1WESA

Solution structure of phd domain in inhibitor of growth family, member 1-like
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
b'GSSGSSGEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inhibitor of growth family, member 1-like
publication title Solution structure of PHD domain in inhibitor of growth family, member 1-like
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 4
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wesA00
2Y43A 2K4DA 5DINA 1X4UA 4P5OB 2YYRA 4R2YA 2QJ0A 3M63A 5EYAF 3HCTA 2VJEB 3ZPV1 2HDPA 5D1LB 5AITA 2C2VS 4QF3A 3FL2A 2KWKA 2KU3A 2YU4A 4QF2A 3U5NA 2PNXA 2I50A 1X4IA 2VPDA 4CA1A 5J3XA 2YHOA 1WEQA 2MIQA 1X4JA 2M6MA 2F42A 4WA6A 4IC3A 2VPGA 1IYMA 2ECGA 1WFKA 1WE9A 3SOWA 1ZBDB 5G04B 2RI7A 4I7CA 5KH9A 2CSYA 4UP0A 4MVTA 4YC9A 2LV9A 2G43A 3NG2A 1K2FA 3O33A 2FUUA 4N4FA 3LQHA 1WEPA 2CKLB 3KV5A 4UI9B 1MM2A 1CHCA 5AIUA 3PUQA 3O36A 2MUMA 3ZVYA 2CSZA 5TDWA 3N9OA 3L1ZB 5I3LA 4WZ3B 4PTBA 1WGMA 3RTRB 3GL6A 2M1RA 3EB5A 2YQLA 4Q6FA 5JG6A 3MHHA 3ZVZB 5H1UA 2D8SA 4L58A 5G05B 3SHBA 2H0DB 1JM7A 1V87A 1WIMA 2YREA 4FO9A 4S3OC 2IDAA 4XI1A 5TDRA 2VJFA 2FSAA 2KREA 1F62A 2ECVA 2LGKA 2KR4A 1HYIA 1E4UA 4N3WA 3L1XA 2EODA 2ECJA 3ASLA 2LXPC 4WZ0A 2MD7B 4GNDA 1HYJA 1G25A 4LK9A 3VK6A 2YSMA 4AYCA 3N9LA 5B75A 5B77A 2YQMA 4GNEA 3N9PA 4I7BA 2K17A 4R7EA 4FJCA 3U5OA 5LKZA 2KWNA 2YURA 4BHWA 2UZGA 4LKAA 2LGLA 3QZVA 1Z2QA 5B76A 5H1TA 2KGIA 3HCSA 1XWHA 2MD8C 2LXHC 2VJEA 1FP0A 3DQVR 1Z60A 2YUCA 1VD4A 3LQIA 2ECIA 3RPGB 5FB1A 1N87A 5G0FA 4I7DA 4FIPA 3PHDA 5TRBA 5LCWB 1FBVA 3C6WA 2VP7A 4B86C 4YABA 1U6GB 4TKPB 2L43A 2EA6A 2YHNA 5LKTA 4B7YC 3I2DA 3IHPA 1VYXA 2QIZA 3O34A 1WEWA 4AVXA 2M3HA 2KYUA 1JOCA 2K16A 4GB0A 2HYED 2LDRA 4WZ2A 2CKLA 2ZETC 3O7AA 4A4BA 4FK5A 4R8PK 1BORA 3KNVA 3M99A 3O35A 4NN2A 4L7XA 2DX8A 2QICA 4YAXA 4GNGA 1Z6UA 4A0CD 3KV6A 2VPBA 3T7LA 1WEMA 2G6QA 5C13A 2JMIA 5TABA 3EB6A 2Y1NA 5D1MB 4F52B 4X3GA 4ZDTA 2E6SA 1WEOA 4PPEA 2L0BA 2MNZA 3DPLR 2KFTA 2FUIA 2RSDA 4AUQB 2H0DA 4LJNA 2AN6A 2JMJA 2MA6A 2NAAA 3HTKC 3ZYQA 2M85A 2YW8A 3O37A 1WEUA 4YBMA 2L80A 2MT5A 3KQIA 3LRQA 1WESA 2LRIC 3O70A 2ECNA 5DKAA 4CCGX 5LKXA 3N9QA 3U5PA 4C9ZA 4IC2A 2KE1A 4LADB 2BAYA 2L5UA 2F6JA 3ZNIA 2ECWA 5KH3A 5B78A 4V3KC 1WENA 2MNYA 5TBNA 3GV4A 4YATA 3ZTGA 5D1KB 2JRJA 4AP4A 4MSXA 2C2LA 4GNFA 5B8DA 5FERA 5FB0A 1MM3A 1WEEA 3RPGC 2KWOA 3V43A 3L11A 5H9MA 2CT2A 2XEUA 2F6NA 3PURA 4V3LC 3N9NA 4LLBA 5H1VA 