1WESA

Solution structure of phd domain in inhibitor of growth family, member 1-like
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
71
structure length
71
Chain Sequence
GSSGSSGEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inhibitor of growth family, member 1-like
publication title Solution structure of PHD domain in inhibitor of growth family, member 1-like
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 4
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wesA00
2MNZA 1WE9A 4UP0A 1WEUA 1WEEA 2CSZA 5H9MA 2K17A 5FB0A 1JM7B 1WILA 2K4DA 3ZYQA 5LKTA 2YQMA 3V43A 4A4BA 4A4CA 1CHCA 2QJ0A 2CKLA 3M62A 4QF2A 1X4UA 2XEUA 3PUQA 5DKAA 4UI9B 4AP4A 3PURA 4YBTA 4MSXA 3ZPV1 2PUYA 2YHOA 4YBSA 4YBMA 4S3OB 1RMDA 3PHDA 3U5NA 3RPGB 2BAYA 4TKPB 5TDRA 2M6MA 2ECIA 2IDAA 5TRBA 5TBNA 2UZGA 3KQIA 2YUCA 1LDJB 4QF3A 5H1TA 3QZVA 5LCWB 5B79A 3L1ZB 2VPBA 2KR4A 1G25A 3L1XA 4PPEA 2VJFB 4C9ZA 2VPDA 3T6RA 2KFTA 2ECGA 5LKZA 2LGLA 4GNGA 1VFYA 3LRQA 5TABA 2MIQA 3HCUA 2HDPA 2LXHC 2E6SA 4BBQA 2YQLA 1U6GB 4YABA 4W4UA 4AYCB 2DX8A 2K16A 1HYJA 4FJCA 2ZETC 2LGKA 2YYRA 4UP5A 3N9LA 4A49A 3RPGC 4XI1A 1WEPA 1K2FA 2C2LA 2YSMA 4V3KC 3M99A 5I3LA 4X3GA 2KREA 5J3XA 2KWOA 1WGMA 2LRIC 4GB0A 4LJNA 2FSAA 2HYED 2ECTA 3DQVR 2ECVA 4YAXA 5KH3A 2F42A 3N9OA 3ZNIA 2KGIA 2LDRA 2G45A 2VJEA 4YADA 2YREA 2CKLB 1WESA 2ECNA 3KV5A 3O35A 3LQIA 2YW8A 2G6QA 3O34A 5D1LB 4GNDA 1WIMA 2F6JA 2QIZA 1JOCA 1MM3A 4FK5A 3O33A 2RI7A 4LK9A 1DVPA 2YHNA 4Q6FA 2KWNA 3KV6A 3MHHA 1V87A 4BHWA 2EODA 5G05B 1X4JA 3SOWA 4R8PK 2JMIA 1Z60A 5D1KB 5B8DA 2L75A 2CT2A 3LQHA 2FUIA 3N9PA 5LKXA 2MD7B 4GNFA 2YURA 2L43A 4ZDTA 4CCGX 4ZQLA 2L80A 1MM2A 1E4UA 2JRJA 2VPGA 4LADB 4FIPA 3EB6A 2L0BA 5B75A 5FEYA 5H1UA 5JG6A 1WEMA 3EB5A 4YATA 2LGVA 4S3OC 2VJFA 2H0DA 2ECJA 3NG2A 3ZVZB 3SOXA 2PNXA 5G0FA 2I50A 2JMDA 2MA6A 4ZUXU 2VPEA 2ECWA 2KGGA 3O36A 4NN2A 1IYMA 2AN6A 4PTBA 2Y1NA 3C6WA 3FL2A 1WEWA 2LN0A 5G04B 1FBVA 5DINA 2LGGA 3U5OA 4WZ0A 1BORA 4AUQB 4WZ2A 2MUMA 1Z2QA 2M85A 5D1MB 3HTKC 2MT5A 5B77A 4L7XA 3SHBA 1WEQA 4AVXA 3O37A 2FUUA 1WEVA 4R2YA 3IHPA 2VP7A 2JMJA 1LDKC 1VYXA 1VD4A 4LKAA 1N87A 4L58A 4I7CA 1T1HA 1FP0A 1WEOA 3O7AA 3MHSA 3C5KA 2MD8C 2M1RA 4P5OB 2D8SA 1JM7A 5KH7A 5AITA 3ZVYA 3N9NA 4WZ3B 3U5MA 4IC2A 2RSDA 2YU4A 4LLBA 4FO9A 3L11A 5B78A 4GNEA 4B86C 5FERA 2LQ6A 2VNFA 4A0CD 1Z6UA 4IC3A 1XWHA 5LKUA 4YC9A 3ZTGA 2KE1A 1X4IA 1WFKA 2KIZA 4CA1A 3O70A 2MNYA 5AIUA 2LXPC 2E6RA 