4LADB

Crystal structure of the ube2g2:ring-g2br complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
69
Chain Sequence
DDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMGSADERQRMLVQRKDELLQQARKRFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/ligase
molecule keywords Ubiquitin-conjugating enzyme E2 G2
publication title Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 69
sequence length 121
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13639 zf-RING_2 Ring finger domain
B PF18442 G2BR E3 gp78 Ube2g2-binding region (G2BR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ladB00
3SOUA 3PUQA 1ZBDB 1VFYA 3U5MA 3VK6A 2M6MA 4QF2A 4Q6FA 2LQ6A 2Y43A 3PURA 2VPBA 2ECNA 4IC2A 2LV9A 3GL6A 3ZVYA 4YBTA 3HCUA 2YQLA 5D1KB 3T6RA 3MHHA 5G0FA 5FERA 4N3WA 3ASLA 1HYIA 2JMJA 4LKAA 3O7AA 5LKZA 2Y1NA 2ECWA 4NN2A 1WFKA 4ZUXU 1V87A 5TABA 4A4CA 2L5UA 5G04B 2VPDA 5TDWA 2CSZA 4UP5A 1X4UA 1WE9A 1IYMA 4YC9A 2KWOA 2LGLA 4LADB 3ZNIA 4L7XA 2G45A 2QICA 4B7YC 4A49A 2K1JA 3DQVR 1WESA 3O70A 3PHDA 1X4JA 2PNXA 2VPEA 1Z60A 4MSXA 4V3KC 2L43A 2YSJA 4WA6A 4B86C 1F62A 4N4FA 3C5KA 3M99A 5H9MA 2LGVA 5B75A 3SOWA 2YHNA 4PPEA 4A0CD 2VNFA 4F52B 2OXQC 4WZ0A 1XWHA 3N9QA 2KGIA 4AYCB 5TRBA 5TDRA 4R2YA 2K4DA 2JMDA 2F6NA 2YQMA 2YSMA 2L75A 2ECJA 4LLBA 1WILA 2M1RA 3KNVA 2C2LA 3MHSA 5FB0A 2LN0A 2FUUA 2QIZA 2YT5A 2KIZA 5FEYA 4MVTA 3HCSA 4GNDA 2HDPA 2KE1A 3RTRB 2XEUA 2VJFA 2MT5A 2YURA 1E4UA 4BBQA 1K2FA 2CKLA 3LQHA 4UI9B 1LDKC 4S3OB 5G05B 5LKTA 2DX8A 2JMIA 2VJFB 4YAXA 3L1ZB 5H1UA 3RPGB 1WENA 5B76A 3KQIA 5B8DA 3ZPV1 2CKLB 3V43A 2KFTA 2NAAA 1JM7B 2ZETC 4WZ3B 2PUYA 2MNZA 2C2VS 5LKXA 3O33A 2KWJA 2CT2A 2ECTA 2K17A 4O64A 2L0BA 3U5NA 1BORA 1LDJB 3I2DA 5C13A 3U5OA 2KU3A 2MA6A 2KWNA 2EA6A 1RMDA 3L11A 4IC3A 1MM3A 4YBSA 2L80A 3ZPVE 2YREA 2KREA 5AIUA 3ZTGA 4GB0A 2IDAA 3O36A 4LJNA 2UZGA 5B78A 1X4IA 4I7BA 4CA1A 3M62A 2LXHC 4V3LC 2E6SA 1DVPA 