4LADB

Crystal structure of the ube2g2:ring-g2br complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
69
Chain Sequence
DDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMGSADERQRMLVQRKDELLQQARKRFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase
molecule keywords Ubiquitin-conjugating enzyme E2 G2
total genus 18
structure length 69
sequence length 121
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13639 zf-RING_2 Ring finger domain
B PF18442 G2BR E3 gp78 Ube2g2-binding region (G2BR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ladB00
2L0BA 2KWOA 2K17A 1WEPA 3M99A 4IC3A 3RPGB 4MSXA 3LQJA 4PPEA 4F52B 4QF3A 4YAXA 3SOXA 2L80A 3VK6A 2VPBA 2YT5A 3ZVZB 4I7CA 3SOWA 2NAAA 5B78A 1JOCA 2F6NA 5AITA 5I3LA 5EYAF 1G25A 2L5UA 2E6RA 5FB0A 3DQVR 2VJEB 3RPGC 3MHHA 3HCTA 5KH9A 2ZETC 5TRBA 4WA6A 4A49A 4A4CA 2BAYA 3ZNIA 2MD8C 4A4BA 5LKZA 2JMDA 4ZQLA 5D1KB 4BBQA 1RMDA 1U6GB 4GNDA 3T6RA 3N9MA 2I50A 4FK5A 4O64A 1LDJB 3ZPVE 2VPDA 2VJFA 5KH7A 3HCUA 1MM3A 1WEEA 2KWKA 4FIPA 4S3OB 1F62A 4GNGA 2KGGA 1IYMA 2Y1NA 2KFTA 2LQ6A 4QF2A 4LADB 1VD4A 2YHOA 2L43A 2LDRA 4B7YC 2KREA 1BORA 1VYXA 2KU3A 3KV5A 2ECVA 3N9QA 5TBNA 4C9ZA 1WEUA 5LKUA 4WZ3B 4UP5A 3C6WA 1WGMA 1HYJA 2YYRA 1FBVA 2LGLA 2MA6A 1WEOA 4AYCB 4N3WA 3V43A 1WILA 2KYUA 5FERA 2RSDA 2C2LA 4I7DA 3N9OA 5H9MA 1LDKC 1VFYA 2VJEA 4WZ0A 3L1XA 2ECWA 4UI9B 4LLBA 4V3KC 3QZVA 5J3XA 5B76A 5G0FA 2VPGA 3ZPV1 2F42A 2F6JA 2YSMA 3ZTGA 4CA1A 2KIZA 1JM7B 2G45A 4B86C 2ECIA 2YREA 3I2DA 3IHPA 4X3GA 4Q6FA 2XB1A 2G6QA 2M85A 5JG6A 3MHSA 5DINA 2LN0A 1K2FA 2C2VS 4GNEA 2LRIC 2D8SA 5B77A 1X4JA 1Z6UA 4ZDTA 2RI7A 4YC9A 4UP0A 2M6MA 2HDPA 5G05B 2UZGA 2VP7A 2MD7B 4NN2A 1WFKA 2KR4A 4YBSA 3M62A 2CKLB 1CHCA 2EGPA 2AN6A 1WEWA 2MNZA 5D1MB 1MM2A 1V87A 1XWHA 3GL6A 2MNYA 2QICA 5FEYA 5H1TA 4AP4A 2OXQC 2VNFA 2H0DB 1ZBDB 2VJFB 2K1JA 5H1UA 1JM7A 1FP0A 3SHBA 4YBMA 3LRQA 2L75A 4IC2A 3KQIA 2Y1MA 5B75A 3HCSA 4S3OC 5LCWB 4YABA 2JMIA 1HYIA 4L58A 5FB1A 4GB0A 4GNFA 2Y43A 2JRJA 2ECGA 3O7AA 5TDRA 1T1HA 3C5KA 3GV4A 4I7BA 3O70A 2EA6A 2FSAA 2LGVA 3PHDA 1X4IA 5B79A 2MIQA 5DKAA 3ZVYA 1WENA 2ECTA 2G43A 3N9PA 4N4FA 4WZ2A 2KE1A 2K4DA 3DPLR 2MA5A 2YW8A 3KV6A 1WEQA 1WIMA 3LQHA 4R2YA 4A0CD 2YSJA 2CSZA 4W4UA 2YQMA 3RTRB 2HYED 2CKLA 2FUIA 3N9NA 1Z60A 1E4UA 4LJNA 3EB6A 2M1RA 5LKXA 1WEVA 2XEUA 3T7LA 4R7EA 5TDWA 5B8DA 5KH3A 2ECNA 2H0DA 1X4UA 3N9LA 5C13A 3O33A 4XI1A 3SOUA 3FL2A 5C11A 2YHNA 2IDAA 2LGGA 2YQLA 