4LADB

Crystal structure of the ube2g2:ring-g2br complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
69
Chain Sequence
b'DDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMGSADERQRMLVQRKDELLQQARKRFLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 G2
publication title Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase
total genus 18
structure length 69
sequence length 121
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13639 zf-RING_2 Ring finger domain
B PF18442 G2BR E3 gp78 Ube2g2-binding region (G2BR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ladB00
4AVXA 3ZVZB 1IYMA 4XI1A 2LGKA 2CKLB 4YBMA 4AYCB 3ZPVE 3VK6A 5B79A 5EYAF 1WGMA 3HCUA 3N9OA 2BAYA 4ZUXU 2L43A 5FB1A 3L1XA 2NAAA 3O37A 2LDRA 5KH9A 2VP7A 3MHSA 1WEQA 4UP5A 3O34A 1WESA 1G25A 2EA6A 1HYJA 4UI9B 2MNZA 1JOCA 3V43A 2Y1MA 1MM2A 1E4UA 3N9NA 3O7AA 4FK5A 2L75A 4CA1A 4LK9A 3SOUA 2YREA 2VPGA 3KNVA 2VPDA 2D8SA 5TDWA 4R7EA 1WEOA 2ECIA 4CCGX 5TABA 2ECNA 2LXHC 1X4IA 3DPLR 2RI7A 3T7LA 2CSYA 2ECJA 5AITA 4P5OB 3KV5A 2XEUA 5B78A 5G05B 2QICA 4YBTA 1U6GB 2KIZA 2JMIA 1ZBDB 1WEUA 3HCTA 1MM3A 2EGPA 2E6RA 1WE9A 5LKUA 2H0DA 2PNXA 3ZYQA 2FUUA 1FBVA 1Z6UA 2YUCA 1V87A 4WZ2A 5KH3A 2L80A 4YBSA 3ASLA 4YABA 2EODA 3I2DA 4V3LC 2MA5A 2VJEB 4R8PK 4N4FA 2MA6A 2G6QA 4WA6A 2KWOA 3PHDA 2E6SA 4NN2A 4Q6FA 2FUIA 2MUMA 3RTRB 3M62A 2K1JA 2M6MA 3N9MA 2YQLA 2HYED 1X4JA 5KH7A 4WZ0A 3N9QA 1Z2QA 2XB1A 3LQJA 5B76A 5J3XA 2JMJA 5LKXA 1WFKA 3MHHA 3HCSA 1VFYA 2PUYA 3O33A 4FIPA 4LJNA 4YC9A 3U5PA 3FL2A 2VJFA 3N9LA 2LV9A 3HTKC 2F6JA 2YU4A 2IDAA 3U5OA 3LRQA 4YADA 5I3LA 2ECVA 2G45A 1N87A 5FB0A 4GNDA 4S3OB 1WEPA 3L11A 2JMDA 3SOXA 4C9ZA 1Z60A 2MT5A 5DKAA 1WEEA 4A0CD 4FJCA 2LGVA 3C5KA 4BHWA 5TRBA 5B77A 4V3KC 4A49A 5AIUA 3EB6A 3ZTGA 4F52B 3PURA 4R2YA 1WEVA 2YHOA 5D1KB 2LN0A 1F62A 1WILA 1WEWA 3C6WA 1JM7A 2M85A 3PUQA 4YATA 3NG2A 1BORA 1X4UA 2F6NA 4GNFA 2DX8A 4A4CA 1WIMA 4O64A 2YW8A 4B86C 2VNFA 4I7BA 2YSMA 2F42A 4I7CA 1WENA 2QIZA 2KWKA 3ZVYA 4WZ3B 3GL6A 2KWNA 2KWJA 2Y43A 3O70A 4LADB 2KU3A 2ECWA 5FEYA 3KQIA 1LDJB 2VPEA 4TKPB 2OXQC 4ZDTA 4ZQLA 2CKLA 2MD8C 4AYCA 4GNEA 4QF2A 2H0DB 2KFTA 1WEMA 4MSXA 5B8DA 5FERA 2G43A 4GB0A 3KV6A 2KR4A 5H1VA 4BBQA 3EB5A 2UZGA 2K4DA 4AUQB 5H9MA 1RMDA 4A4BA 2KREA 2YQMA 4L58A 4IC3A 2L0BA 2M3HA 3LQIA 1VD4A 2Y1NA 5D1LB 4UP0A 1K2FA 2MD7B 4GNGA 2FSAA 2QJ0A 5JG6A 2MNYA 3LQHA 2LRIC 3RPGB 4I7DA 2YT5A 5LKTA 2KYUA 3M63A 2ECTA 4LLBA 5TBNA 2I50A 