2LGVA 4YBSA 5FEYA 2VNFA 4ZUXU 4A4CA 3N9MA 4BBQA 1DVPA 3SOXA 2XB1A 2OXQC 4W4UA 1JM7B 5B79A 3MHSA 2VPEA 4A49A 3SOUA 3C5KA 1T1HA 2VJFB 3M62A 2PUYA 2KWJA 1WEVA 2E6RA 3LQJA 5KH7A 3ZPVE 2LQ6A 2K1JA 4S3OB 4YBTA 3T6RA 2L75A 2G45A 1VFYA 1LDJB 4ZQLA 2YSJA 2ECTA 3HCUA 2Y1MA 1RMDA 2KGGA 1LDKC 2YT5A 4UP5A 5C11A 4AYCB 4O64A 2LGGA 2MA5A 1WILA 2LN0A 4YADA 2JMDA 3U5MA 2KIZA 5LKUA 2EGPA
chains in the Genus database with same CATH superfamily
2Y43A 2K4DA 2D8UA 5DINA 1X4UA 4F1PA 4P5OB 2YYRA 5SVIA 2OWAA 2CRWA 4R2YA 2QJ0A 3M63A 5EYAF 3HCTA 2VJEB 3ZPV1 2HDPA 5D1LB 5AITA 2C2VS 4QF3A 3FL2A 2KWKA 2KU3A 2YU4A 4QF2A 3U5NA 2PNXA 2I50A 1X4IA 2VPDA 4CA1A 5J3XA 2YHOA 1WEQA 2DJAA 2XOYA 2MIQA 1X4JA 2M6MA 2P57A 2F42A 4WA6A 4IC3A 2EXUA 3LJUX 2VPGA 2FD4A 1IYMA 2ECGA 1WFKA 1WE9A 3SOWA 1ZBDB 2YVRA 5G04B 2RI7A 4I7CA 5KH9A 2CSYA 2JM3A 4UP0A 4MVTA 3Q1DA 4YC9A 2LV9A 2G43A 3NG2A 1K2FA 3O33A 2FUUA 4N4FA 3LQHA 1WEPA 2CKLB 2CSVA 3KV5A 4UI9B 1MM2A 1CHCA 5AIUA 3PUQA 3O36A 2MUMA 3ZVYA 2CSZA 5TDWA 2XOZA 3N9OA 3L1ZB 5I3LA 3FEHA 4WZ3B 4PTBA 1WGMA 3RTRB 3FJUB 2FFWA 3DWDA 3GL6A 1MBMA 2M1RA 3EB5A 2YQLA 4Q6FA 5JG6A 3JUEA 3MHHA 3ZVZB 5H1UA 2D8SA 4L58A 5G05B 3SHBA 2H0DB 1JM7A 3FM8C 1V87A 1WIMA 2YREA 4FO9A 4S3OC 2IDAA 4XI1A 5TDRA 2M13A 2VJFA 3SUBA 2FSAA 2KREA 1F62A 2ECVA 2LGKA 2KR4A 1HYIA 2CONA 1E4UA 4N3WA 3L1XA 2EODA 2ECJA 3ASLA 2LXPC 4WZ0A 2MD7B 4GNDA 1HYJA 1G25A 4LK9A 3VK6A 3O47A 2YSMA 4AYCA 3N9LA 5B75A 4O62A 5B77A 2YQMA 4GNEA 3N9PA 2B0OE 4I7BA 2K17A 2XOCA 4R7EA 4FJCA 3U5OA 5LKZA 2KWNA 2YURA 2EGMA 4BHWA 2UZGA 4LKAA 2LGLA 3QZVA 1Z2QA 5B76A 5H1TA 2DSMA 2KGIA 3HCSA 1XWHA 2MD8C 2LXHC 2VJEA 1FP0A 3DQVR 1Z60A 4OGCA 2YUCA 1VD4A 3LQIA 2ECIA 3E2DA 3FAOA 3RPGB 5FB1A 1N87A 5G0FA 4I7DA 4FIPA 3PHDA 5TRBA 5LCWB 2RR4A 1FBVA 3C6WA 2VP7A 4B86C 4YABA 1U6GB 4TKPB 2L43A 2EA6A 2YHNA 5LKTA 4B7YC 3I2DA 3IHPA 1VYXA 2QIZA 3O34A 1WEWA 4AVXA 2M3HA 2KYUA 1JOCA 2K16A 4GB0A 2HYED 2CRRA 2LDRA 4WZ2A 2CKLA 2ZETC 3O7AA 4A4BA 2JUNA 4FK5A 2XP0A 4R8PK 4Z0RA 1BORA 3KNVA 3M99A 3O35A 4NN2A 4L7XA 2DX8A 2QICA 4YAXA 4GNGA 1Z6UA 4A0CD 3KV6A 2VPBA 3T7LA 1WEMA 2G6QA 5C13A 2JMIA 2MKEA 5TABA 3EB6A 5SVXA 2Y1NA 5D1MB 4F52B 4X3GA 4ZDTA 2E6SA 1WEOA 4PPEA 2L0BA 2MNZA 3DPLR 2KFTA 2FUIA 3FANA 2RSDA 5SVIB 4AUQB 2H0DA 3PLWA 4LJNA 2AN6A 2JMJA 2MA6A 2NAAA 5K3QA 2KKYA 3HTKC 3ZYQA 2M85A 2YW8A 3O37A 1WEUA 4YBMA 2L80A 2MT5A 3KQIA 3LRQA 1WESA 3LVRE 2LRIC 3O70A 1DCQA 2L7PA 2ECNA 5DKAA 