2K1JA 2KU3A 2KYUA 2YT5A 3SOUA 4I7DA 2H0DB 2NAAA 2F6NA 3ZPVE 3RTRB 5C13A 2EGPA 4I7BA 4R7EA 2Y1MA 4B7YC 2KWJA 3HCSA 1F62A 3VK6A 1ZBDB 2XB1A 3U5PA 3LQJA 4N4FA 5FB1A 5TDWA 4F52B 1HYIA 3GV4A 2M3HA 3M63A 4V3LC 2MA5A 5KH9A 2VJEB 3GL6A 4MVTA 2G43A 3N9MA 3KNVA 4AYCA 3T7LA 3ASLA 5EYAF 4N3WA 2KWKA 2OXQC 3I2DA 4WA6A 1WENA 5H1VA 2Y43A 3N9QA 2EA6A 3DPLR 2L5UA 2C2VS 2CSYA 5C11A 2QICA 3HCTA 4O64A 2YSJA 5B76A 2LV9A
chains in the Genus database with same CATH superfamily
2MNZA 1WE9A 4UP0A 1WEUA 1WEEA 2CSZA 2D8UA 5H9MA 2K17A 5FB0A 1JM7B 1WILA 2K4DA 3ZYQA 2JM3A 5LKTA 2YQMA 3V43A 4A4BA 4A4CA 1CHCA 2QJ0A 2CKLA 3M62A 4QF2A 1X4UA 2XEUA 3PUQA 3FAOA 5DKAA 4UI9B 4AP4A 3PURA 4YBTA 4MSXA 3ZPV1 2PUYA 2YHOA 4YBSA 4YBMA 4S3OB 1RMDA 3PHDA 3U5NA 3SUBA 3RPGB 2BAYA 4TKPB 5TDRA 3O47A 2M6MA 2ECIA 2IDAA 5TRBA 4O62A 5TBNA 2UZGA 3KQIA 2YUCA 1LDJB 4QF3A 5SVIA 5H1TA 3QZVA 5LCWB 5B79A 1DCQA 3L1ZB 4OGCA 2VPBA 2KR4A 1G25A 3L1XA 4PPEA 2VJFB 4C9ZA 2VPDA 3T6RA 3E2DA 2KFTA 4F1PA 2ECGA 5LKZA 2LGLA 4GNGA 1VFYA 3LRQA 5TABA 2MIQA 2XP0A 3HCUA 2HDPA 2LXHC 2E6SA 5SVXA 2OWAA 4BBQA 2YQLA 1U6GB 2JUNA 4YABA 4W4UA 4AYCB 2DX8A 2KKXA 2K16A 2CRWA 2CSVA 2P57A 1HYJA 4FJCA 2ZETC 2LGKA 2YYRA 4UP5A 3N9LA 4A49A 3RPGC 4XI1A 1WEPA 1K2FA 2C2LA 2YSMA 4V3KC 3M99A 5I3LA 4X3GA 2KREA 5J3XA 2KWOA 1WGMA 2LRIC 4GB0A 5SVYA 4Z0RA 4LJNA 2FSAA 2HYED 2ECTA 3DQVR 2ECVA 4YAXA 5KH3A 2F42A 3N9OA 3ZNIA 3PLWA 2KGIA 2LDRA 3FEHA 2G45A 2VJEA 4YADA 2YREA 2DJAA 2CKLB 3DWDA 1WESA 2ECNA 3KV5A 3O35A 3LQIA 2YW8A 2G6QA 3O34A 5D1LB 4GNDA 1WIMA 3DDTA 2F6JA 2QIZA 1JOCA 1MM3A 4FK5A 3O33A 2RI7A 3H7HA 4LK9A 1DVPA 2CRRA 2YHNA 2E61A 4Q6FA 2KWNA 3KV6A 3MHHA 1V87A 5SVIB 4BHWA 2EODA 5G05B 1X4JA 3SOWA 4R8PK 2JMIA 1Z60A 5D1KB 3FANA 2LV9A 5B8DA 2L75A 2CT2A 3LQHA 2FUIA 3N9PA 2DSMA 5LKXA 2MD7B 4GNFA 2YURA 2L43A 4ZDTA 4CCGX 4ZQLA 2L80A 1MM2A 1E4UA 2JRJA 2VPGA 4LADB 4FIPA 3EB6A 2L0BA 5B75A 5FEYA 3MDBC 2MKEA 5H1UA 5JG6A 1WEMA 3JUEA 3EB5A 4YATA 2LGVA 4S3OC 2XOZA 2CONA 2VJFA 2H0DA 2ECJA 1MBMA 3NG2A 3ZVZB 3SOXA 2EXUA 2PNXA 5G0FA 2I50A 2JMDA 2MA6A 4ZUXU 2VPEA 2ECWA 4H9DA 2KGGA 3O36A 2YVRA 4NN2A 1IYMA 2AN6A 4PTBA 2Y1NA 3C6WA 3T9KA 3FL2A 1WEWA 2IQJA 2LN0A 5G04B 1FBVA 5DINA 2LGGA 3U5OA 4WZ0A 1BORA 4AUQB 4WZ2A 2MUMA 2L7PA 1Z2QA 4Z0OA 2M85A 5D1MB 3HTKC 2MT5A 5B77A 4L7XA 3SHBA 1WEQA 4AVXA 3O37A 2FUUA 1WEVA 4R2YA 3IHPA 2VP7A 5K3QA 2JMJA 1LDKC 1VYXA 1VD4A 4LKAA 1N87A 4L58A 4I7CA 1T1HA 2FD4A 1FP0A 1WEOA 