2LXPC 4N3WA 5C11A 2K16A 4W4UA 2KE1A 2VJFB 5LCWB 1VYXA 2YSJA 3ZNIA 3T6RA 4L7XA 3M99A 5G04B 1T1HA 3GV4A 2LGLA 2VPBA 3DQVR 4S3OC 4PTBA 5D1MB 5TDRA 3SHBA 2RSDA 5C13A 4PPEA 3RPGC 2LGGA 1LDKC 4MVTA 5LKZA 2C2LA 2KGIA 2VJEA 5H1TA 1JM7B 2ZETC 5B75A 2JRJA 2MIQA 4QF3A 2YURA 3U5NA 2CSZA 3ZPV1 2L5UA 3O36A 5G0FA 2K17A 4B7YC 2KGGA 4IC2A 1FP0A 4X3GA 2YYRA 2M1RA 5H1UA 4LKAA 2ECGA 3QZVA 2HDPA 1CHCA 1XWHA 4YAXA 2YHNA 3SOWA 1DVPA 4FO9A 2LQ6A 3N9PA 3IHPA 2C2VS 3U5MA 2CT2A 2AN6A 3O35A 5DINA 4AP4A 1HYIA 3L1ZB
chains in the Genus database with same CATH superfamily
4AVXA 3ZVZB 1IYMA 4XI1A 2LGKA 2CKLB 4YBMA 4AYCB 3ZPVE 3VK6A 5B79A 5EYAF 1WGMA 3HCUA 3N9OA 2BAYA 5SVIB 4ZUXU 2L43A 5FB1A 3L1XA 2CSVA 2NAAA 3O37A 2LDRA 5KH9A 2VP7A 3MHSA 4OGCA 2CRWA 1WEQA 4UP5A 3O34A 1WESA 1G25A 2EA6A 1HYJA 4UI9B 2MNZA 1JOCA 3V43A 2Y1MA 3DDTA 1MM2A 1E4UA 3N9NA 2OWAA 3O7AA 4FK5A 5SVYA 2L75A 4CA1A 4LK9A 3SOUA 2YREA 3FANA 2P57A 2VPGA 3KNVA 2VPDA 2D8SA 5TDWA 4R7EA 3MDBC 1WEOA 3PLWA 2ECIA 4CCGX 5TABA 2ECNA 2LXHC 1X4IA 3DPLR 2RI7A 3FAOA 3T7LA 2MKEA 4H9DA 5K3QA 2CSYA 2ECJA 5AITA 4P5OB 3KV5A 2XEUA 5B78A 5G05B 2QICA 4YBTA 1U6GB 2KIZA 3FM8C 3LVQE 2JMIA 1ZBDB 1WEUA 3HCTA 1MM3A 2EGPA 2E6RA 1WE9A 5LKUA 2H0DA 2PNXA 3ZYQA 2FUUA 1FBVA 2CONA 1Z6UA 2YUCA 1V87A 4WZ2A 5KH3A 2L80A 4YBSA 3ASLA 4YABA 2EODA 3I2DA 2LAUA 4V3LC 2MA5A 2VJEB 4O62A 4R8PK 4N4FA 2MA6A 2L7PA 2G6QA 4WA6A 2KWOA 3PHDA 2E6SA 4NN2A 4Q6FA 2FUIA 2MUMA 3RTRB 3M62A 2K1JA 2M6MA 3N9MA 2YQLA 2HYED 1X4JA 5KH7A 4WZ0A 3N9QA 1Z2QA 1DCQA 2XB1A 3LQJA 4Z0OA 5B76A 5J3XA 4OGEA 2JMJA 5LKXA 1WFKA 4QQ4A 3MHHA 3HCSA 1VFYA 2PUYA 3O33A 4FIPA 4LJNA 4YC9A 2M13A 3U5PA 3FL2A 3E2DA 2VJFA 3N9LA 2LV9A 3HTKC 2F6JA 2DJAA 2IDAA 2YU4A 3U5OA 3LRQA 4YADA 5I3LA 2ECVA 2G45A 1N87A 5FB0A 2JUNA 4GNDA 2DSMA 4S3OB 1WEPA 3L11A 2JMDA 3SOXA 4C9ZA 1Z60A 2JM3A 2MT5A 5DKAA 1WEEA 4A0CD 4FJCA 2LGVA 3C5KA 4BHWA 5TRBA 5B77A 4V3KC 3O47A 4A49A 5AIUA 3EB6A 3ZTGA 4F52B 3KDEC 3PURA 4R2YA 1WEVA 2YHOA 5D1KB 2LN0A 1F62A 1WILA 3DWDA 1WEWA 3C6WA 1JM7A 2M85A 3PUQA 4YATA 3NG2A 1BORA 1X4UA 2F6NA 4GNFA 2DX8A 4A4CA 1WIMA 4Z0RA 3H7HA 4O64A 2YW8A 4B86C 2VNFA 4I7BA 2KKXA 2KKYA 3FEHA 2YSMA 2F42A 2YVRA 4I7CA 1WENA 2QIZA 2KWKA 3ZVYA 4WZ3B 3GL6A 2KWNA 3FJUB 2KWJA 2Y43A 2FD4A 3O70A 4LADB 2KU3A 2ECWA 5FEYA 3KQIA 2RR4A 1LDJB 4F1PA 2VPEA 4TKPB 2FFWA 2OXQC 2E61A 4ZQLA 4ZDTA 1MBMA 2CKLA 3LVRE 2MD8C 4AYCA 4GNEA 4QF2A 2H0DB 2KFTA 1WEMA 4MSXA 5B8DA 5FERA 2G43A 4GB0A 