4CCGX 5LKXA 3N9QA 3U5PA 4C9ZA 4IC2A 2KE1A 4LADB 2BAYA 2L5UA 2F6JA 3ZNIA 2ECWA 4H9DA 2LAUA 5KH3A 5B78A 4V3KC 1WENA 2MNYA 3KDEC 5TBNA 3T9KA 3GV4A 4YATA 3ZTGA 3M7KA 5D1KB 2JRJA 4AP4A 4MSXA 2C2LA 4GNFA 5B8DA 5FERA 5FB0A 1MM3A 1WEEA 3RPGC 2KWOA 3V43A 3L11A 5H9MA 2CT2A 2XEUA 5SVYA 2F6NA 3PURA 4V3LC 4LLBA 3N9NA 2KKXA 5H1VA 2LGVA 4YBSA 5FEYA 2VNFA 4ZUXU 4A4CA 3H7HA 3N9MA 4BBQA 1DVPA 3SOXA 2XB1A 2OXQC 4W4UA 1JM7B 5B79A 3LVQE 3MHSA 2VPEA 4A49A 3SOUA 3C5KA 2E61A 1T1HA 2VJFB 3M62A 2PUYA 2KWJA 3DDTA 1WEVA 2E6RA 3LQJA 5KH7A 3ZPVE 2LQ6A 2K1JA 4OGEA 2IQJA 4QQ4A 4S3OB 4YBTA 3T6RA 2L75A 2G45A 1VFYA 1LDJB 4ZQLA 2YSJA 2ECTA 3HCUA 2Y1MA 3MDBC 1RMDA 2KGGA 4Z0OA 1LDKC 2YT5A 4UP5A 5C11A 4AYCB 4O64A 2LGGA 2MA5A 1WILA 2LN0A 4YADA 2JMDA 3U5MA 2KIZA 3LDYA 5LKUA 2EGPA
chains in the Genus database with same CATH topology
2Y43A 2K4DA 5DINA 1X4UA 4P5OB 2YYRA 4R2YA 2QJ0A 3M63A 5EYAF 3HCTA 2VJEB 3ZPV1 2HDPA 5D1LB 5AITA 2C2VS 4QF3A 3FL2A 2KWKA 2KU3A 2YU4A 4QF2A 3U5NA 2PNXA 2I50A 1X4IA 2VPDA 4CA1A 5J3XA 2YHOA 1WEQA 2MIQA 1X4JA 2M6MA 2F42A 4WA6A 4IC3A 2VPGA 1IYMA 2ECGA 1WFKA 1WE9A 3SOWA 1ZBDB 5G04B 2RI7A 4I7CA 5KH9A 2CSYA 4UP0A 4MVTA 4YC9A 2LV9A 2G43A 3NG2A 1K2FA 3O33A 2FUUA 4N4FA 3LQHA 1WEPA 2CKLB 3KV5A 4UI9B 1MM2A 1CHCA 5AIUA 3PUQA 3O36A 2MUMA 3ZVYA 2CSZA 5TDWA 3N9OA 3L1ZB 5I3LA 4WZ3B 4PTBA 1WGMA 3RTRB 3GL6A 2M1RA 3EB5A 2YQLA 4Q6FA 5JG6A 3MHHA 3ZVZB 5H1UA 2D8SA 4L58A 5G05B 3SHBA 2H0DB 1JM7A 1V87A 1WIMA 2YREA 4FO9A 4S3OC 2IDAA 4XI1A 5TDRA 2VJFA 2FSAA 2KREA 1F62A 2ECVA 2LGKA 2KR4A 1HYIA 1E4UA 4N3WA 3L1XA 2EODA 2ECJA 3ASLA 2LXPC 4WZ0A 2MD7B 4GNDA 1HYJA 1G25A 4LK9A 3VK6A 2YSMA 4AYCA 3N9LA 5B75A 5B77A 2YQMA 4GNEA 3N9PA 4I7BA 2K17A 4R7EA 4FJCA 3U5OA 5LKZA 2KWNA 2YURA 4BHWA 2UZGA 4LKAA 2LGLA 3QZVA 1Z2QA 5B76A 5H1TA 2KGIA 3HCSA 1XWHA 2MD8C 2LXHC 2VJEA 1FP0A 3DQVR 1Z60A 2YUCA 1VD4A 3LQIA 2ECIA 3RPGB 5FB1A 1N87A 5G0FA 4I7DA 4FIPA 3PHDA 5TRBA 5LCWB 1FBVA 3C6WA 2VP7A 4B86C 4YABA 1U6GB 4TKPB 2L43A 2EA6A 2YHNA 5LKTA 4B7YC 3I2DA 3IHPA 1VYXA 2QIZA 3O34A 1WEWA 4AVXA 2M3HA 2KYUA 1JOCA 2K16A 4GB0A 2HYED 2LDRA 4WZ2A 2CKLA 2ZETC 3O7AA 4A4BA 4FK5A 4R8PK 1BORA 3KNVA 3M99A 3O35A 4NN2A 4L7XA 2DX8A 2QICA 4YAXA 4GNGA 1Z6UA 4A0CD 3KV6A 2VPBA 3T7LA 1WEMA 2G6QA 5C13A 2JMIA 5TABA 3EB6A 2Y1NA 5D1MB 4F52B 4X3GA 4ZDTA 2E6SA 1WEOA 4PPEA 2L0BA 2MNZA 3DPLR 2KFTA 2FUIA 2RSDA 4AUQB 2H0DA 4LJNA 2AN6A 2JMJA 2MA6A 2NAAA 3HTKC 3ZYQA 2M85A 2YW8A 