3O7AA 3MHSA 3C5KA 2MD8C 2M1RA 4P5OB 4OGEA 3Q1DA 2D8SA 1JM7A 5KH7A 5AITA 3ZVYA 3FM8C 3N9NA 4WZ3B 3U5MA 4IC2A 2RSDA 2YU4A 4LLBA 4FO9A 3L11A 5B78A 4GNEA 4B86C 5FERA 2LQ6A 2VNFA 4A0CD 1Z6UA 4IC3A 1XWHA 5LKUA 4YC9A 3ZTGA 2KE1A 1X4IA 1WFKA 2KIZA 2XOCA 4CA1A 3LJUX 3O70A 2MNYA 5AIUA 2LXPC 3FJUB 2XOYA 2E6RA 2B0OE 2K1JA 2KU3A 2KYUA 2YT5A 3KDEC 2KKYA 3SOUA 4I7DA 2H0DB 2NAAA 2F6NA 3ZPVE 3RTRB 5C13A 2EGPA 4I7BA 4R7EA 2Y1MA 4B7YC 2KWJA 3HCSA 1F62A 3VK6A 1ZBDB 2XB1A 3U5PA 2FFWA 3LQJA 4N4FA 5FB1A 5TDWA 2EGMA 4F52B 1HYIA 3GV4A 2M3HA 3M63A 4V3LC 2MA5A 5KH9A 2VJEB 3GL6A 4MVTA 2LAUA 2G43A 3N9MA 3KNVA 4AYCA 3T7LA 3ASLA 5EYAF 2RR4A 4N3WA 2KWKA 3LDYA 2OXQC 3I2DA 4WA6A 1WENA 5H1VA 2Y43A 3N9QA 2M13A 2EA6A 3DPLR 3LVQE 2L5UA 2C2VS 2CSYA 5C11A 3M7KA 2QICA 3HCTA 4O64A 2YSJA 5B76A 3LVRE 4QQ4A
chains in the Genus database with same CATH topology
2MNZA 1WE9A 4UP0A 1WEUA 1WEEA 2CSZA 5H9MA 2K17A 5FB0A 1JM7B 1WILA 2K4DA 3ZYQA 5LKTA 2YQMA 3V43A 4A4BA 4A4CA 1CHCA 2QJ0A 2CKLA 3M62A 4QF2A 1X4UA 2XEUA 3PUQA 5DKAA 4UI9B 4AP4A 3PURA 4YBTA 4MSXA 3ZPV1 2PUYA 2YHOA 4YBSA 4YBMA 4S3OB 1RMDA 3PHDA 3U5NA 3RPGB 2BAYA 4TKPB 5TDRA 2M6MA 2ECIA 2IDAA 5TRBA 5TBNA 2UZGA 3KQIA 2YUCA 1LDJB 4QF3A 5H1TA 3QZVA 5LCWB 5B79A 3L1ZB 2VPBA 2KR4A 1G25A 3L1XA 4PPEA 2VJFB 4C9ZA 2VPDA 3T6RA 2KFTA 2ECGA 5LKZA 2LGLA 4GNGA 1VFYA 3LRQA 5TABA 2MIQA 3HCUA 2HDPA 2LXHC 2E6SA 4BBQA 2YQLA 1U6GB 4YABA 4W4UA 4AYCB 2DX8A 2K16A 1HYJA 4FJCA 2ZETC 2LGKA 2YYRA 4UP5A 3N9LA 4A49A 3RPGC 4XI1A 1WEPA 1K2FA 2C2LA 2YSMA 4V3KC 3M99A 5I3LA 4X3GA 2KREA 5J3XA 2KWOA 1WGMA 2LRIC 4GB0A 4LJNA 2FSAA 2HYED 2ECTA 3DQVR 2ECVA 4YAXA 5KH3A 2F42A 3N9OA 3ZNIA 2KGIA 2LDRA 2G45A 2VJEA 4YADA 2YREA 2CKLB 1WESA 2ECNA 3KV5A 3O35A 3LQIA 2YW8A 2G6QA 3O34A 5D1LB 4GNDA 1WIMA 2F6JA 2QIZA 1JOCA 1MM3A 4FK5A 3O33A 2RI7A 4LK9A 1DVPA 2YHNA 4Q6FA 2KWNA 3KV6A 3MHHA 1V87A 4BHWA 2EODA 5G05B 1X4JA 3SOWA 4R8PK 2JMIA 1Z60A 5D1KB 5B8DA 2L75A 2CT2A 3LQHA 2FUIA 3N9PA 5LKXA 2MD7B 4GNFA 2YURA 2L43A 4ZDTA 4CCGX 4ZQLA 2L80A 1MM2A 1E4UA 2JRJA 2VPGA 4LADB 4FIPA 3EB6A 2L0BA 5B75A 5FEYA 5H1UA 5JG6A 1WEMA 3EB5A 4YATA 2LGVA 4S3OC 2VJFA 2H0DA 2ECJA 3NG2A 3ZVZB 3SOXA 2PNXA 5G0FA 2I50A 2JMDA 2MA6A 4ZUXU 2VPEA 2ECWA 2KGGA 3O36A 4NN2A 1IYMA 2AN6A 4PTBA 2Y1NA 3C6WA 3FL2A 1WEWA 2LN0A 5G04B 1FBVA 5DINA 2LGGA 3U5OA 4WZ0A 1BORA 4AUQB 4WZ2A 2MUMA 1Z2QA 2M85A 5D1MB 3HTKC 2MT5A 5B77A 4L7XA 3SHBA 1WEQA 4AVXA 3O37A 2FUUA 1WEVA 4R2YA 