3KV6A 2KR4A 5H1VA 5SVIA 4BBQA 3EB5A 2UZGA 2K4DA 4AUQB 3Q1DA 5H9MA 1RMDA 4A4BA 2KREA 2EXUA 2XOYA 2YQMA 4L58A 4IC3A 2L0BA 2M3HA 3LQIA 1VD4A 2Y1NA 5D1LB 4UP0A 1K2FA 3LJUX 2MD7B 4GNGA 2FSAA 2QJ0A 5JG6A 2MNYA 3LQHA 2LRIC 2XOCA 3RPGB 4I7DA 2YT5A 5LKTA 2KYUA 3M63A 2ECTA 4LLBA 5TBNA 2I50A 2LXPC 4N3WA 5C11A 2K16A 4W4UA 2KE1A 2VJFB 5LCWB 1VYXA 2YSJA 3ZNIA 3T6RA 4L7XA 3M99A 5G04B 1T1HA 3GV4A 2EGMA 3T9KA 2LGLA 2VPBA 3DQVR 4S3OC 4PTBA 5D1MB 5TDRA 3SHBA 2RSDA 5C13A 4PPEA 3RPGC 2LGGA 3LDYA 1LDKC 4MVTA 5LKZA 2C2LA 2KGIA 2VJEA 5H1TA 1JM7B 2ZETC 5B75A 2CRRA 2JRJA 2IQJA 2MIQA 4QF3A 2YURA 3U5NA 2CSZA 3ZPV1 2L5UA 3O36A 5G0FA 2K17A 4B7YC 2KGGA 4IC2A 1FP0A 4X3GA 2YYRA 2M1RA 5H1UA 4LKAA 2XOZA 2ECGA 3QZVA 3M7KA 2HDPA 1CHCA 3JUEA 1XWHA 2D8UA 2B0OE 4YAXA 2YHNA 3SOWA 1DVPA 2XP0A 4FO9A 2LQ6A 3N9PA 3IHPA 5SVXA 3SUBA 2C2VS 3U5MA 2CT2A 2AN6A 3O35A 5DINA 4AP4A 1HYIA 3L1ZB
chains in the Genus database with same CATH topology
4AVXA 3ZVZB 1IYMA 4XI1A 2LGKA 2CKLB 4YBMA 4AYCB 3ZPVE 3VK6A 5B79A 5EYAF 1WGMA 3HCUA 3N9OA 2BAYA 4ZUXU 2L43A 5FB1A 3L1XA 2NAAA 3O37A 2LDRA 5KH9A 2VP7A 3MHSA 1WEQA 4UP5A 3O34A 1WESA 1G25A 2EA6A 1HYJA 4UI9B 2MNZA 1JOCA 3V43A 2Y1MA 1MM2A 1E4UA 3N9NA 3O7AA 4FK5A 2L75A 4CA1A 4LK9A 3SOUA 2YREA 2VPGA 3KNVA 2VPDA 2D8SA 5TDWA 4R7EA 1WEOA 2ECIA 4CCGX 5TABA 2ECNA 2LXHC 1X4IA 3DPLR 2RI7A 3T7LA 2CSYA 2ECJA 5AITA 4P5OB 3KV5A 2XEUA 5B78A 5G05B 2QICA 4YBTA 1U6GB 2KIZA 2JMIA 1ZBDB 1WEUA 3HCTA 1MM3A 2EGPA 2E6RA 1WE9A 5LKUA 2H0DA 2PNXA 3ZYQA 2FUUA 1FBVA 1Z6UA 2YUCA 1V87A 4WZ2A 5KH3A 2L80A 4YBSA 3ASLA 4YABA 2EODA 3I2DA 4V3LC 2MA5A 2VJEB 4R8PK 4N4FA 2MA6A 2G6QA 4WA6A 2KWOA 3PHDA 2E6SA 4NN2A 4Q6FA 2FUIA 2MUMA 3RTRB 3M62A 2K1JA 2M6MA 3N9MA 2YQLA 2HYED 1X4JA 5KH7A 4WZ0A 3N9QA 1Z2QA 2XB1A 3LQJA 5B76A 5J3XA 2JMJA 5LKXA 1WFKA 3MHHA 3HCSA 1VFYA 2PUYA 3O33A 4FIPA 4LJNA 4YC9A 3U5PA 3FL2A 2VJFA 3N9LA 2LV9A 3HTKC 2F6JA 2YU4A 2IDAA 3U5OA 3LRQA 4YADA 5I3LA 2ECVA 2G45A 1N87A 5FB0A 4GNDA 4S3OB 1WEPA 3L11A 2JMDA 3SOXA 4C9ZA 1Z60A 2MT5A 5DKAA 1WEEA 4A0CD 4FJCA 2LGVA 3C5KA 4BHWA 5TRBA 5B77A 4V3KC 4A49A 5AIUA 3EB6A 3ZTGA 4F52B 3PURA 4R2YA 1WEVA 2YHOA 5D1KB 2LN0A 1F62A 1WILA 1WEWA 3C6WA 1JM7A 2M85A 3PUQA 4YATA 3NG2A 1BORA 1X4UA 2F6NA 4GNFA 2DX8A 4A4CA 1WIMA 4O64A 2YW8A 4B86C 2VNFA 4I7BA 2YSMA 2F42A 4I7CA 1WENA 2QIZA 2KWKA 3ZVYA 4WZ3B 3GL6A 2KWNA 2KWJA 2Y43A 3O70A 4LADB 2KU3A 2ECWA 5FEYA 3KQIA 1LDJB 2VPEA 4TKPB 2OXQC 4ZDTA 4ZQLA 2CKLA 2MD8C 