3O37A 1WEUA 4YBMA 2L80A 2MT5A 3KQIA 3LRQA 1WESA 2LRIC 3O70A 2ECNA 5DKAA 4CCGX 5LKXA 3N9QA 3U5PA 4C9ZA 4IC2A 2KE1A 4LADB 2BAYA 2L5UA 2F6JA 3ZNIA 2ECWA 5KH3A 5B78A 4V3KC 1WENA 2MNYA 5TBNA 3GV4A 4YATA 3ZTGA 5D1KB 2JRJA 4AP4A 4MSXA 2C2LA 4GNFA 5B8DA 5FERA 5FB0A 1MM3A 1WEEA 3RPGC 2KWOA 3V43A 3L11A 5H9MA 2CT2A 2XEUA 2F6NA 3PURA 4V3LC 3N9NA 4LLBA 5H1VA 2LGVA 4YBSA 5FEYA 2VNFA 4ZUXU 4A4CA 3N9MA 4BBQA 1DVPA 3SOXA 2XB1A 2OXQC 4W4UA 1JM7B 5B79A 3MHSA 2VPEA 4A49A 3SOUA 3C5KA 1T1HA 2VJFB 3M62A 2PUYA 2KWJA 1WEVA 2E6RA 3LQJA 5KH7A 3ZPVE 2LQ6A 2K1JA 4S3OB 4YBTA 3T6RA 2L75A 2G45A 1VFYA 1LDJB 4ZQLA 2YSJA 2ECTA 3HCUA 2Y1MA 1RMDA 2KGGA 1LDKC 2YT5A 4UP5A 5C11A 4AYCB 4O64A 2LGGA 2MA5A 1WILA 2LN0A 4YADA 2JMDA 3U5MA 2KIZA 5LKUA 2EGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y43 A;  2K4D A;  5DIN A;  1X4U A;  4P5O B;  2YYR A;  4R2Y A;  2QJ0 A;  3M63 A;  5EYA F;  3HCT A;  2VJE B;  3ZPV 1;  2HDP A;  5D1L B;  5AIT A;  2C2V S;  4QF3 A;  3FL2 A;  2KWK A;  2KU3 A;  2YU4 A;  4QF2 A;  3U5N A;  2PNX A;  2I50 A;  1X4I A;  2VPD A;  4CA1 A;  5J3X A;  2YHO A;  1WEQ A;  2MIQ A;  1X4J A;  2M6M A;  2F42 A;  4WA6 A;  4IC3 A;  2VPG A;  1IYM A;  2ECG A;  1WFK A;  1WE9 A;  3SOW A;  1ZBD B;  5G04 B;  2RI7 A;  4I7C A;  5KH9 A;  2CSY A;  4UP0 A;  4MVT A;  4YC9 A;  2LV9 A;  2G43 A;  3NG2 A;  1K2F A;  3O33 A;  2FUU A;  4N4F A;  3LQH A;  1WEP A;  2CKL B;  3KV5 A;  4UI9 B;  1MM2 A;  1CHC A;  5AIU A;  3PUQ A;  3O36 A;  2MUM A;  3ZVY A;  2CSZ A;  5TDW A;  3N9O A;  3L1Z B;  5I3L A;  4WZ3 B;  4PTB A;  1WGM A;  3RTR B;  3GL6 A;  2M1R A;  3EB5 A;  2YQL A;  4Q6F A;  5JG6 A;  3MHH A;  3ZVZ B;  5H1U A;  2D8S A;  4L58 A;  5G05 B;  3SHB A;  2H0D B;  1JM7 A;  1V87 A;  1WIM A;  2YRE A;  4FO9 A;  4S3O C;  2IDA A;  4XI1 A;  5TDR A;  2VJF A;  2FSA A;  2KRE A;  1F62 A;  2ECV A;  2LGK A;  2KR4 A;  1HYI A;  1E4U A;  4N3W A;  3L1X A;  2EOD A;  2ECJ A;  3ASL A;  2LXP C;  4WZ0 A;  2MD7 B;  4GND A;  1HYJ A;  1G25 A;  4LK9 A;  3VK6 A;  2YSM A;  4AYC A;  3N9L A;  5B75 A;  5B77 A;  2YQM A;  4GNE A;  3N9P A;  4I7B A;  2K17 A;  4R7E A;  4FJC A;  3U5O A;  5LKZ A;  2KWN A;  2YUR A;  4BHW A;  2UZG A;  4LKA A;  2LGL A;  3QZV A;  1Z2Q A;  5B76 A;  5H1T A;  2KGI A;  3HCS A;  1XWH A;  2MD8 C;  2LXH C;  2VJE A;  1FP0 A;  3DQV R;  1Z60 A;  2YUC A;  1VD4 A;  3LQI A;  2ECI A;  3RPG B;  5FB1 A;  1N87 A;  5G0F A;  4I7D A;  4FIP A;  3PHD A;  5TRB A;  5LCW