3IHPA 2VP7A 2JMJA 1LDKC 1VYXA 1VD4A 4LKAA 1N87A 4L58A 4I7CA 1T1HA 1FP0A 1WEOA 3O7AA 3MHSA 3C5KA 2MD8C 2M1RA 4P5OB 2D8SA 1JM7A 5KH7A 5AITA 3ZVYA 3N9NA 4WZ3B 3U5MA 4IC2A 2RSDA 2YU4A 4LLBA 4FO9A 3L11A 5B78A 4GNEA 4B86C 5FERA 2LQ6A 2VNFA 4A0CD 1Z6UA 4IC3A 1XWHA 5LKUA 4YC9A 3ZTGA 2KE1A 1X4IA 1WFKA 2KIZA 4CA1A 3O70A 2MNYA 5AIUA 2LXPC 2E6RA 2K1JA 2KU3A 2KYUA 2YT5A 3SOUA 4I7DA 2H0DB 2NAAA 2F6NA 3ZPVE 3RTRB 5C13A 2EGPA 4I7BA 4R7EA 2Y1MA 4B7YC 2KWJA 3HCSA 1F62A 3VK6A 1ZBDB 2XB1A 3U5PA 3LQJA 4N4FA 5FB1A 5TDWA 4F52B 1HYIA 3GV4A 2M3HA 3M63A 4V3LC 2MA5A 5KH9A 2VJEB 3GL6A 4MVTA 2G43A 3N9MA 3KNVA 4AYCA 3T7LA 3ASLA 5EYAF 4N3WA 2KWKA 2OXQC 3I2DA 4WA6A 1WENA 5H1VA 2Y43A 3N9QA 2EA6A 3DPLR 2L5UA 2C2VS 2CSYA 5C11A 2QICA 3HCTA 4O64A 2YSJA 5B76A 2LV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNZ A;  1WE9 A;  4UP0 A;  1WEU A;  1WEE A;  2CSZ A;  5H9M A;  2K17 A;  5FB0 A;  1JM7 B;  1WIL A;  2K4D A;  3ZYQ A;  5LKT A;  2YQM A;  3V43 A;  4A4B A;  4A4C A;  1CHC A;  2QJ0 A;  2CKL A;  3M62 A;  4QF2 A;  1X4U A;  2XEU A;  3PUQ A;  5DKA A;  4UI9 B;  4AP4 A;  3PUR A;  4YBT A;  4MSX A;  3ZPV 1;  2PUY A;  2YHO A;  4YBS A;  4YBM A;  4S3O B;  1RMD A;  3PHD A;  3U5N A;  3RPG B;  2BAY A;  4TKP B;  5TDR A;  2M6M A;  2ECI A;  2IDA A;  5TRB A;  5TBN A;  2UZG A;  3KQI A;  2YUC A;  1LDJ B;  4QF3 A;  5H1T A;  3QZV A;  5LCW B;  5B79 A;  3L1Z B;  2VPB A;  2KR4 A;  1G25 A;  3L1X A;  4PPE A;  2VJF B;  4C9Z A;  2VPD A;  3T6R A;  2KFT A;  2ECG A;  5LKZ A;  2LGL A;  4GNG A;  1VFY A;  3LRQ A;  5TAB A;  2MIQ A;  3HCU A;  2HDP A;  2LXH C;  2E6S A;  4BBQ A;  2YQL A;  1U6G B;  4YAB A;  4W4U A;  4AYC B;  2DX8 A;  2K16 A;  1HYJ A;  4FJC A;  2ZET C;  2LGK A;  2YYR A;  4UP5 A;  3N9L A;  4A49 A;  3RPG C;  4XI1 A;  1WEP A;  1K2F A;  2C2L A;  2YSM A;  4V3K C;  3M99 A;  5I3L A;  4X3G A;  2KRE A;  5J3X A;  2KWO A;  1WGM A;  2LRI C;  4GB0 A;  4LJN A;  2FSA A;  2HYE D;  2ECT A;  3DQV R;  2ECV A;  4YAX A;  5KH3 A;  2F42 A;  3N9O A;  3ZNI A;  2KGI A;  2LDR A;  2G45 A;  2VJE A;  4YAD A;  2YRE A;  2CKL B;  1WES A;  2ECN A;  3KV5 A;  3O35 A;  3LQI A;  2YW8 A;  2G6Q A;  3O34 A;  5D1L B;  4GND A;  1WIM A;  2F6J A;  2QIZ A;  1JOC A;  1MM3 A;  4FK5 A;  3O33 A;  2RI7 A;  4LK9 A;  1DVP A;  2YHN A;  4Q6F A;  2KWN A;  3KV6 A;  3MHH A;  1V87 A;  4BHW A;  2EOD A;  5G05 B;  1X4J A;  3SOW A;  4R8P K;  2JMI A;  1Z60 A;  5D1K B;  5B8D A;  2L75 A;  2CT2 