2ECGA 4I7DA 4AYCA 2E6RA 5FB1A 1FP0A 1HYJA 1JOCA 2YUCA 4L58A 2KGGA 2AN6A 3SOXA 4CCGX 3HCTA 2LGGA 1FBVA 2ECIA 3SHBA 5KH9A 2YU4A 3N9MA 2MA5A 1WGMA 1N87A 3U5PA 2YHOA 2QJ0A 2MD7B 2I50A 4GNFA 3O34A 3QZVA 1WEPA 4FO9A 5JG6A 2VP7A 2EGPA 3N9PA 4FK5A 2RI7A 1Z6UA 4R8PK 4ZDTA 5D1LB 5B77A 2VJEB 1CHCA 2MNYA 2Y1MA 4XI1A 3M63A 3ZYQA 3N9LA 2JRJA 1VYXA 3IHPA 2EODA 5KH7A 2ECVA 1JM7A 4AUQB 5DINA 5LCWB 4W4UA 5H1TA 5J3XA 2BAYA 3LQIA 2LDRA 4ZQLA 4FJCA 4UP0A 1WIMA 2VPGA 1WEQA 2LXPC 3L1XA 4TKPB 1WEEA 2K16A 1G25A 4YBMA 4BHWA 2YW8A 2FUIA 2KR4A 4WZ2A 2D8SA 2RSDA 2G6QA 4I7CA 2MD8C 1T1HA 5LKUA 2G43A 2LRIC 3KV5A 1WEMA 1WEOA 3T7LA 1WEVA 3N9NA 2YYRA 4YATA 4GNGA 4YABA 2M85A 4P5OB 5DKAA 5I3LA 4AP4A 2XB1A 2LGKA 4R7EA 5C11A 1Z2QA 3LRQA 5H1VA 2HYED 2FSAA 3EB5A 2CSYA 1WEWA 2KYUA 2M3HA 2F6JA 2MUMA 4S3OC 5AITA 3ZVZB 4PTBA 3O37A 4AVXA 4LK9A 5TBNA 2H0DA 1WEUA 5D1MB 2F42A 2MIQA 3RPGC 4X3GA 3FL2A 3GV4A 4GNEA 2KWKA 1U6GB 4A4BA 4C9ZA 1MM2A 5B79A 2H0DB 3EB6A 3C6WA 5EYAF 3DPLR 4YADA 4FIPA 3LQJA 3NG2A 3HTKC 2VJEA 3O35A 3N9OA 3KV6A 1VD4A 5KH3A 4QF3A
chains in the Genus database with same CATH superfamily
2XP0A 3SOUA 3PUQA 1ZBDB 1VFYA 3U5MA 3VK6A 2XOZA 2M6MA 5SVIB 4QF2A 4Q6FA 2JUNA 2LQ6A 2Y43A 3PURA 2VPBA 2ECNA 4IC2A 2LV9A 3GL6A 3ZVYA 4YBTA 3HCUA 2YQLA 5D1KB 3T6RA 3MHHA 5G0FA 5FERA 2IQJA 4N3WA 3FANA 3ASLA 1HYIA 2JMJA 4LKAA 3O7AA 5LKZA 2Y1NA 3DDTA 2ECWA 4NN2A 1WFKA 4H9DA 4ZUXU 1V87A 2XOCA 5TABA 4A4CA 2L5UA 2LAUA 2OWAA 5G04B 2VPDA 5TDWA 2CSZA 4UP5A 1X4UA 1WE9A 1IYMA 4YC9A 3Q1DA 5SVYA 2KWOA 2LGLA 4LADB 3ZNIA 4L7XA 3E2DA 5SVXA 2G45A 2QICA 4B7YC 4A49A 2K1JA 2L7PA 3DQVR 1WESA 3O70A 3PHDA 4F1PA 1X4JA 2PNXA 2VPEA 1Z60A 4MSXA 4V3KC 2L43A 2YSJA 4WA6A 4B86C 1F62A 4N4FA 3C5KA 3M99A 5H9MA 2LGVA 5B75A 3SOWA 2YHNA 4Z0RA 4PPEA 2CRRA 4A0CD 3MDBC 2VNFA 4F52B 2OXQC 4WZ0A 1XWHA 3N9QA 2CONA 2KGIA 4AYCB 5SVIA 5TRBA 5TDRA 4R2YA 2K4DA 2JMDA 2F6NA 2YQMA 2YSMA 2L75A 