B;  1FBV A;  3C6W A;  2VP7 A;  4B86 C;  4YAB A;  1U6G B;  4TKP B;  2L43 A;  2EA6 A;  2YHN A;  5LKT A;  4B7Y C;  3I2D A;  3IHP A;  1VYX A;  2QIZ A;  3O34 A;  1WEW A;  4AVX A;  2M3H A;  2KYU A;  1JOC A;  2K16 A;  4GB0 A;  2HYE D;  2LDR A;  4WZ2 A;  2CKL A;  2ZET C;  3O7A A;  4A4B A;  4FK5 A;  4R8P K;  1BOR A;  3KNV A;  3M99 A;  3O35 A;  4NN2 A;  4L7X A;  2DX8 A;  2QIC A;  4YAX A;  4GNG A;  1Z6U A;  4A0C D;  3KV6 A;  2VPB A;  3T7L A;  1WEM A;  2G6Q A;  5C13 A;  2JMI A;  5TAB A;  3EB6 A;  2Y1N A;  5D1M B;  4F52 B;  4X3G A;  4ZDT A;  2E6S A;  1WEO A;  4PPE A;  2L0B A;  2MNZ A;  3DPL R;  2KFT A;  2FUI A;  2RSD A;  4AUQ B;  2H0D A;  4LJN A;  2AN6 A;  2JMJ A;  2MA6 A;  2NAA A;  3HTK C;  3ZYQ A;  2M85 A;  2YW8 A;  3O37 A;  1WEU A;  4YBM A;  2L80 A;  2MT5 A;  3KQI A;  3LRQ A;  1WES A;  2LRI C;  3O70 A;  2ECN A;  5DKA A;  4CCG X;  5LKX A;  3N9Q A;  3U5P A;  4C9Z A;  4IC2 A;  2KE1 A;  4LAD B;  2BAY A;  2L5U A;  2F6J A;  3ZNI A;  2ECW A;  5KH3 A;  5B78 A;  4V3K C;  1WEN A;  2MNY A;  5TBN A;  3GV4 A;  4YAT A;  3ZTG A;  5D1K B;  2JRJ A;  4AP4 A;  4MSX A;  2C2L A;  4GNF A;  5B8D A;  5FER A;  5FB0 A;  1MM3 A;  1WEE A;  3RPG C;  2KWO A;  3V43 A;  3L11 A;  5H9M A;  2CT2 A;  2XEU A;  2F6N A;  3PUR A;  4V3L C;  3N9N A;  4LLB A;  5H1V A;  2LGV A;  4YBS A;  5FEY A;  2VNF A;  4ZUX U;  4A4C A;  3N9M A;  4BBQ A;  1DVP A;  3SOX A;  2XB1 A;  2OXQ C;  4W4U A;  1JM7 B;  5B79 A;  3MHS A;  2VPE A;  4A49 A;  3SOU A;  3C5K A;  1T1H A;  2VJF B;  3M62 A;  2PUY A;  2KWJ A;  1WEV A;  2E6R A;  3LQJ A;  5KH7 A;  3ZPV E;  2LQ6 A;  2K1J A;  4S3O B;  4YBT A;  3T6R A;  2L75 A;  2G45 A;  1VFY A;  1LDJ B;  4ZQL A;  2YSJ A;  2ECT A;  3HCU A;  2Y1M A;  1RMD A;  2KGG A;  1LDK C;  2YT5 A;  4UP5 A;  5C11 A;  4AYC B;  4O64 A;  2LGG A;  2MA5 A;  1WIL A;  2LN0 A;  4YAD A;  2JMD A;  3U5M A;  2KIZ A;  5LKU A;  2EGP A; 
#chains in the Genus database with same CATH topology
 2Y43 A;  2K4D A;  2D8U A;  5DIN A;  1X4U A;  4F1P A;  4P5O B;  2YYR A;  5SVI A;  2OWA A;  2CRW A;  4R2Y A;  2QJ0 A;  3M63 A;  5EYA F;  3HCT A;  2VJE B;  3ZPV 1;  2HDP A;  5D1L B;  5AIT A;  2C2V S;  4QF3 A;  3FL2 A;  2KWK A;  2KU3 A;  2YU4 A;  4QF2 A;  3U5N A;  2PNX A;  2I50 A;  1X4I A;  2VPD A;  4CA1 A;  5J3X A;  2YHO A;  1WEQ A;  2DJA A;  2XOY A;  2MIQ A;  1X4J A;  2M6M A;  2P57 A;  2F42 A;  4WA6 A;  4IC3 A;  2EXU A;  3LJU X;  2VPG A;  2FD4 A;  1IYM A;  