A;  3LQH A;  2FUI A;  3N9P A;  5LKX A;  2MD7 B;  4GNF A;  2YUR A;  2L43 A;  4ZDT A;  4CCG X;  4ZQL A;  2L80 A;  1MM2 A;  1E4U A;  2JRJ A;  2VPG A;  4LAD B;  4FIP A;  3EB6 A;  2L0B A;  5B75 A;  5FEY A;  5H1U A;  5JG6 A;  1WEM A;  3EB5 A;  4YAT A;  2LGV A;  4S3O C;  2VJF A;  2H0D A;  2ECJ A;  3NG2 A;  3ZVZ B;  3SOX A;  2PNX A;  5G0F A;  2I50 A;  2JMD A;  2MA6 A;  4ZUX U;  2VPE A;  2ECW A;  2KGG A;  3O36 A;  4NN2 A;  1IYM A;  2AN6 A;  4PTB A;  2Y1N A;  3C6W A;  3FL2 A;  1WEW A;  2LN0 A;  5G04 B;  1FBV A;  5DIN A;  2LGG A;  3U5O A;  4WZ0 A;  1BOR A;  4AUQ B;  4WZ2 A;  2MUM A;  1Z2Q A;  2M85 A;  5D1M B;  3HTK C;  2MT5 A;  5B77 A;  4L7X A;  3SHB A;  1WEQ A;  4AVX A;  3O37 A;  2FUU A;  1WEV A;  4R2Y A;  3IHP A;  2VP7 A;  2JMJ A;  1LDK C;  1VYX A;  1VD4 A;  4LKA A;  1N87 A;  4L58 A;  4I7C A;  1T1H A;  1FP0 A;  1WEO A;  3O7A A;  3MHS A;  3C5K A;  2MD8 C;  2M1R A;  4P5O B;  2D8S A;  1JM7 A;  5KH7 A;  5AIT A;  3ZVY A;  3N9N A;  4WZ3 B;  3U5M A;  4IC2 A;  2RSD A;  2YU4 A;  4LLB A;  4FO9 A;  3L11 A;  5B78 A;  4GNE A;  4B86 C;  5FER A;  2LQ6 A;  2VNF A;  4A0C D;  1Z6U A;  4IC3 A;  1XWH A;  5LKU A;  4YC9 A;  3ZTG A;  2KE1 A;  1X4I A;  1WFK A;  2KIZ A;  4CA1 A;  3O70 A;  2MNY A;  5AIU A;  2LXP C;  2E6R A;  2K1J A;  2KU3 A;  2KYU A;  2YT5 A;  3SOU A;  4I7D A;  2H0D B;  2NAA A;  2F6N A;  3ZPV E;  3RTR B;  5C13 A;  2EGP A;  4I7B A;  4R7E A;  2Y1M A;  4B7Y C;  2KWJ A;  3HCS A;  1F62 A;  3VK6 A;  1ZBD B;  2XB1 A;  3U5P A;  3LQJ A;  4N4F A;  5FB1 A;  5TDW A;  4F52 B;  1HYI A;  3GV4 A;  2M3H A;  3M63 A;  4V3L C;  2MA5 A;  5KH9 A;  2VJE B;  3GL6 A;  4MVT A;  2G43 A;  3N9M A;  3KNV A;  4AYC A;  3T7L A;  3ASL A;  5EYA F;  4N3W A;  2KWK A;  2OXQ C;  3I2D A;  4WA6 A;  1WEN A;  5H1V A;  2Y43 A;  3N9Q A;  2EA6 A;  3DPL R;  2L5U A;  2C2V S;  2CSY A;  5C11 A;  2QIC A;  3HCT A;  4O64 A;  2YSJ A;  5B76 A;  2LV9 A; 
#chains in the Genus database with same CATH topology
 2MNZ A;  1WE9 A;  4UP0 A;  1WEU A;  1WEE A;  2CSZ A;  2D8U A;  5H9M A;  2K17 A;  5FB0 A;  1JM7 B;  1WIL A;  2K4D A;  3ZYQ A;  2JM3 A;  5LKT A;  2YQM A;  3V43 A;  4A4B A;  4A4C A;  1CHC A;  2QJ0 A;  2CKL A;  3M62 A;  4QF2 A;  1X4U A;  2XEU A;  3PUQ A;  3FAO A;  5DKA A;  4UI9 B;  4AP4 A;  3PUR A;  4YBT A;  4MSX A;  3ZPV 1;  2PUY A;  2YHO A;  4YBS A;  4YBM A;  4S3O B;  1RMD A;  3PHD A;  3U5N A;  3SUB A;  3RPG B;  2BAY A;  4TKP B;  5TDR A;  3O47 