2ECJA 4LLBA 1WILA 2M1RA 3KNVA 2C2LA 3MHSA 1DCQA 5FB0A 2LN0A 2FUUA 2QIZA 2YT5A 2KIZA 5FEYA 3M7KA 4MVTA 3HCSA 4GNDA 2HDPA 3T9KA 2KE1A 3RTRB 2XEUA 2VJFA 2MT5A 2YURA 1E4UA 4BBQA 1K2FA 2CKLA 3LQHA 4UI9B 1LDKC 4S3OB 5G05B 5LKTA 2DX8A 2JMIA 2VJFB 4YAXA 3L1ZB 5H1UA 3RPGB 1WENA 5B76A 3KQIA 2DSMA 5B8DA 3ZPV1 2CKLB 2FFWA 3V43A 4O62A 2KFTA 2NAAA 1JM7B 2ZETC 4WZ3B 2PUYA 2MNZA 3FM8C 3JUEA 2C2VS 5LKXA 3O33A 2KWJA 2MKEA 2CT2A 2ECTA 2K17A 4O64A 2L0BA 3SUBA 3U5NA 1BORA 1LDJB 3I2DA 5C13A 3U5OA 2FD4A 2P57A 2YVRA 2KU3A 2MA6A 2KWNA 3DWDA 2EA6A 1RMDA 3L11A 4IC3A 1MM3A 4YBSA 2L80A 3ZPVE 2YREA 2KREA 2EXUA 5AIUA 3ZTGA 4GB0A 2IDAA 3O36A 4LJNA 2UZGA 5B78A 1X4IA 4I7BA 4CA1A 3M62A 3LVRE 2LXHC 2JM3A 4V3LC 2E6SA 1DVPA 2ECGA 4I7DA 4AYCA 2E6RA 5FB1A 1FP0A 1HYJA 1JOCA 2KKXA 2YUCA 4L58A 2KGGA 2XOYA 2AN6A 2CRWA 4OGCA 3SOXA 4CCGX 3HCTA 2LGGA 1FBVA 2ECIA 3SHBA 5KH9A 2YU4A 3N9MA 2MA5A 1WGMA 2M13A 1N87A 3O47A 3U5PA 2YHOA 2B0OE 2QJ0A 2MD7B 2I50A 4GNFA 3O34A 3QZVA 1WEPA 4FO9A 5JG6A 2VP7A 2EGPA 3PLWA 2RR4A 3N9PA 4FK5A 2RI7A 3FAOA 1Z6UA 4R8PK 4ZDTA 5D1LB 5B77A 2VJEB 3LDYA 1CHCA 3FJUB 2MNYA 2Y1MA 4XI1A 3M63A 2EGMA 3ZYQA 3N9LA 2JRJA 1VYXA 3IHPA 2EODA 5KH7A 2ECVA 1JM7A 4AUQB 3FEHA 5DINA 5LCWB 4W4UA 5H1TA 5J3XA 2BAYA 3LQIA 2LDRA 4ZQLA 4FJCA 2E61A 4UP0A 1WIMA 2VPGA 1WEQA 2LXPC 3L1XA 4TKPB 1WEEA 2K16A 1G25A 4YBMA 4BHWA 2YW8A 2FUIA 2KR4A 4WZ2A 3KDEC 2D8SA 2RSDA 2G6QA 4I7CA 2MD8C 1T1HA 3LJUX 5LKUA 2G43A 2LRIC 3H7HA 3KV5A 1WEMA 1WEOA 3T7LA 1WEVA 3N9NA 2YYRA 4YATA 4GNGA 4YABA 2M85A 4P5OB 2D8UA 5DKAA 5I3LA 4AP4A 2XB1A 2LGKA 4R7EA 5C11A 1Z2QA 3LRQA 2DJAA 5K3QA 5H1VA 2HYED 2FSAA 4Z0OA 3EB5A 2CSYA 1WEWA 2KYUA 2M3HA 2F6JA 2MUMA 4S3OC 5AITA 3ZVZB 4PTBA 2KKYA 3O37A 4AVXA 4LK9A 5TBNA 2H0DA 1WEUA 5D1MB 2F42A 2MIQA 3RPGC 4X3GA 3FL2A 3GV4A 3LVQE 4GNEA 2KWKA 1U6GB 4A4BA 4C9ZA 1MM2A 5B79A 2H0DB 3EB6A 3C6WA 5EYAF 4QQ4A 3DPLR 4YADA 4FIPA 3LQJA 3NG2A 4OGEA 3HTKC 2VJEA 3O35A 3N9OA 3KV6A 1VD4A 1MBMA 5KH3A 2CSVA 4QF3A