2ECG A;  1WFK A;  1WE9 A;  3SOW A;  1ZBD B;  2YVR A;  5G04 B;  2RI7 A;  4I7C A;  5KH9 A;  2CSY A;  2JM3 A;  4UP0 A;  4MVT A;  3Q1D A;  4YC9 A;  2LV9 A;  2G43 A;  3NG2 A;  1K2F A;  3O33 A;  2FUU A;  4N4F A;  3LQH A;  1WEP A;  2CKL B;  2CSV A;  3KV5 A;  4UI9 B;  1MM2 A;  1CHC A;  5AIU A;  3PUQ A;  3O36 A;  2MUM A;  3ZVY A;  2CSZ A;  5TDW A;  2XOZ A;  3N9O A;  3L1Z B;  5I3L A;  3FEH A;  4WZ3 B;  4PTB A;  1WGM A;  3RTR B;  3FJU B;  2FFW A;  3DWD A;  3GL6 A;  1MBM A;  2M1R A;  3EB5 A;  2YQL A;  4Q6F A;  5JG6 A;  3JUE A;  3MHH A;  3ZVZ B;  5H1U A;  2D8S A;  4L58 A;  5G05 B;  3SHB A;  2H0D B;  1JM7 A;  3FM8 C;  1V87 A;  1WIM A;  2YRE A;  4FO9 A;  4S3O C;  2IDA A;  4XI1 A;  5TDR A;  2M13 A;  2VJF A;  3SUB A;  2FSA A;  2KRE A;  1F62 A;  2ECV A;  2LGK A;  2KR4 A;  1HYI A;  2CON A;  1E4U A;  4N3W A;  3L1X A;  2EOD A;  2ECJ A;  3ASL A;  2LXP C;  4WZ0 A;  2MD7 B;  4GND A;  1HYJ A;  1G25 A;  4LK9 A;  3VK6 A;  3O47 A;  2YSM A;  4AYC A;  3N9L A;  5B75 A;  4O62 A;  5B77 A;  2YQM A;  4GNE A;  3N9P A;  2B0O E;  4I7B A;  2K17 A;  2XOC A;  4R7E A;  4FJC A;  3U5O A;  5LKZ A;  2KWN A;  2YUR A;  2EGM A;  4BHW A;  2UZG A;  4LKA A;  2LGL A;  3QZV A;  1Z2Q A;  5B76 A;  5H1T A;  2DSM A;  2KGI A;  3HCS A;  1XWH A;  2MD8 C;  2LXH C;  2VJE A;  1FP0 A;  3DQV R;  1Z60 A;  4OGC A;  2YUC A;  1VD4 A;  3LQI A;  2ECI A;  3E2D A;  3FAO A;  3RPG B;  5FB1 A;  1N87 A;  5G0F A;  4I7D A;  4FIP A;  3PHD A;  5TRB A;  5LCW B;  2RR4 A;  1FBV A;  3C6W A;  2VP7 A;  4B86 C;  4YAB A;  1U6G B;  4TKP B;  2L43 A;  2EA6 A;  2YHN A;  5LKT A;  4B7Y C;  3I2D A;  3IHP A;  1VYX A;  2QIZ A;  3O34 A;  1WEW A;  4AVX A;  2M3H A;  2KYU A;  1JOC A;  2K16 A;  4GB0 A;  2HYE D;  2CRR A;  2LDR A;  4WZ2 A;  2CKL A;  2ZET C;  3O7A A;  4A4B A;  2JUN A;  4FK5 A;  2XP0 A;  4R8P K;  4Z0R A;  1BOR A;  3KNV A;  3M99 A;  3O35 A;  4NN2 A;  4L7X A;  2DX8 A;  2QIC A;  4YAX A;  4GNG A;  1Z6U A;  4A0C D;  3KV6 A;  2VPB A;  3T7L A;  1WEM A;  2G6Q A;  5C13 A;  2JMI A;  2MKE A;  5TAB A;  3EB6 A;  5SVX A;  2Y1N A;  5D1M B;  4F52 B;  4X3G A;  4ZDT A;  2E6S A;  1WEO A;  4PPE A;  2L0B A;  2MNZ A;  3DPL R;  2KFT A;  2FUI A;  3FAN A;  2RSD A;  5SVI B;  4AUQ B;  2H0D A;  3PLW A;  4LJN A;  2AN6 A;  2JMJ A;  2MA6 A;  2NAA A;  5K3Q A;  2KKY A;  3HTK C;  3ZYQ A;  2M85 A;  2YW8 A;  3O37 A;  1WEU A;  4YBM A;  2L80 A;  2MT5 A;  3KQI A;  3LRQ A;  1WES A;  3LVR E;  2LRI