A;  2M6M A;  2ECI A;  2IDA A;  5TRB A;  4O62 A;  5TBN A;  2UZG A;  3KQI A;  2YUC A;  1LDJ B;  4QF3 A;  5SVI A;  5H1T A;  3QZV A;  5LCW B;  5B79 A;  1DCQ A;  3L1Z B;  4OGC A;  2VPB A;  2KR4 A;  1G25 A;  3L1X A;  4PPE A;  2VJF B;  4C9Z A;  2VPD A;  3T6R A;  3E2D A;  2KFT A;  4F1P A;  2ECG A;  5LKZ A;  2LGL A;  4GNG A;  1VFY A;  3LRQ A;  5TAB A;  2MIQ A;  2XP0 A;  3HCU A;  2HDP A;  2LXH C;  2E6S A;  5SVX A;  2OWA A;  4BBQ A;  2YQL A;  1U6G B;  2JUN A;  4YAB A;  4W4U A;  4AYC B;  2DX8 A;  2KKX A;  2K16 A;  2CRW A;  2CSV A;  2P57 A;  1HYJ A;  4FJC A;  2ZET C;  2LGK A;  2YYR A;  4UP5 A;  3N9L A;  4A49 A;  3RPG C;  4XI1 A;  1WEP A;  1K2F A;  2C2L A;  2YSM A;  4V3K C;  3M99 A;  5I3L A;  4X3G A;  2KRE A;  5J3X A;  2KWO A;  1WGM A;  2LRI C;  4GB0 A;  5SVY A;  4Z0R A;  4LJN A;  2FSA A;  2HYE D;  2ECT A;  3DQV R;  2ECV A;  4YAX A;  5KH3 A;  2F42 A;  3N9O A;  3ZNI A;  3PLW A;  2KGI A;  2LDR A;  3FEH A;  2G45 A;  2VJE A;  4YAD A;  2YRE A;  2DJA A;  2CKL B;  3DWD A;  1WES A;  2ECN A;  3KV5 A;  3O35 A;  3LQI A;  2YW8 A;  2G6Q A;  3O34 A;  5D1L B;  4GND A;  1WIM A;  3DDT A;  2F6J A;  2QIZ A;  1JOC A;  1MM3 A;  4FK5 A;  3O33 A;  2RI7 A;  3H7H A;  4LK9 A;  1DVP A;  2CRR A;  2YHN A;  2E61 A;  4Q6F A;  2KWN A;  3KV6 A;  3MHH A;  1V87 A;  5SVI B;  4BHW A;  2EOD A;  5G05 B;  1X4J A;  3SOW A;  4R8P K;  2JMI A;  1Z60 A;  5D1K B;  3FAN A;  2LV9 A;  5B8D A;  2L75 A;  2CT2 A;  3LQH A;  2FUI A;  3N9P A;  2DSM A;  5LKX A;  2MD7 B;  4GNF A;  2YUR A;  2L43 A;  4ZDT A;  4CCG X;  4ZQL A;  2L80 A;  1MM2 A;  1E4U A;  2JRJ A;  2VPG A;  4LAD B;  4FIP A;  3EB6 A;  2L0B A;  5B75 A;  5FEY A;  3MDB C;  2MKE A;  5H1U A;  5JG6 A;  1WEM A;  3JUE A;  3EB5 A;  4YAT A;  2LGV A;  4S3O C;  2XOZ A;  2CON A;  2VJF A;  2H0D A;  2ECJ A;  1MBM A;  3NG2 A;  3ZVZ B;  3SOX A;  2EXU A;  2PNX A;  5G0F A;  2I50 A;  2JMD A;  2MA6 A;  4ZUX U;  2VPE A;  2ECW A;  4H9D A;  2KGG A;  3O36 A;  2YVR A;  4NN2 A;  1IYM A;  2AN6 A;  4PTB A;  2Y1N A;  3C6W A;  3T9K A;  3FL2 A;  1WEW A;  2IQJ A;  2LN0 A;  5G04 B;  1FBV A;  5DIN A;  2LGG A;  3U5O A;  4WZ0 A;  1BOR A;  4AUQ B;  4WZ2 A;  2MUM A;  2L7P A;  1Z2Q A;  4Z0O A;  2M85 A;  5D1M B;  3HTK C;  2MT5 A;  5B77 A;  4L7X A;  3SHB A;  1WEQ A;  4AVX A;  3O37 A;  2FUU A;  1WEV A;  4R2Y A;  3IHP A;  2VP7 A;  5K3Q A;  2JMJ A;  1LDK C;  1VYX A;  1VD4 A;  4LKA A;  1N87 A;  4L58 A;  4I7C A;  1T1H A;  2FD4 