4AYCA 4GNEA 4QF2A 2H0DB 2KFTA 1WEMA 4MSXA 5B8DA 5FERA 2G43A 4GB0A 3KV6A 2KR4A 5H1VA 4BBQA 3EB5A 2UZGA 2K4DA 4AUQB 5H9MA 1RMDA 4A4BA 2KREA 2YQMA 4L58A 4IC3A 2L0BA 2M3HA 3LQIA 1VD4A 2Y1NA 5D1LB 4UP0A 1K2FA 2MD7B 4GNGA 2FSAA 2QJ0A 5JG6A 2MNYA 3LQHA 2LRIC 3RPGB 4I7DA 2YT5A 5LKTA 2KYUA 3M63A 2ECTA 4LLBA 5TBNA 2I50A 2LXPC 4N3WA 5C11A 2K16A 4W4UA 2KE1A 2VJFB 5LCWB 1VYXA 2YSJA 3ZNIA 3T6RA 4L7XA 3M99A 5G04B 1T1HA 3GV4A 2LGLA 2VPBA 3DQVR 4S3OC 4PTBA 5D1MB 5TDRA 3SHBA 2RSDA 5C13A 4PPEA 3RPGC 2LGGA 1LDKC 4MVTA 5LKZA 2C2LA 2KGIA 2VJEA 5H1TA 1JM7B 2ZETC 5B75A 2JRJA 2MIQA 4QF3A 2YURA 3U5NA 2CSZA 3ZPV1 2L5UA 3O36A 5G0FA 2K17A 4B7YC 2KGGA 4IC2A 1FP0A 4X3GA 2YYRA 2M1RA 5H1UA 4LKAA 2ECGA 3QZVA 2HDPA 1CHCA 1XWHA 4YAXA 2YHNA 3SOWA 1DVPA 4FO9A 2LQ6A 3N9PA 3IHPA 2C2VS 3U5MA 2CT2A 2AN6A 3O35A 5DINA 4AP4A 1HYIA 3L1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVX A;  3ZVZ B;  1IYM A;  4XI1 A;  2LGK A;  2CKL B;  4YBM A;  4AYC B;  3ZPV E;  3VK6 A;  5B79 A;  5EYA F;  1WGM A;  3HCU A;  3N9O A;  2BAY A;  4ZUX U;  2L43 A;  5FB1 A;  3L1X A;  2NAA A;  3O37 A;  2LDR A;  5KH9 A;  2VP7 A;  3MHS A;  1WEQ A;  4UP5 A;  3O34 A;  1WES A;  1G25 A;  2EA6 A;  1HYJ A;  4UI9 B;  2MNZ A;  1JOC A;  3V43 A;  2Y1M A;  1MM2 A;  1E4U A;  3N9N A;  3O7A A;  4FK5 A;  2L75 A;  4CA1 A;  4LK9 A;  3SOU A;  2YRE A;  2VPG A;  3KNV A;  2VPD A;  2D8S A;  5TDW A;  4R7E A;  1WEO A;  2ECI A;  4CCG X;  5TAB A;  2ECN A;  2LXH C;  1X4I A;  3DPL R;  2RI7 A;  3T7L A;  2CSY A;  2ECJ A;  5AIT A;  4P5O B;  3KV5 A;  2XEU A;  5B78 A;  5G05 B;  2QIC A;  4YBT A;  1U6G B;  2KIZ A;  2JMI A;  1ZBD B;  1WEU A;  3HCT A;  1MM3 A;  2EGP A;  2E6R A;  1WE9 A;  5LKU A;  2H0D A;  2PNX A;  3ZYQ A;  2FUU A;  1FBV A;  1Z6U A;  2YUC A;  1V87 A;  4WZ2 A;  5KH3 A;  2L80 A;  4YBS A;  3ASL A;  4YAB A;  2EOD A;  3I2D A;  4V3L C;  2MA5 A;  2VJE B;  4R8P K;  4N4F A;  2MA6 A;  2G6Q A;  4WA6 A;  2KWO A;  3PHD A;  2E6S A;  4NN2 A;  4Q6F A;  2FUI A;  2MUM A;  3RTR B;  3M62 A;  2K1J A;  2M6M A;  3N9M A;  2YQL A;  2HYE D;  1X4J A;  5KH7 A;  4WZ0 A;  3N9Q A;  1Z2Q A;  2XB1 A;  3LQJ A;  5B76 A;  5J3X A;  2JMJ A;  5LKX A;  1WFK A;  3MHH A;  3HCS A;  1VFY A;  2PUY A;  3O33 A;  4FIP A;  4LJN A;  4YC9 A;  3U5P A;  3FL2 A;  2VJF A;  3N9L A;  2LV9 A;  3HTK C;  2F6J A;  2YU4 A;  2IDA A;  3U5O A;  3LRQ A;  4YAD A;  5I3L A;  2ECV A;  2G45 A;  1N87 A;  5FB0 A;  4GND A;  4S3O B;  1WEP A;  3L11 A;  