C;  3O70 A;  1DCQ A;  2L7P A;  2ECN A;  5DKA A;  4CCG X;  5LKX A;  3N9Q A;  3U5P A;  4C9Z A;  4IC2 A;  2KE1 A;  4LAD B;  2BAY A;  2L5U A;  2F6J A;  3ZNI A;  2ECW A;  4H9D A;  2LAU A;  5KH3 A;  5B78 A;  4V3K C;  1WEN A;  2MNY A;  3KDE C;  5TBN A;  3T9K A;  3GV4 A;  4YAT A;  3ZTG A;  3M7K A;  5D1K B;  2JRJ A;  4AP4 A;  4MSX A;  2C2L A;  4GNF A;  5B8D A;  5FER A;  5FB0 A;  1MM3 A;  1WEE A;  3RPG C;  2KWO A;  3V43 A;  3L11 A;  5H9M A;  2CT2 A;  2XEU A;  5SVY A;  2F6N A;  3PUR A;  4V3L C;  4LLB A;  3N9N A;  2KKX A;  5H1V A;  2LGV A;  4YBS A;  5FEY A;  2VNF A;  4ZUX U;  4A4C A;  3H7H A;  3N9M A;  4BBQ A;  1DVP A;  3SOX A;  2XB1 A;  2OXQ C;  4W4U A;  1JM7 B;  5B79 A;  3LVQ E;  3MHS A;  2VPE A;  4A49 A;  3SOU A;  3C5K A;  2E61 A;  1T1H A;  2VJF B;  3M62 A;  2PUY A;  2KWJ A;  3DDT A;  1WEV A;  2E6R A;  3LQJ A;  5KH7 A;  3ZPV E;  2LQ6 A;  2K1J A;  4OGE A;  2IQJ A;  4QQ4 A;  4S3O B;  4YBT A;  3T6R A;  2L75 A;  2G45 A;  1VFY A;  1LDJ B;  4ZQL A;  2YSJ A;  2ECT A;  3HCU A;  2Y1M A;  3MDB C;  1RMD A;  2KGG A;  4Z0O A;  1LDK C;  2YT5 A;  4UP5 A;  5C11 A;  4AYC B;  4O64 A;  2LGG A;  2MA5 A;  1WIL A;  2LN0 A;  4YAD A;  2JMD A;  3U5M A;  2KIZ A;  3LDY A;  5LKU A;  2EGP A; 
#chains in the Genus database with same CATH homology
 2Y43 A;  2K4D A;  5DIN A;  1X4U A;  4P5O B;  2YYR A;  4R2Y A;  2QJ0 A;  3M63 A;  5EYA F;  3HCT A;  2VJE B;  3ZPV 1;  2HDP A;  5D1L B;  5AIT A;  2C2V S;  4QF3 A;  3FL2 A;  2KWK A;  2KU3 A;  2YU4 A;  4QF2 A;  3U5N A;  2PNX A;  2I50 A;  1X4I A;  2VPD A;  4CA1 A;  5J3X A;  2YHO A;  1WEQ A;  2MIQ A;  1X4J A;  2M6M A;  2F42 A;  4WA6 A;  4IC3 A;  2VPG A;  1IYM A;  2ECG A;  1WFK A;  1WE9 A;  3SOW A;  1ZBD B;  5G04 B;  2RI7 A;  4I7C A;  5KH9 A;  2CSY A;  4UP0 A;  4MVT A;  4YC9 A;  2LV9 A;  2G43 A;  3NG2 A;  1K2F A;  3O33 A;  2FUU A;  4N4F A;  3LQH A;  1WEP A;  2CKL B;  3KV5 A;  4UI9 B;  1MM2 A;  1CHC A;  5AIU A;  3PUQ A;  3O36 A;  2MUM A;  3ZVY A;  2CSZ A;  5TDW A;  3N9O A;  3L1Z B;  5I3L A;  4WZ3 B;  4PTB A;  1WGM A;  3RTR B;  3GL6 A;  2M1R A;  3EB5 A;  2YQL A;  4Q6F A;  5JG6 A;  3MHH A;  3ZVZ B;  5H1U A;  2D8S A;  4L58 A;  5G05 B;  3SHB A;  2H0D B;  1JM7 A;  1V87 A;  1WIM A;  2YRE A;  4FO9 A;  4S3O C;  2IDA A;  4XI1 A;  5TDR A;  2VJF A;  2FSA A;  2KRE A;  1F62 A;  2ECV A;  2LGK A;  2KR4 A;  1HYI A;  1E4U A;  4N3W A;  3L1X A;  2EOD A;  2ECJ A;  3ASL A;  2LXP C;  4WZ0 A;  