A;  1FP0 A;  1WEO A;  3O7A A;  3MHS A;  3C5K A;  2MD8 C;  2M1R A;  4P5O B;  4OGE A;  3Q1D A;  2D8S A;  1JM7 A;  5KH7 A;  5AIT A;  3ZVY A;  3FM8 C;  3N9N A;  4WZ3 B;  3U5M A;  4IC2 A;  2RSD A;  2YU4 A;  4LLB A;  4FO9 A;  3L11 A;  5B78 A;  4GNE A;  4B86 C;  5FER A;  2LQ6 A;  2VNF A;  4A0C D;  1Z6U A;  4IC3 A;  1XWH A;  5LKU A;  4YC9 A;  3ZTG A;  2KE1 A;  1X4I A;  1WFK A;  2KIZ A;  2XOC A;  4CA1 A;  3LJU X;  3O70 A;  2MNY A;  5AIU A;  2LXP C;  3FJU B;  2XOY A;  2E6R A;  2B0O E;  2K1J A;  2KU3 A;  2KYU A;  2YT5 A;  3KDE C;  2KKY A;  3SOU A;  4I7D A;  2H0D B;  2NAA A;  2F6N A;  3ZPV E;  3RTR B;  5C13 A;  2EGP A;  4I7B A;  4R7E A;  2Y1M A;  4B7Y C;  2KWJ A;  3HCS A;  1F62 A;  3VK6 A;  1ZBD B;  2XB1 A;  3U5P A;  2FFW A;  3LQJ A;  4N4F A;  5FB1 A;  5TDW A;  2EGM A;  4F52 B;  1HYI A;  3GV4 A;  2M3H A;  3M63 A;  4V3L C;  2MA5 A;  5KH9 A;  2VJE B;  3GL6 A;  4MVT A;  2LAU A;  2G43 A;  3N9M A;  3KNV A;  4AYC A;  3T7L A;  3ASL A;  5EYA F;  2RR4 A;  4N3W A;  2KWK A;  3LDY A;  2OXQ C;  3I2D A;  4WA6 A;  1WEN A;  5H1V A;  2Y43 A;  3N9Q A;  2M13 A;  2EA6 A;  3DPL R;  3LVQ E;  2L5U A;  2C2V S;  2CSY A;  5C11 A;  3M7K A;  2QIC A;  3HCT A;  4O64 A;  2YSJ A;  5B76 A;  3LVR E;  4QQ4 A; 
#chains in the Genus database with same CATH homology
 2MNZ A;  1WE9 A;  4UP0 A;  1WEU A;  1WEE A;  2CSZ A;  5H9M A;  2K17 A;  5FB0 A;  1JM7 B;  1WIL A;  2K4D A;  3ZYQ A;  5LKT A;  2YQM A;  3V43 A;  4A4B A;  4A4C A;  1CHC A;  2QJ0 A;  2CKL A;  3M62 A;  4QF2 A;  1X4U A;  2XEU A;  3PUQ A;  5DKA A;  4UI9 B;  4AP4 A;  3PUR A;  4YBT A;  4MSX A;  3ZPV 1;  2PUY A;  2YHO A;  4YBS A;  4YBM A;  4S3O B;  1RMD A;  3PHD A;  3U5N A;  3RPG B;  2BAY A;  4TKP B;  5TDR A;  2M6M A;  2ECI A;  2IDA A;  5TRB A;  5TBN A;  2UZG A;  3KQI A;  2YUC A;  1LDJ B;  4QF3 A;  5H1T A;  3QZV A;  5LCW B;  5B79 A;  3L1Z B;  2VPB A;  2KR4 A;  1G25 A;  3L1X A;  4PPE A;  2VJF B;  4C9Z A;  2VPD A;  3T6R A;  2KFT A;  2ECG A;  5LKZ A;  2LGL A;  4GNG A;  1VFY A;  3LRQ A;  5TAB A;  2MIQ A;  3HCU A;  2HDP A;  2LXH C;  2E6S A;  4BBQ A;  2YQL A;  1U6G B;  4YAB A;  4W4U A;  4AYC B;  2DX8 A;  2K16 A;  1HYJ A;  4FJC A;  2ZET C;  2LGK A;  2YYR A;  4UP5 A;  3N9L A;  4A49 A;  3RPG C;  4XI1 A;  1WEP A;  1K2F A;  2C2L A;  2YSM A;  4V3K C;  3M99 A;  5I3L A;  4X3G A;  2KRE A;  5J3X A;  2KWO A;  1WGM A;  2LRI C;  4GB0 A;  4LJN A;  2FSA A;  2HYE D;  2ECT A;  3DQV R;  2ECV