2PNXA 3U5OA 2LV9A 4V3LC 2QIZA 4YATA 2LXPC 4FJCA 2KWJA 2FUUA 2ECJA 2KGIA 1WEMA 1Z2QA 2MUMA 3O34A 4YADA 2YU4A 3PUQA 3L1ZB 4FO9A 2M3HA 5AIUA 4LK9A 3U5MA 5TABA 3U5NA 2LGKA 3O37A 4P5OB 1WESA 3NG2A 3HTKC 4AYCA 3ASLA 3PURA 2JMJA 2MT5A 4CCGX 3U5PA 5H1VA 5D1LB 2YUCA 2YURA 2CT2A 3KNVA 4ZUXU 4R8PK 3LQIA 3L11A 2VPEA 4YBTA 2DX8A 2CSYA 2KWNA 4LKAA 4L7XA 2E6SA 3O36A 2QJ0A 1WE9A 4AVXA 3O35A 3EB5A 3ZYQA 4MVTA 3M63A 1DVPA 2PUYA 4BHWA 2EODA 4TKPB 2K16A 4AUQB 5LKTA 4PTBA 1N87A 2LXHC 5G04B
chains in the Genus database with same CATH superfamily
2L0BA 2KWOA 2K17A 1WEPA 3M99A 4IC3A 3FJUB 3RPGB 2FD4A 4MSXA 3LQJA 4PPEA 4F52B 4QF3A 4YAXA 3SOXA 2L80A 3VK6A 2VPBA 2YT5A 3ZVZB 4I7CA 3SOWA 2NAAA 5B78A 1JOCA 2F6NA 5AITA 5I3LA 5EYAF 1G25A 2L5UA 2E6RA 5FB0A 3DQVR 2VJEB 3RPGC 3MHHA 3HCTA 4QQ4A 5KH9A 2ZETC 5TRBA 4WA6A 4A49A 4A4CA 2BAYA 3ZNIA 2MD8C 4A4BA 5LKZA 2JMDA 4ZQLA 5D1KB 4BBQA 1RMDA 1U6GB 4GNDA 3T6RA 3N9MA 2I50A 4FK5A 4O64A 1LDJB 3ZPVE 2CONA 2VPDA 3JUEA 3FM8C 2VJFA 5KH7A 3HCUA 1MM3A 1WEEA 2KWKA 4FIPA 4S3OB 1DCQA 1F62A 4GNGA 2KGGA 3KDEC 1IYMA 2Y1NA 2KFTA 2LQ6A 5SVYA 4QF2A 5SVXA 4LADB 1VD4A 2YHOA 2L43A 2LDRA 4B7YC 2IQJA 2KREA 1BORA 1VYXA 2XOZA 2KU3A 3KV5A 2ECVA 3N9QA 5TBNA 4C9ZA 1WEUA 5LKUA 4WZ3B 4UP5A 3C6WA 1WGMA 5SVIB 1HYJA 2YYRA 2CRWA 1FBVA 2LGLA 2MA6A 1WEOA 4AYCB 4N3WA 2JUNA 3V43A 1WILA 2M13A 2KYUA 3FANA 5FERA 2RSDA 2C2LA 3SUBA 4I7DA 3N9OA 5H9MA 2LAUA 1LDKC 1VFYA 2VJEA 4WZ0A 3L1XA 2ECWA 4UI9B 4LLBA 4V3KC 3QZVA 5J3XA 5B76A 5G0FA 3FAOA 2VPGA 3ZPV1 2F42A 2F6JA 2YSMA 3ZTGA 4CA1A 2DSMA 2KIZA 1JM7B 2G45A 4B86C 2ECIA 3T9KA 3MDBC 2YREA 2XOCA 3I2DA 3IHPA 4X3GA 4Q6FA 2CRRA 2XB1A 2G6QA 2M85A 5JG6A 3MHSA 5DINA 2LN0A 1K2FA 2C2VS 4GNEA 2LRIC 2D8SA 5B77A 1X4JA 1Z6UA 4ZDTA 2RI7A 4YC9A 4UP0A 2M6MA 3FEHA 2HDPA 5G05B 2UZGA 2VP7A 2MD7B 4NN2A 1MBMA 1WFKA 2KR4A 3LJUX 4YBSA 3M62A 3DDTA 2CKLB 1CHCA 2EGPA 2AN6A 1WEWA 2MNZA 5D1MB 3LVQE 1MM2A 1V87A 2CSVA 1XWHA 3GL6A 5SVIA 2MNYA 2QICA 5FEYA 5H1TA 4AP4A 2OXQC 2YVRA 2VNFA 2H0DB 1ZBDB 3E2DA 4F1PA 2VJFB 2K1JA 5H1UA 1JM7A 1FP0A 3SHBA 4YBMA 2OWAA 3LRQA 2L75A 4IC2A 3KQIA 2Y1MA 5B75A 3HCSA 4S3OC 5LCWB 4YABA 2JMIA 1HYIA 4L58A 5FB1A 4GB0A 4GNFA 4OGEA 2P57A 2Y43A 2L7PA 2JRJA 2ECGA 3O7AA 5TDRA 1T1HA 3C5KA 3GV4A 4I7BA 3O70A 2EA6A 2FSAA 2LGVA 3PHDA 1X4IA 5B79A 2MIQA 5K3QA 5DKAA 3ZVYA 1WENA 2E61A 2EGMA 2B0OE 2ECTA 2G43A 3N9PA 4N4FA 4WZ2A 2KE1A 2K4DA 3DPLR 2MA5A 2YW8A 3KV6A 1WEQA 3LQHA 1WIMA 2XP0A 3Q1DA 