chains in the Genus database with same CATH topology
3SOUA 3PUQA 1ZBDB 1VFYA 3U5MA 3VK6A 2M6MA 4QF2A 4Q6FA 2LQ6A 2Y43A 3PURA 2VPBA 2ECNA 4IC2A 2LV9A 3GL6A 3ZVYA 4YBTA 3HCUA 2YQLA 5D1KB 3T6RA 3MHHA 5G0FA 5FERA 4N3WA 3ASLA 1HYIA 2JMJA 4LKAA 3O7AA 5LKZA 2Y1NA 2ECWA 4NN2A 1WFKA 4ZUXU 1V87A 5TABA 4A4CA 2L5UA 5G04B 2VPDA 5TDWA 2CSZA 4UP5A 1X4UA 1WE9A 1IYMA 4YC9A 2KWOA 2LGLA 4LADB 3ZNIA 4L7XA 2G45A 2QICA 4B7YC 4A49A 2K1JA 3DQVR 1WESA 3O70A 3PHDA 1X4JA 2PNXA 2VPEA 1Z60A 4MSXA 4V3KC 2L43A 2YSJA 4WA6A 4B86C 1F62A 4N4FA 3C5KA 3M99A 5H9MA 2LGVA 5B75A 3SOWA 2YHNA 4PPEA 4A0CD 2VNFA 4F52B 2OXQC 4WZ0A 1XWHA 3N9QA 2KGIA 4AYCB 5TRBA 5TDRA 4R2YA 2K4DA 2JMDA 2F6NA 2YQMA 2YSMA 2L75A 2ECJA 4LLBA 1WILA 2M1RA 3KNVA 2C2LA 3MHSA 5FB0A 2LN0A 2FUUA 2QIZA 2YT5A 2KIZA 5FEYA 4MVTA 3HCSA 4GNDA 2HDPA 2KE1A 3RTRB 2XEUA 2VJFA 2MT5A 2YURA 1E4UA 4BBQA 1K2FA 2CKLA 3LQHA 4UI9B 1LDKC 4S3OB 5G05B 5LKTA 2DX8A 2JMIA 2VJFB 4YAXA 3L1ZB 5H1UA 3RPGB 1WENA 5B76A 3KQIA 5B8DA 3ZPV1 2CKLB 3V43A 2KFTA 2NAAA 1JM7B 2ZETC 4WZ3B 2PUYA 2MNZA 2C2VS 5LKXA 3O33A 2KWJA 2CT2A 2ECTA 2K17A 4O64A 2L0BA 3U5NA 1BORA 1LDJB 3I2DA 5C13A 3U5OA 2KU3A 2MA6A 2KWNA 2EA6A 1RMDA 3L11A 4IC3A 1MM3A 4YBSA 2L80A 3ZPVE 2YREA 2KREA 5AIUA 3ZTGA 4GB0A 2IDAA 3O36A 4LJNA 2UZGA 5B78A 1X4IA 4I7BA 4CA1A 3M62A 2LXHC 4V3LC 2E6SA 1DVPA 2ECGA 4I7DA 4AYCA 2E6RA 5FB1A 1FP0A 1HYJA 1JOCA 2YUCA 4L58A 2KGGA 2AN6A 3SOXA 4CCGX 3HCTA 2LGGA 1FBVA 2ECIA 3SHBA 5KH9A 2YU4A 3N9MA 2MA5A 1WGMA 1N87A 3U5PA 2YHOA 2QJ0A 2MD7B 2I50A 4GNFA 3O34A 3QZVA 1WEPA 4FO9A 5JG6A 2VP7A 2EGPA 3N9PA 4FK5A 2RI7A 1Z6UA 4R8PK 4ZDTA 5D1LB 5B77A 2VJEB 1CHCA 2MNYA 2Y1MA 4XI1A 3M63A 3ZYQA 3N9LA 2JRJA 1VYXA 3IHPA 2EODA 5KH7A 2ECVA 1JM7A 4AUQB 5DINA 5LCWB 4W4UA 5H1TA 5J3XA 2BAYA 3LQIA 2LDRA 4ZQLA 4FJCA 4UP0A 1WIMA 2VPGA 1WEQA 2LXPC 3L1XA 4TKPB 1WEEA 2K16A 1G25A 4YBMA 4BHWA 