2JMD A;  3SOX A;  4C9Z A;  1Z60 A;  2MT5 A;  5DKA A;  1WEE A;  4A0C D;  4FJC A;  2LGV A;  3C5K A;  4BHW A;  5TRB A;  5B77 A;  4V3K C;  4A49 A;  5AIU A;  3EB6 A;  3ZTG A;  4F52 B;  3PUR A;  4R2Y A;  1WEV A;  2YHO A;  5D1K B;  2LN0 A;  1F62 A;  1WIL A;  1WEW A;  3C6W A;  1JM7 A;  2M85 A;  3PUQ A;  4YAT A;  3NG2 A;  1BOR A;  1X4U A;  2F6N A;  4GNF A;  2DX8 A;  4A4C A;  1WIM A;  4O64 A;  2YW8 A;  4B86 C;  2VNF A;  4I7B A;  2YSM A;  2F42 A;  4I7C A;  1WEN A;  2QIZ A;  2KWK A;  3ZVY A;  4WZ3 B;  3GL6 A;  2KWN A;  2KWJ A;  2Y43 A;  3O70 A;  4LAD B;  2KU3 A;  2ECW A;  5FEY A;  3KQI A;  1LDJ B;  2VPE A;  4TKP B;  2OXQ C;  4ZDT A;  4ZQL A;  2CKL A;  2MD8 C;  4AYC A;  4GNE A;  4QF2 A;  2H0D B;  2KFT A;  1WEM A;  4MSX A;  5B8D A;  5FER A;  2G43 A;  4GB0 A;  3KV6 A;  2KR4 A;  5H1V A;  4BBQ A;  3EB5 A;  2UZG A;  2K4D A;  4AUQ B;  5H9M A;  1RMD A;  4A4B A;  2KRE A;  2YQM A;  4L58 A;  4IC3 A;  2L0B A;  2M3H A;  3LQI A;  1VD4 A;  2Y1N A;  5D1L B;  4UP0 A;  1K2F A;  2MD7 B;  4GNG A;  2FSA A;  2QJ0 A;  5JG6 A;  2MNY A;  3LQH A;  2LRI C;  3RPG B;  4I7D A;  2YT5 A;  5LKT A;  2KYU A;  3M63 A;  2ECT A;  4LLB A;  5TBN A;  2I50 A;  2LXP C;  4N3W A;  5C11 A;  2K16 A;  4W4U A;  2KE1 A;  2VJF B;  5LCW B;  1VYX A;  2YSJ A;  3ZNI A;  3T6R A;  4L7X A;  3M99 A;  5G04 B;  1T1H A;  3GV4 A;  2LGL A;  2VPB A;  3DQV R;  4S3O C;  4PTB A;  5D1M B;  5TDR A;  3SHB A;  2RSD A;  5C13 A;  4PPE A;  3RPG C;  2LGG A;  1LDK C;  4MVT A;  5LKZ A;  2C2L A;  2KGI A;  2VJE A;  5H1T A;  1JM7 B;  2ZET C;  5B75 A;  2JRJ A;  2MIQ A;  4QF3 A;  2YUR A;  3U5N A;  2CSZ A;  3ZPV 1;  2L5U A;  3O36 A;  5G0F A;  2K17 A;  4B7Y C;  2KGG A;  4IC2 A;  1FP0 A;  4X3G A;  2YYR A;  2M1R A;  5H1U A;  4LKA A;  2ECG A;  3QZV A;  2HDP A;  1CHC A;  1XWH A;  4YAX A;  2YHN A;  3SOW A;  1DVP A;  4FO9 A;  2LQ6 A;  3N9P A;  3IHP A;  2C2V S;  3U5M A;  2CT2 A;  2AN6 A;  3O35 A;  5DIN A;  4AP4 A;  1HYI A;  3L1Z B; 
#chains in the Genus database with same CATH topology
 4AVX A;  3ZVZ B;  1IYM A;  4XI1 A;  2LGK A;  2CKL B;  4YBM A;  4AYC B;  3ZPV E;  3VK6 A;  5B79 A;  5EYA F;  1WGM A;  3HCU A;  3N9O A;  2BAY A;  5SVI B;  4ZUX U;  2L43 A;  5FB1 A;  3L1X A;  2CSV A;  2NAA A;  3O37 A;  2LDR A;  5KH9 A;  2VP7 A;  3MHS A;  4OGC A;  2CRW A;  1WEQ A;  4UP5 A;  3O34 A;  1WES A;  1G25 A;  2EA6 A;  1HYJ A;  4UI9 B;  2MNZ A;  1JOC A;  3V43 A;  2Y1M A;  3DDT A;  1MM2 A;  1E4U A;  