4R2YA 4A0CD 2YSJA 2CSZA 4W4UA 2YQMA 2DJAA 3RTRB 2HYED 2CKLA 4H9DA 2FUIA 3N9NA 1Z60A 1E4UA 4LJNA 3EB6A 2M1RA 5LKXA 1WEVA 2JM3A 2XEUA 3T7LA 4R7EA 5TDWA 5B8DA 4O62A 5KH3A 3O47A 2ECNA 2H0DA 1X4UA 3N9LA 5C13A 3O33A 4XI1A 3SOUA 3FL2A 5C11A 2YHNA 2IDAA 2LGGA 2YQLA 3DWDA 2PNXA 3U5OA 3H7HA 2LV9A 4V3LC 2QIZA 4YATA 2LXPC 4FJCA 2KWJA 2FUUA 2ECJA 2KGIA 2FFWA 1WEMA 1Z2QA 2MUMA 3O34A 4YADA 2YU4A 3M7KA 4Z0RA 3PUQA 3L1ZB 2D8UA 4FO9A 2M3HA 2XOYA 3PLWA 5AIUA 4LK9A 3U5MA 5TABA 3U5NA 2LGKA 4Z0OA 3O37A 4P5OB 1WESA 3NG2A 3HTKC 4AYCA 3ASLA 3LVRE 3LDYA 3PURA 2KKYA 2JMJA 2MT5A 2EXUA 4CCGX 3U5PA 5H1VA 5D1LB 2YUCA 4OGCA 2YURA 2CT2A 3KNVA 4ZUXU 4R8PK 3LQIA 3L11A 2VPEA 4YBTA 2DX8A 2CSYA 2KWNA 2RR4A 4LKAA 4L7XA 2E6SA 3O36A 2QJ0A 1WE9A 4AVXA 3O35A 3EB5A 4MVTA 3ZYQA 3M63A 1DVPA 2MKEA 2PUYA 4BHWA 2EODA 2KKXA 4TKPB 2K16A 4AUQB 5LKTA 4PTBA 1N87A 2LXHC 5G04B
chains in the Genus database with same CATH topology
2L0BA 2KWOA 2K17A 1WEPA 3M99A 4IC3A 3RPGB 4MSXA 3LQJA 4PPEA 4F52B 4QF3A 4YAXA 3SOXA 2L80A 3VK6A 2VPBA 2YT5A 3ZVZB 4I7CA 3SOWA 2NAAA 5B78A 1JOCA 2F6NA 5AITA 5I3LA 5EYAF 1G25A 2L5UA 2E6RA 5FB0A 3DQVR 2VJEB 3RPGC 3MHHA 3HCTA 5KH9A 2ZETC 5TRBA 4WA6A 4A49A 4A4CA 2BAYA 3ZNIA 2MD8C 4A4BA 5LKZA 2JMDA 4ZQLA 5D1KB 4BBQA 1RMDA 1U6GB 4GNDA 3T6RA 3N9MA 2I50A 4FK5A 4O64A 1LDJB 3ZPVE 2VPDA 2VJFA 5KH7A 3HCUA 1MM3A 1WEEA 2KWKA 4FIPA 4S3OB 1F62A 4GNGA 2KGGA 1IYMA 2Y1NA 2KFTA 2LQ6A 4QF2A 4LADB 1VD4A 2YHOA 2L43A 2LDRA 4B7YC 2KREA 1BORA 1VYXA 2KU3A 3KV5A 2ECVA 3N9QA 5TBNA 4C9ZA 1WEUA 5LKUA 4WZ3B 4UP5A 3C6WA 1WGMA 1HYJA 2YYRA 1FBVA 2LGLA 2MA6A 1WEOA 4AYCB 4N3WA 3V43A 1WILA 2KYUA 5FERA 2RSDA 2C2LA 4I7DA 3N9OA 5H9MA 1LDKC 1VFYA 2VJEA 4WZ0A 3L1XA 2ECWA 4UI9B 4LLBA 4V3KC 3QZVA 5J3XA 5B76A 5G0FA 2VPGA 3ZPV1 2F42A 2F6JA 2YSMA 3ZTGA 4CA1A 2KIZA 1JM7B 2G45A 4B86C 2ECIA 2YREA 3I2DA 3IHPA 4X3GA 4Q6FA 2XB1A 2G6QA 2M85A 5JG6A 3MHSA 5DINA 2LN0A 1K2FA 2C2VS 4GNEA 2LRIC 2D8SA 5B77A 1X4JA 1Z6UA 4ZDTA 2RI7A 4YC9A 4UP0A 2M6MA 2HDPA 5G05B 2UZGA 2VP7A 2MD7B 4NN2A 1WFKA 2KR4A 4YBSA 3M62A 2CKLB 1CHCA 2EGPA 2AN6A 1WEWA 2MNZA 5D1MB 1MM2A 1V87A 1XWHA 3GL6A 2MNYA 2QICA 5FEYA 5H1TA 4AP4A 2OXQC 2VNFA 2H0DB 1ZBDB 2VJFB 2K1JA 5H1UA 1JM7A 1FP0A 3SHBA 4YBMA 3LRQA 2L75A 4IC2A 3KQIA 2Y1MA 5B75A 3HCSA 4S3OC 5LCWB 4YABA 2JMIA 1HYIA 4L58A 5FB1A 4GB0A 4GNFA 2Y43A 2JRJA 2ECGA 3O7AA 5TDRA 1T1HA 3C5KA 3GV4A 4I7BA 3O70A 2EA6A 2FSAA 2LGVA 3PHDA 1X4IA 5B79A 2MIQA 5DKAA 3ZVYA 1WENA 