2MD7 B;  4GND A;  1HYJ A;  1G25 A;  4LK9 A;  3VK6 A;  2YSM A;  4AYC A;  3N9L A;  5B75 A;  5B77 A;  2YQM A;  4GNE A;  3N9P A;  4I7B A;  2K17 A;  4R7E A;  4FJC A;  3U5O A;  5LKZ A;  2KWN A;  2YUR A;  4BHW A;  2UZG A;  4LKA A;  2LGL A;  3QZV A;  1Z2Q A;  5B76 A;  5H1T A;  2KGI A;  3HCS A;  1XWH A;  2MD8 C;  2LXH C;  2VJE A;  1FP0 A;  3DQV R;  1Z60 A;  2YUC A;  1VD4 A;  3LQI A;  2ECI A;  3RPG B;  5FB1 A;  1N87 A;  5G0F A;  4I7D A;  4FIP A;  3PHD A;  5TRB A;  5LCW B;  1FBV A;  3C6W A;  2VP7 A;  4B86 C;  4YAB A;  1U6G B;  4TKP B;  2L43 A;  2EA6 A;  2YHN A;  5LKT A;  4B7Y C;  3I2D A;  3IHP A;  1VYX A;  2QIZ A;  3O34 A;  1WEW A;  4AVX A;  2M3H A;  2KYU A;  1JOC A;  2K16 A;  4GB0 A;  2HYE D;  2LDR A;  4WZ2 A;  2CKL A;  2ZET C;  3O7A A;  4A4B A;  4FK5 A;  4R8P K;  1BOR A;  3KNV A;  3M99 A;  3O35 A;  4NN2 A;  4L7X A;  2DX8 A;  2QIC A;  4YAX A;  4GNG A;  1Z6U A;  4A0C D;  3KV6 A;  2VPB A;  3T7L A;  1WEM A;  2G6Q A;  5C13 A;  2JMI A;  5TAB A;  3EB6 A;  2Y1N A;  5D1M B;  4F52 B;  4X3G A;  4ZDT A;  2E6S A;  1WEO A;  4PPE A;  2L0B A;  2MNZ A;  3DPL R;  2KFT A;  2FUI A;  2RSD A;  4AUQ B;  2H0D A;  4LJN A;  2AN6 A;  2JMJ A;  2MA6 A;  2NAA A;  3HTK C;  3ZYQ A;  2M85 A;  2YW8 A;  3O37 A;  1WEU A;  4YBM A;  2L80 A;  2MT5 A;  3KQI A;  3LRQ A;  1WES A;  2LRI C;  3O70 A;  2ECN A;  5DKA A;  4CCG X;  5LKX A;  3N9Q A;  3U5P A;  4C9Z A;  4IC2 A;  2KE1 A;  4LAD B;  2BAY A;  2L5U A;  2F6J A;  3ZNI A;  2ECW A;  5KH3 A;  5B78 A;  4V3K C;  1WEN A;  2MNY A;  5TBN A;  3GV4 A;  4YAT A;  3ZTG A;  5D1K B;  2JRJ A;  4AP4 A;  4MSX A;  2C2L A;  4GNF A;  5B8D A;  5FER A;  5FB0 A;  1MM3 A;  1WEE A;  3RPG C;  2KWO A;  3V43 A;  3L11 A;  5H9M A;  2CT2 A;  2XEU A;  2F6N A;  3PUR A;  4V3L C;  3N9N A;  4LLB A;  5H1V A;  2LGV A;  4YBS A;  5FEY A;  2VNF A;  4ZUX U;  4A4C A;  3N9M A;  4BBQ A;  1DVP A;  3SOX A;  2XB1 A;  2OXQ C;  4W4U A;  1JM7 B;  5B79 A;  3MHS A;  2VPE A;  4A49 A;  3SOU A;  3C5K A;  1T1H A;  2VJF B;  3M62 A;  2PUY A;  2KWJ A;  1WEV A;  2E6R A;  3LQJ A;  5KH7 A;  3ZPV E;  2LQ6 A;  2K1J A;  4S3O B;  4YBT A;  3T6R A;  2L75 A;  2G45 A;  1VFY A;  1LDJ B;  4ZQL A;  2YSJ A;  2ECT A;  3HCU A;  2Y1M A;  1RMD A;  2KGG A;  1LDK C;  2YT5 A;  4UP5 A;  5C11 A;  4AYC B;  4O64 A;  2LGG A;  2MA5 A;  1WIL A;  2LN0 A;  4YAD A;  2JMD A;  3U5M A;  2KIZ A;  5LKU A;  2EGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...