3N9N A;  2OWA A;  3O7A A;  4FK5 A;  5SVY A;  2L75 A;  4CA1 A;  4LK9 A;  3SOU A;  2YRE A;  3FAN A;  2P57 A;  2VPG A;  3KNV A;  2VPD A;  2D8S A;  5TDW A;  4R7E A;  3MDB C;  1WEO A;  3PLW A;  2ECI A;  4CCG X;  5TAB A;  2ECN A;  2LXH C;  1X4I A;  3DPL R;  2RI7 A;  3FAO A;  3T7L A;  2MKE A;  4H9D A;  5K3Q A;  2CSY A;  2ECJ A;  5AIT A;  4P5O B;  3KV5 A;  2XEU A;  5B78 A;  5G05 B;  2QIC A;  4YBT A;  1U6G B;  2KIZ A;  3FM8 C;  3LVQ E;  2JMI A;  1ZBD B;  1WEU A;  3HCT A;  1MM3 A;  2EGP A;  2E6R A;  1WE9 A;  5LKU A;  2H0D A;  2PNX A;  3ZYQ A;  2FUU A;  1FBV A;  2CON A;  1Z6U A;  2YUC A;  1V87 A;  4WZ2 A;  5KH3 A;  2L80 A;  4YBS A;  3ASL A;  4YAB A;  2EOD A;  3I2D A;  2LAU A;  4V3L C;  2MA5 A;  2VJE B;  4O62 A;  4R8P K;  4N4F A;  2MA6 A;  2L7P A;  2G6Q A;  4WA6 A;  2KWO A;  3PHD A;  2E6S A;  4NN2 A;  4Q6F A;  2FUI A;  2MUM A;  3RTR B;  3M62 A;  2K1J A;  2M6M A;  3N9M A;  2YQL A;  2HYE D;  1X4J A;  5KH7 A;  4WZ0 A;  3N9Q A;  1Z2Q A;  1DCQ A;  2XB1 A;  3LQJ A;  4Z0O A;  5B76 A;  5J3X A;  4OGE A;  2JMJ A;  5LKX A;  1WFK A;  4QQ4 A;  3MHH A;  3HCS A;  1VFY A;  2PUY A;  3O33 A;  4FIP A;  4LJN A;  4YC9 A;  2M13 A;  3U5P A;  3FL2 A;  3E2D A;  2VJF A;  3N9L A;  2LV9 A;  3HTK C;  2F6J A;  2DJA A;  2IDA A;  2YU4 A;  3U5O A;  3LRQ A;  4YAD A;  5I3L A;  2ECV A;  2G45 A;  1N87 A;  5FB0 A;  2JUN A;  4GND A;  2DSM A;  4S3O B;  1WEP A;  3L11 A;  2JMD A;  3SOX A;  4C9Z A;  1Z60 A;  2JM3 A;  2MT5 A;  5DKA A;  1WEE A;  4A0C D;  4FJC A;  2LGV A;  3C5K A;  4BHW A;  5TRB A;  5B77 A;  4V3K C;  3O47 A;  4A49 A;  5AIU A;  3EB6 A;  3ZTG A;  4F52 B;  3KDE C;  3PUR A;  4R2Y A;  1WEV A;  2YHO A;  5D1K B;  2LN0 A;  1F62 A;  1WIL A;  3DWD A;  1WEW A;  3C6W A;  1JM7 A;  2M85 A;  3PUQ A;  4YAT A;  3NG2 A;  1BOR A;  1X4U A;  2F6N A;  4GNF A;  2DX8 A;  4A4C A;  1WIM A;  4Z0R A;  3H7H A;  4O64 A;  2YW8 A;  4B86 C;  2VNF A;  4I7B A;  2KKX A;  2KKY A;  3FEH A;  2YSM A;  2F42 A;  2YVR A;  4I7C A;  1WEN A;  2QIZ A;  2KWK A;  3ZVY A;  4WZ3 B;  3GL6 A;  2KWN A;  3FJU B;  2KWJ A;  2Y43 A;  2FD4 A;  3O70 A;  4LAD B;  2KU3 A;  2ECW A;  5FEY A;  3KQI A;  2RR4 A;  1LDJ B;  4F1P A;  2VPE A;  4TKP B;  2FFW A;  2OXQ C;  2E61 A;  4ZQL A;  4ZDT A;  1MBM A;  2CKL A;  3LVR E;  2MD8 C;  4AYC A;  4GNE A;  4QF2 A;  2H0D B;  2KFT A;  1WEM A;  4MSX A;  5B8D A;  5FER A;  2G43 A;  4GB0 A;  3KV6 A;  2KR4 A;  5H1V A;  5SVI A;  4BBQ A;  3EB5 A;  2UZG A;  2K4D