2ECTA 2G43A 3N9PA 4N4FA 4WZ2A 2KE1A 2K4DA 3DPLR 2MA5A 2YW8A 3KV6A 1WEQA 1WIMA 3LQHA 4R2YA 4A0CD 2YSJA 2CSZA 4W4UA 2YQMA 3RTRB 2HYED 2CKLA 2FUIA 3N9NA 1Z60A 1E4UA 4LJNA 3EB6A 2M1RA 5LKXA 1WEVA 2XEUA 3T7LA 4R7EA 5TDWA 5B8DA 5KH3A 2ECNA 2H0DA 1X4UA 3N9LA 5C13A 3O33A 4XI1A 3SOUA 3FL2A 5C11A 2YHNA 2IDAA 2LGGA 2YQLA 2PNXA 3U5OA 2LV9A 4V3LC 2QIZA 4YATA 2LXPC 4FJCA 2KWJA 2FUUA 2ECJA 2KGIA 1WEMA 1Z2QA 2MUMA 3O34A 4YADA 2YU4A 3PUQA 3L1ZB 4FO9A 2M3HA 5AIUA 4LK9A 3U5MA 5TABA 3U5NA 2LGKA 3O37A 4P5OB 1WESA 3NG2A 3HTKC 4AYCA 3ASLA 3PURA 2JMJA 2MT5A 4CCGX 3U5PA 5H1VA 5D1LB 2YUCA 2YURA 2CT2A 3KNVA 4ZUXU 4R8PK 3LQIA 3L11A 2VPEA 4YBTA 2DX8A 2CSYA 2KWNA 4LKAA 4L7XA 2E6SA 3O36A 2QJ0A 1WE9A 4AVXA 3O35A 3EB5A 3ZYQA 4MVTA 3M63A 1DVPA 2PUYA 4BHWA 2EODA 4TKPB 2K16A 4AUQB 5LKTA 4PTBA 1N87A 2LXHC 5G04B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0B A;  2KWO A;  2K17 A;  1WEP A;  3M99 A;  4IC3 A;  3RPG B;  4MSX A;  3LQJ A;  4PPE A;  4F52 B;  4QF3 A;  4YAX A;  3SOX A;  2L80 A;  3VK6 A;  2VPB A;  2YT5 A;  3ZVZ B;  4I7C A;  3SOW A;  2NAA A;  5B78 A;  1JOC A;  2F6N A;  5AIT A;  5I3L A;  5EYA F;  1G25 A;  2L5U A;  2E6R A;  5FB0 A;  3DQV R;  2VJE B;  3RPG C;  3MHH A;  3HCT A;  5KH9 A;  2ZET C;  5TRB A;  4WA6 A;  4A49 A;  4A4C A;  2BAY A;  3ZNI A;  2MD8 C;  4A4B A;  5LKZ A;  2JMD A;  4ZQL A;  5D1K B;  4BBQ A;  1RMD A;  1U6G B;  4GND A;  3T6R A;  3N9M A;  2I50 A;  4FK5 A;  4O64 A;  1LDJ B;  3ZPV E;  2VPD A;  2VJF A;  5KH7 A;  3HCU A;  1MM3 A;  1WEE A;  2KWK A;  4FIP A;  4S3O B;  1F62 A;  4GNG A;  2KGG A;  1IYM A;  2Y1N A;  2KFT A;  2LQ6 A;  4QF2 A;  4LAD B;  1VD4 A;  2YHO A;  2L43 A;  2LDR A;  4B7Y C;  2KRE A;  1BOR A;  1VYX A;  2KU3 A;  3KV5 A;  2ECV A;  3N9Q A;  5TBN A;  4C9Z A;  1WEU A;  5LKU A;  4WZ3 B;  4UP5 A;  3C6W A;  1WGM A;  1HYJ A;  2YYR A;  1FBV A;  2LGL A;  2MA6 A;  1WEO A;  4AYC B;  4N3W A;  3V43 A;  1WIL A;  2KYU A;  5FER A;  2RSD A;  2C2L A;  4I7D A;  3N9O A;  5H9M A;  1LDK C;  1VFY A;  2VJE A;  4WZ0 A;  3L1X A;  2ECW A;  4UI9 B;  4LLB A;  4V3K C;  3QZV A;  5J3X A;  5B76 A;  5G0F A;  2VPG A;  3ZPV 1;  2F42 A;  2F6J A;  2YSM A;  3ZTG A;  4CA1 A;  2KIZ A;  1JM7 B;  2G45 A;  4B86 C;  2ECI A;  2YRE A;  3I2D A;  3IHP A;  4X3G A;  4Q6F A;  2XB1 A;  2G6Q A;  2M85 A;  5JG6 A;  3MHS A;  5DIN A;  2LN0 A;  1K2F A;  2C2V S;  4GNE A;  2LRI C;  2D8S A;  5B77 A;  1X4J A;  1Z6U A;  4ZDT A;  2RI7 A;  4YC9 A;  