A;  4YAX A;  5KH3 A;  2F42 A;  3N9O A;  3ZNI A;  2KGI A;  2LDR A;  2G45 A;  2VJE A;  4YAD A;  2YRE A;  2CKL B;  1WES A;  2ECN A;  3KV5 A;  3O35 A;  3LQI A;  2YW8 A;  2G6Q A;  3O34 A;  5D1L B;  4GND A;  1WIM A;  2F6J A;  2QIZ A;  1JOC A;  1MM3 A;  4FK5 A;  3O33 A;  2RI7 A;  4LK9 A;  1DVP A;  2YHN A;  4Q6F A;  2KWN A;  3KV6 A;  3MHH A;  1V87 A;  4BHW A;  2EOD A;  5G05 B;  1X4J A;  3SOW A;  4R8P K;  2JMI A;  1Z60 A;  5D1K B;  5B8D A;  2L75 A;  2CT2 A;  3LQH A;  2FUI A;  3N9P A;  5LKX A;  2MD7 B;  4GNF A;  2YUR A;  2L43 A;  4ZDT A;  4CCG X;  4ZQL A;  2L80 A;  1MM2 A;  1E4U A;  2JRJ A;  2VPG A;  4LAD B;  4FIP A;  3EB6 A;  2L0B A;  5B75 A;  5FEY A;  5H1U A;  5JG6 A;  1WEM A;  3EB5 A;  4YAT A;  2LGV A;  4S3O C;  2VJF A;  2H0D A;  2ECJ A;  3NG2 A;  3ZVZ B;  3SOX A;  2PNX A;  5G0F A;  2I50 A;  2JMD A;  2MA6 A;  4ZUX U;  2VPE A;  2ECW A;  2KGG A;  3O36 A;  4NN2 A;  1IYM A;  2AN6 A;  4PTB A;  2Y1N A;  3C6W A;  3FL2 A;  1WEW A;  2LN0 A;  5G04 B;  1FBV A;  5DIN A;  2LGG A;  3U5O A;  4WZ0 A;  1BOR A;  4AUQ B;  4WZ2 A;  2MUM A;  1Z2Q A;  2M85 A;  5D1M B;  3HTK C;  2MT5 A;  5B77 A;  4L7X A;  3SHB A;  1WEQ A;  4AVX A;  3O37 A;  2FUU A;  1WEV A;  4R2Y A;  3IHP A;  2VP7 A;  2JMJ A;  1LDK C;  1VYX A;  1VD4 A;  4LKA A;  1N87 A;  4L58 A;  4I7C A;  1T1H A;  1FP0 A;  1WEO A;  3O7A A;  3MHS A;  3C5K A;  2MD8 C;  2M1R A;  4P5O B;  2D8S A;  1JM7 A;  5KH7 A;  5AIT A;  3ZVY A;  3N9N A;  4WZ3 B;  3U5M A;  4IC2 A;  2RSD A;  2YU4 A;  4LLB A;  4FO9 A;  3L11 A;  5B78 A;  4GNE A;  4B86 C;  5FER A;  2LQ6 A;  2VNF A;  4A0C D;  1Z6U A;  4IC3 A;  1XWH A;  5LKU A;  4YC9 A;  3ZTG A;  2KE1 A;  1X4I A;  1WFK A;  2KIZ A;  4CA1 A;  3O70 A;  2MNY A;  5AIU A;  2LXP C;  2E6R A;  2K1J A;  2KU3 A;  2KYU A;  2YT5 A;  3SOU A;  4I7D A;  2H0D B;  2NAA A;  2F6N A;  3ZPV E;  3RTR B;  5C13 A;  2EGP A;  4I7B A;  4R7E A;  2Y1M A;  4B7Y C;  2KWJ A;  3HCS A;  1F62 A;  3VK6 A;  1ZBD B;  2XB1 A;  3U5P A;  3LQJ A;  4N4F A;  5FB1 A;  5TDW A;  4F52 B;  1HYI A;  3GV4 A;  2M3H A;  3M63 A;  4V3L C;  2MA5 A;  5KH9 A;  2VJE B;  3GL6 A;  4MVT A;  2G43 A;  3N9M A;  3KNV A;  4AYC A;  3T7L A;  3ASL A;  5EYA F;  4N3W A;  2KWK A;  2OXQ C;  3I2D A;  4WA6 A;  1WEN A;  5H1V A;  2Y43 A;  3N9Q A;  2EA6 A;  3DPL R;  2L5U A;  2C2V S;  2CSY A;  5C11 A;  2QIC A;  3HCT A;  4O64 A;  2YSJ A;  5B76 A;  2LV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...