A;  4AUQ B;  3Q1D A;  5H9M A;  1RMD A;  4A4B A;  2KRE A;  2EXU A;  2XOY A;  2YQM A;  4L58 A;  4IC3 A;  2L0B A;  2M3H A;  3LQI A;  1VD4 A;  2Y1N A;  5D1L B;  4UP0 A;  1K2F A;  3LJU X;  2MD7 B;  4GNG A;  2FSA A;  2QJ0 A;  5JG6 A;  2MNY A;  3LQH A;  2LRI C;  2XOC A;  3RPG B;  4I7D A;  2YT5 A;  5LKT A;  2KYU A;  3M63 A;  2ECT A;  4LLB A;  5TBN A;  2I50 A;  2LXP C;  4N3W A;  5C11 A;  2K16 A;  4W4U A;  2KE1 A;  2VJF B;  5LCW B;  1VYX A;  2YSJ A;  3ZNI A;  3T6R A;  4L7X A;  3M99 A;  5G04 B;  1T1H A;  3GV4 A;  2EGM A;  3T9K A;  2LGL A;  2VPB A;  3DQV R;  4S3O C;  4PTB A;  5D1M B;  5TDR A;  3SHB A;  2RSD A;  5C13 A;  4PPE A;  3RPG C;  2LGG A;  3LDY A;  1LDK C;  4MVT A;  5LKZ A;  2C2L A;  2KGI A;  2VJE A;  5H1T A;  1JM7 B;  2ZET C;  5B75 A;  2CRR A;  2JRJ A;  2IQJ A;  2MIQ A;  4QF3 A;  2YUR A;  3U5N A;  2CSZ A;  3ZPV 1;  2L5U A;  3O36 A;  5G0F A;  2K17 A;  4B7Y C;  2KGG A;  4IC2 A;  1FP0 A;  4X3G A;  2YYR A;  2M1R A;  5H1U A;  4LKA A;  2XOZ A;  2ECG A;  3QZV A;  3M7K A;  2HDP A;  1CHC A;  3JUE A;  1XWH A;  2D8U A;  2B0O E;  4YAX A;  2YHN A;  3SOW A;  1DVP A;  2XP0 A;  4FO9 A;  2LQ6 A;  3N9P A;  3IHP A;  5SVX A;  3SUB A;  2C2V S;  3U5M A;  2CT2 A;  2AN6 A;  3O35 A;  5DIN A;  4AP4 A;  1HYI A;  3L1Z B; 
#chains in the Genus database with same CATH homology
 4AVX A;  3ZVZ B;  1IYM A;  4XI1 A;  2LGK A;  2CKL B;  4YBM A;  4AYC B;  3ZPV E;  3VK6 A;  5B79 A;  5EYA F;  1WGM A;  3HCU A;  3N9O A;  2BAY A;  4ZUX U;  2L43 A;  5FB1 A;  3L1X A;  2NAA A;  3O37 A;  2LDR A;  5KH9 A;  2VP7 A;  3MHS A;  1WEQ A;  4UP5 A;  3O34 A;  1WES A;  1G25 A;  2EA6 A;  1HYJ A;  4UI9 B;  2MNZ A;  1JOC A;  3V43 A;  2Y1M A;  1MM2 A;  1E4U A;  3N9N A;  3O7A A;  4FK5 A;  2L75 A;  4CA1 A;  4LK9 A;  3SOU A;  2YRE A;  2VPG A;  3KNV A;  2VPD A;  2D8S A;  5TDW A;  4R7E A;  1WEO A;  2ECI A;  4CCG X;  5TAB A;  2ECN A;  2LXH C;  1X4I A;  3DPL R;  2RI7 A;  3T7L A;  2CSY A;  2ECJ A;  5AIT A;  4P5O B;  3KV5 A;  2XEU A;  5B78 A;  5G05 B;  2QIC A;  4YBT A;  1U6G B;  2KIZ A;  2JMI A;  1ZBD B;  1WEU A;  3HCT A;  1MM3 A;  2EGP A;  2E6R A;  1WE9 A;  5LKU A;  2H0D A;  2PNX A;  3ZYQ A;  2FUU A;  1FBV A;  1Z6U A;  2YUC A;  1V87 A;  4WZ2 A;  5KH3 A;  2L80 A;  4YBS A;  3ASL A;  4YAB A;  2EOD A;  3I2D A;  4V3L C;  2MA5 A;  2VJE B;  4R8P K;  4N4F A;  2MA6 A;  2G6Q A;  4WA6 A;  2KWO A;  3PHD A;  2E6S A;  4NN2 A;  4Q6F A;  2FUI A;  2MUM A;  3RTR B;  3M62 A;  