4UP0 A;  2M6M A;  2HDP A;  5G05 B;  2UZG A;  2VP7 A;  2MD7 B;  4NN2 A;  1WFK A;  2KR4 A;  4YBS A;  3M62 A;  2CKL B;  1CHC A;  2EGP A;  2AN6 A;  1WEW A;  2MNZ A;  5D1M B;  1MM2 A;  1V87 A;  1XWH A;  3GL6 A;  2MNY A;  2QIC A;  5FEY A;  5H1T A;  4AP4 A;  2OXQ C;  2VNF A;  2H0D B;  1ZBD B;  2VJF B;  2K1J A;  5H1U A;  1JM7 A;  1FP0 A;  3SHB A;  4YBM A;  3LRQ A;  2L75 A;  4IC2 A;  3KQI A;  2Y1M A;  5B75 A;  3HCS A;  4S3O C;  5LCW B;  4YAB A;  2JMI A;  1HYI A;  4L58 A;  5FB1 A;  4GB0 A;  4GNF A;  2Y43 A;  2JRJ A;  2ECG A;  3O7A A;  5TDR A;  1T1H A;  3C5K A;  3GV4 A;  4I7B A;  3O70 A;  2EA6 A;  2FSA A;  2LGV A;  3PHD A;  1X4I A;  5B79 A;  2MIQ A;  5DKA A;  3ZVY A;  1WEN A;  2ECT A;  2G43 A;  3N9P A;  4N4F A;  4WZ2 A;  2KE1 A;  2K4D A;  3DPL R;  2MA5 A;  2YW8 A;  3KV6 A;  1WEQ A;  1WIM A;  3LQH A;  4R2Y A;  4A0C D;  2YSJ A;  2CSZ A;  4W4U A;  2YQM A;  3RTR B;  2HYE D;  2CKL A;  2FUI A;  3N9N A;  1Z60 A;  1E4U A;  4LJN A;  3EB6 A;  2M1R A;  5LKX A;  1WEV A;  2XEU A;  3T7L A;  4R7E A;  5TDW A;  5B8D A;  5KH3 A;  2ECN A;  2H0D A;  1X4U A;  3N9L A;  5C13 A;  3O33 A;  4XI1 A;  3SOU A;  3FL2 A;  5C11 A;  2YHN A;  2IDA A;  2LGG A;  2YQL A;  2PNX A;  3U5O A;  2LV9 A;  4V3L C;  2QIZ A;  4YAT A;  2LXP C;  4FJC A;  2KWJ A;  2FUU A;  2ECJ A;  2KGI A;  1WEM A;  1Z2Q A;  2MUM A;  3O34 A;  4YAD A;  2YU4 A;  3PUQ A;  3L1Z B;  4FO9 A;  2M3H A;  5AIU A;  4LK9 A;  3U5M A;  5TAB A;  3U5N A;  2LGK A;  3O37 A;  4P5O B;  1WES A;  3NG2 A;  3HTK C;  4AYC A;  3ASL A;  3PUR A;  2JMJ A;  2MT5 A;  4CCG X;  3U5P A;  5H1V A;  5D1L B;  2YUC A;  2YUR A;  2CT2 A;  3KNV A;  4ZUX U;  4R8P K;  3LQI A;  3L11 A;  2VPE A;  4YBT A;  2DX8 A;  2CSY A;  2KWN A;  4LKA A;  4L7X A;  2E6S A;  3O36 A;  2QJ0 A;  1WE9 A;  4AVX A;  3O35 A;  3EB5 A;  3ZYQ A;  4MVT A;  3M63 A;  1DVP A;  2PUY A;  4BHW A;  2EOD A;  4TKP B;  2K16 A;  4AUQ B;  5LKT A;  4PTB A;  1N87 A;  2LXH C;  5G04 B; 
#chains in the Genus database with same CATH topology
 2L0B A;  2KWO A;  2K17 A;  1WEP A;  3M99 A;  4IC3 A;  3FJU B;  3RPG B;  2FD4 A;  4MSX A;  3LQJ A;  4PPE A;  4F52 B;  4QF3 A;  4YAX A;  3SOX A;  2L80 A;  3VK6 A;  2VPB A;  2YT5 A;  3ZVZ B;  4I7C A;  3SOW A;  2NAA A;  5B78 A;  1JOC A;  2F6N A;  5AIT A;  5I3L A;  5EYA F;  1G25 A;  2L5U A;  2E6R A;  5FB0 A;  3DQV R;  2VJE B;  3RPG C;  3MHH A;  3HCT A;  4QQ4 A;  5KH9 A;  2ZET C;  5TRB A;  4WA6 A;  4A49 A;  4A4C A;  2BAY A;  3ZNI A;  2MD8 C;  4A4B A;  5LKZ A;  2JMD A;  4ZQL A;  5D1K B;  4BBQ A;  1RMD A;  1U6G B;  4GND A;  3T6R A;  3N9M A;  2I50 A;  4FK5 A;  4O64 A;  1LDJ B;  3ZPV E;  2CON A;  2VPD A;  3JUE A;  3FM8 C;  2VJF A;  5KH7 A;  3HCU A;  1MM3 A;  1WEE A;  2KWK A;  4FIP A;  4S3O B;  1DCQ A;  1F62 A;  4GNG A;  2KGG A;  3KDE C;  1IYM A;  2Y1N A;  2KFT A;  2LQ6 A;  5SVY A;  4QF2 A;  5SVX A;  4LAD B;  1VD4 A;  2YHO A;  2L43 A;  2LDR A;  4B7Y C;  2IQJ A;  2KRE A;  1BOR A;  1VYX A;  2XOZ A;  2KU3 A;  3KV5 A;  2ECV A;  3N9Q A;  5TBN A;  4C9Z A;  1WEU A;  5LKU A;  4WZ3 B;  4UP5 A;  3C6W A;  1WGM A;  5SVI B;  1HYJ A;  2YYR A;  2CRW A;  1FBV A;  2LGL A;  2MA6 A;  1WEO A;  4AYC B;  4N3W A;  2JUN A;  3V43 A;  1WIL A;  2M13 A;  2KYU A;  3FAN A;  5FER A;  2RSD A;  2C2L A;  3SUB A;  4I7D A;  3N9O A;  5H9M A;  2LAU A;  1LDK C;  1VFY A;  2VJE A;  4WZ0 A;  3L1X A;  2ECW A;  4UI9 B;  4LLB A;  4V3K C;  3QZV A;  5J3X A;  5B76 A;  5G0F A;  3FAO A;  2VPG A;  3ZPV 1;  2F42 A;  2F6J A;  2YSM A;  3ZTG A;  4CA1 A;  2DSM A;  2KIZ A;  1JM7 B;  2G45 A;  4B86 C;  2ECI A;  3T9K A;  3MDB C;  2YRE A;  2XOC A;  3I2D A;  3IHP A;  4X3G A;  4Q6F A;  2CRR A;  2XB1 A;  2G6Q A;  2M85 A;  5JG6 A;  3MHS A;  5DIN A;  2LN0 A;  1K2F A;  2C2V S;  4GNE A;  2LRI C;  2D8S A;  5B77 A;  1X4J A;  1Z6U A;  4ZDT A;  2RI7 A;  4YC9 A;  4UP0 A;  2M6M A;  3FEH A;  2HDP A;  5G05 B;  2UZG A;  2VP7 A;  2MD7 B;  4NN2 A;  1MBM A;  1WFK A;  2KR4 A;  3LJU X;  4YBS A;  3M62 A;  3DDT A;  2CKL B;  1CHC A;  2EGP A;  2AN6 A;  1WEW A;  2MNZ A;  5D1M B;  3LVQ E;  1MM2 A;  1V87 A;  2CSV A;  1XWH A;  3GL6 A;  5SVI A;  2MNY A;  2QIC A;  5FEY A;  5H1T A;  4AP4 A;  2OXQ C;  2YVR A;  2VNF A;  2H0D B;  1ZBD B;  3E2D A;  4F1P A;  2VJF B;  2K1J A;  5H1U A;  1JM7 A;  1FP0 A;  3SHB A;  4YBM A;  2OWA A;  3LRQ A;  2L75 A;  4IC2 A;  3KQI A;  2Y1M A;  5B75 A;  3HCS A;  4S3O C;  5LCW B;  4YAB A;  2JMI A;  1HYI A;  4L58 A;  5FB1 A;  4GB0 A;  4GNF A;  4OGE A;  2P57 A;  2Y43 A;  2L7P A;  2JRJ A;  2ECG A;  3O7A A;  5TDR A;  1T1H A;  3C5K A;  3GV4 A;  4I7B A;  3O70 A;  2EA6 A;  2FSA A;  2LGV A;  3PHD A;  1X4I A;  5B79 A;  2MIQ A;  5K3Q A;  5DKA A;  3ZVY A;  1WEN A;  2E61 A;  2EGM A;  2B0O E;  2ECT A;  2G43 A;  3N9P A;  4N4F A;  4WZ2 A;  2KE1 A;  2K4D A;  3DPL R;  2MA5 A;  2YW8 A;  3KV6 A;  1WEQ A;  3LQH A;  1WIM A;  2XP0 A;  3Q1D A;  4R2Y A;  4A0C D;  2YSJ A;  2CSZ A;  4W4U A;  2YQM