2K1J A;  2M6M A;  3N9M A;  2YQL A;  2HYE D;  1X4J A;  5KH7 A;  4WZ0 A;  3N9Q A;  1Z2Q A;  2XB1 A;  3LQJ A;  5B76 A;  5J3X A;  2JMJ A;  5LKX A;  1WFK A;  3MHH A;  3HCS A;  1VFY A;  2PUY A;  3O33 A;  4FIP A;  4LJN A;  4YC9 A;  3U5P A;  3FL2 A;  2VJF A;  3N9L A;  2LV9 A;  3HTK C;  2F6J A;  2YU4 A;  2IDA A;  3U5O A;  3LRQ A;  4YAD A;  5I3L A;  2ECV A;  2G45 A;  1N87 A;  5FB0 A;  4GND A;  4S3O B;  1WEP A;  3L11 A;  2JMD A;  3SOX A;  4C9Z A;  1Z60 A;  2MT5 A;  5DKA A;  1WEE A;  4A0C D;  4FJC A;  2LGV A;  3C5K A;  4BHW A;  5TRB A;  5B77 A;  4V3K C;  4A49 A;  5AIU A;  3EB6 A;  3ZTG A;  4F52 B;  3PUR A;  4R2Y A;  1WEV A;  2YHO A;  5D1K B;  2LN0 A;  1F62 A;  1WIL A;  1WEW A;  3C6W A;  1JM7 A;  2M85 A;  3PUQ A;  4YAT A;  3NG2 A;  1BOR A;  1X4U A;  2F6N A;  4GNF A;  2DX8 A;  4A4C A;  1WIM A;  4O64 A;  2YW8 A;  4B86 C;  2VNF A;  4I7B A;  2YSM A;  2F42 A;  4I7C A;  1WEN A;  2QIZ A;  2KWK A;  3ZVY A;  4WZ3 B;  3GL6 A;  2KWN A;  2KWJ A;  2Y43 A;  3O70 A;  4LAD B;  2KU3 A;  2ECW A;  5FEY A;  3KQI A;  1LDJ B;  2VPE A;  4TKP B;  2OXQ C;  4ZDT A;  4ZQL A;  2CKL A;  2MD8 C;  4AYC A;  4GNE A;  4QF2 A;  2H0D B;  2KFT A;  1WEM A;  4MSX A;  5B8D A;  5FER A;  2G43 A;  4GB0 A;  3KV6 A;  2KR4 A;  5H1V A;  4BBQ A;  3EB5 A;  2UZG A;  2K4D A;  4AUQ B;  5H9M A;  1RMD A;  4A4B A;  2KRE A;  2YQM A;  4L58 A;  4IC3 A;  2L0B A;  2M3H A;  3LQI A;  1VD4 A;  2Y1N A;  5D1L B;  4UP0 A;  1K2F A;  2MD7 B;  4GNG A;  2FSA A;  2QJ0 A;  5JG6 A;  2MNY A;  3LQH A;  2LRI C;  3RPG B;  4I7D A;  2YT5 A;  5LKT A;  2KYU A;  3M63 A;  2ECT A;  4LLB A;  5TBN A;  2I50 A;  2LXP C;  4N3W A;  5C11 A;  2K16 A;  4W4U A;  2KE1 A;  2VJF B;  5LCW B;  1VYX A;  2YSJ A;  3ZNI A;  3T6R A;  4L7X A;  3M99 A;  5G04 B;  1T1H A;  3GV4 A;  2LGL A;  2VPB A;  3DQV R;  4S3O C;  4PTB A;  5D1M B;  5TDR A;  3SHB A;  2RSD A;  5C13 A;  4PPE A;  3RPG C;  2LGG A;  1LDK C;  4MVT A;  5LKZ A;  2C2L A;  2KGI A;  2VJE A;  5H1T A;  1JM7 B;  2ZET C;  5B75 A;  2JRJ A;  2MIQ A;  4QF3 A;  2YUR A;  3U5N A;  2CSZ A;  3ZPV 1;  2L5U A;  3O36 A;  5G0F A;  2K17 A;  4B7Y C;  2KGG A;  4IC2 A;  1FP0 A;  4X3G A;  2YYR A;  2M1R A;  5H1U A;  4LKA A;  2ECG A;  3QZV A;  2HDP A;  1CHC A;  1XWH A;  4YAX A;  2YHN A;  3SOW A;  1DVP A;  4FO9 A;  2LQ6 A;  3N9P A;  3IHP A;  2C2V S;  3U5M A;  2CT2 A;  2AN6 A;  3O35 A;  5DIN A;  4AP4 A;  1HYI A;  3L1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...