A;  2DJA A;  3RTR B;  2HYE D;  2CKL A;  4H9D A;  2FUI A;  3N9N A;  1Z60 A;  1E4U A;  4LJN A;  3EB6 A;  2M1R A;  5LKX A;  1WEV A;  2JM3 A;  2XEU A;  3T7L A;  4R7E A;  5TDW A;  5B8D A;  4O62 A;  5KH3 A;  3O47 A;  2ECN A;  2H0D A;  1X4U A;  3N9L A;  5C13 A;  3O33 A;  4XI1 A;  3SOU A;  3FL2 A;  5C11 A;  2YHN A;  2IDA A;  2LGG A;  2YQL A;  3DWD A;  2PNX A;  3U5O A;  3H7H A;  2LV9 A;  4V3L C;  2QIZ A;  4YAT A;  2LXP C;  4FJC A;  2KWJ A;  2FUU A;  2ECJ A;  2KGI A;  2FFW A;  1WEM A;  1Z2Q A;  2MUM A;  3O34 A;  4YAD A;  2YU4 A;  3M7K A;  4Z0R A;  3PUQ A;  3L1Z B;  2D8U A;  4FO9 A;  2M3H A;  2XOY A;  3PLW A;  5AIU A;  4LK9 A;  3U5M A;  5TAB A;  3U5N A;  2LGK A;  4Z0O A;  3O37 A;  4P5O B;  1WES A;  3NG2 A;  3HTK C;  4AYC A;  3ASL A;  3LVR E;  3LDY A;  3PUR A;  2KKY A;  2JMJ A;  2MT5 A;  2EXU A;  4CCG X;  3U5P A;  5H1V A;  5D1L B;  2YUC A;  4OGC A;  2YUR A;  2CT2 A;  3KNV A;  4ZUX U;  4R8P K;  3LQI A;  3L11 A;  2VPE A;  4YBT A;  2DX8 A;  2CSY A;  2KWN A;  2RR4 A;  4LKA A;  4L7X A;  2E6S A;  3O36 A;  2QJ0 A;  1WE9 A;  4AVX A;  3O35 A;  3EB5 A;  4MVT A;  3ZYQ A;  3M63 A;  1DVP A;  2MKE A;  2PUY A;  4BHW A;  2EOD A;  2KKX A;  4TKP B;  2K16 A;  4AUQ B;  5LKT A;  4PTB A;  1N87 A;  2LXH C;  5G04 B; 
#chains in the Genus database with same CATH homology
 2L0B A;  2KWO A;  2K17 A;  1WEP A;  3M99 A;  4IC3 A;  3RPG B;  4MSX A;  3LQJ A;  4PPE A;  4F52 B;  4QF3 A;  4YAX A;  3SOX A;  2L80 A;  3VK6 A;  2VPB A;  2YT5 A;  3ZVZ B;  4I7C A;  3SOW A;  2NAA A;  5B78 A;  1JOC A;  2F6N A;  5AIT A;  5I3L A;  5EYA F;  1G25 A;  2L5U A;  2E6R A;  5FB0 A;  3DQV R;  2VJE B;  3RPG C;  3MHH A;  3HCT A;  5KH9 A;  2ZET C;  5TRB A;  4WA6 A;  4A49 A;  4A4C A;  2BAY A;  3ZNI A;  2MD8 C;  4A4B A;  5LKZ A;  2JMD A;  4ZQL A;  5D1K B;  4BBQ A;  1RMD A;  1U6G B;  4GND A;  3T6R A;  3N9M A;  2I50 A;  4FK5 A;  4O64 A;  1LDJ B;  3ZPV E;  2VPD A;  2VJF A;  5KH7 A;  3HCU A;  1MM3 A;  1WEE A;  2KWK A;  4FIP A;  4S3O B;  1F62 A;  4GNG A;  2KGG A;  1IYM A;  2Y1N A;  2KFT A;  2LQ6 A;  4QF2 A;  4LAD B;  1VD4 A;  2YHO A;  2L43 A;  2LDR A;  4B7Y C;  2KRE A;  1BOR A;  1VYX A;  2KU3 A;  3KV5 A;  2ECV A;  3N9Q A;  5TBN A;  4C9Z A;  1WEU A;  5LKU A;  4WZ3 B;  4UP5 A;  3C6W A;  1WGM A;  1HYJ A;  2YYR A;  1FBV A;  2LGL A;  2MA6 A;  1WEO A;  4AYC B;  4N3W A;  3V43 A;  1WIL A;  2KYU A;  5FER A;  2RSD A;  2C2L A;  4I7D A;  3N9O A;  5H9M A;  1LDK C;  1VFY A;  2VJE A;  4WZ0 A;  3L1X A;  2ECW A;  4UI9 B;  4LLB A;  4V3K C;  3QZV A;  5J3X A;  5B76 A;  5G0F A;  2VPG A;  3ZPV 1;  2F42 A;  2F6J A;  2YSM A;  3ZTG A;  4CA1 A;  2KIZ A;  1JM7 B;  2G45 A;  4B86 C;  2ECI A;  2YRE A;  3I2D A;  3IHP A;  4X3G A;  4Q6F A;  2XB1 A;  2G6Q A;  2M85 A;  5JG6 A;  3MHS A;  5DIN A;  2LN0 A;  1K2F A;  2C2V S;  4GNE A;  2LRI C;  2D8S A;  5B77 A;  1X4J A;  1Z6U A;  4ZDT A;  2RI7 A;  4YC9 A;  4UP0 A;  2M6M A;  2HDP A;  5G05 B;  2UZG A;  2VP7 A;  2MD7 B;  4NN2 A;  1WFK A;  2KR4 A;  4YBS A;  3M62 A;  2CKL B;  1CHC A;  2EGP A;  2AN6 A;  1WEW A;  2MNZ A;  5D1M B;  1MM2 A;  1V87 A;  1XWH A;  3GL6 A;  2MNY A;  2QIC A;  5FEY A;  5H1T A;  4AP4 A;  2OXQ C;  2VNF A;  2H0D B;  1ZBD B;  2VJF B;  2K1J A;  5H1U A;  1JM7 A;  1FP0 A;  3SHB A;  4YBM A;  3LRQ A;  2L75 A;  4IC2 A;  3KQI A;  2Y1M A;  5B75 A;  3HCS A;  4S3O C;  5LCW B;  4YAB A;  2JMI A;  1HYI A;  4L58 A;  5FB1 A;  4GB0 A;  4GNF A;  2Y43 A;  2JRJ A;  2ECG A;  3O7A A;  5TDR A;  1T1H A;  3C5K A;  3GV4 A;  4I7B A;  3O70 A;  2EA6 A;  2FSA A;  2LGV A;  3PHD A;  1X4I A;  5B79 A;  2MIQ A;  5DKA A;  3ZVY A;  1WEN A;  2ECT A;  2G43 A;  3N9P A;  4N4F A;  4WZ2 A;  2KE1 A;  2K4D A;  3DPL R;  2MA5 A;  2YW8 A;  3KV6 A;  1WEQ A;  1WIM A;  3LQH A;  4R2Y A;  4A0C D;  2YSJ A;  2CSZ A;  4W4U A;  2YQM A;  3RTR B;  2HYE D;  2CKL A;  2FUI A;  3N9N A;  1Z60 A;  1E4U A;  4LJN A;  3EB6 A;  2M1R A;  5LKX A;  1WEV A;  2XEU A;  3T7L A;  4R7E A;  5TDW A;  5B8D A;  5KH3 A;  2ECN A;  2H0D A;  1X4U A;  3N9L A;  5C13 A;  3O33 A;  4XI1 A;  3SOU A;  3FL2 A;  5C11 A;  2YHN A;  2IDA A;  2LGG A;  2YQL A;  2PNX A;  3U5O A;  2LV9 A;  4V3L C;  2QIZ A;  4YAT A;  2LXP C;  4FJC A;  2KWJ A;  2FUU A;  2ECJ A;  2KGI A;  1WEM A;  1Z2Q A;  2MUM A;  3O34 A;  4YAD A;  2YU4 A;  3PUQ A;  3L1Z B;  4FO9 A;  2M3H A;  5AIU A;  4LK9 A;  3U5M A;  5TAB A;  3U5N A;  2LGK A;  3O37 A;  4P5O B;  1WES A;  3NG2 A;  3HTK C;  4AYC A;  3ASL A;  3PUR A;  2JMJ A;  2MT5 A;  4CCG X;  3U5P A;  5H1V A;  5D1L B;  2YUC A;  2YUR A;  2CT2 A;  3KNV A;  4ZUX U;  4R8P K;  3LQI A;  3L11 A;  2VPE A;  4YBT A;  2DX8 A;  2CSY A;  2KWN A;  4LKA A;  4L7X A;  2E6S A;  3O36 A;  2QJ0 A;  1WE9 A;  4AVX A;  3O35 A;  3EB5 A;  3ZYQ A;  4MVT A;  3M63 A;  1DVP A;  2PUY A;  4BHW A;  2EOD A;  4TKP B;  2K16 A;  4AUQ B;  5LKT A;  4PTB A;  1N87 A;  2LXH C;  5G04 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...