2YW8A 2FUIA 2KR4A 4WZ2A 2D8SA 2RSDA 2G6QA 4I7CA 2MD8C 1T1HA 5LKUA 2G43A 2LRIC 3KV5A 1WEMA 1WEOA 3T7LA 1WEVA 3N9NA 2YYRA 4YATA 4GNGA 4YABA 2M85A 4P5OB 5DKAA 5I3LA 4AP4A 2XB1A 2LGKA 4R7EA 5C11A 1Z2QA 3LRQA 5H1VA 2HYED 2FSAA 3EB5A 2CSYA 1WEWA 2KYUA 2M3HA 2F6JA 2MUMA 4S3OC 5AITA 3ZVZB 4PTBA 3O37A 4AVXA 4LK9A 5TBNA 2H0DA 1WEUA 5D1MB 2F42A 2MIQA 3RPGC 4X3GA 3FL2A 3GV4A 4GNEA 2KWKA 1U6GB 4A4BA 4C9ZA 1MM2A 5B79A 2H0DB 3EB6A 3C6WA 5EYAF 3DPLR 4YADA 4FIPA 3LQJA 3NG2A 3HTKC 2VJEA 3O35A 3N9OA 3KV6A 1VD4A 5KH3A 4QF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOU A;  3PUQ A;  1ZBD B;  1VFY A;  3U5M A;  3VK6 A;  2M6M A;  4QF2 A;  4Q6F A;  2LQ6 A;  2Y43 A;  3PUR A;  2VPB A;  2ECN A;  4IC2 A;  2LV9 A;  3GL6 A;  3ZVY A;  4YBT A;  3HCU A;  2YQL A;  5D1K B;  3T6R A;  3MHH A;  5G0F A;  5FER A;  4N3W A;  3ASL A;  1HYI A;  2JMJ A;  4LKA A;  3O7A A;  5LKZ A;  2Y1N A;  2ECW A;  4NN2 A;  1WFK A;  4ZUX U;  1V87 A;  5TAB A;  4A4C A;  2L5U A;  5G04 B;  2VPD A;  5TDW A;  2CSZ A;  4UP5 A;  1X4U A;  1WE9 A;  1IYM A;  4YC9 A;  2KWO A;  2LGL A;  4LAD B;  3ZNI A;  4L7X A;  2G45 A;  2QIC A;  4B7Y C;  4A49 A;  2K1J A;  3DQV R;  1WES A;  3O70 A;  3PHD A;  1X4J A;  2PNX A;  2VPE A;  1Z60 A;  4MSX A;  4V3K C;  2L43 A;  2YSJ A;  4WA6 A;  4B86 C;  1F62 A;  4N4F A;  3C5K A;  3M99 A;  5H9M A;  2LGV A;  5B75 A;  3SOW A;  2YHN A;  4PPE A;  4A0C D;  2VNF A;  4F52 B;  2OXQ C;  4WZ0 A;  1XWH A;  3N9Q A;  2KGI A;  4AYC B;  5TRB A;  5TDR A;  4R2Y A;  2K4D A;  2JMD A;  2F6N A;  2YQM A;  2YSM A;  2L75 A;  2ECJ A;  4LLB A;  1WIL A;  2M1R A;  3KNV A;  2C2L A;  3MHS A;  5FB0 A;  2LN0 A;  2FUU A;  2QIZ A;  2YT5 A;  2KIZ A;  5FEY A;  4MVT A;  3HCS A;  4GND A;  2HDP A;  2KE1 A;  3RTR B;  2XEU A;  2VJF A;  2MT5 A;  2YUR A;  1E4U A;  4BBQ A;  1K2F A;  2CKL A;  3LQH A;  4UI9 B;  1LDK C;  4S3O B;  5G05 B;  5LKT A;  2DX8 A;  2JMI A;  2VJF B;  4YAX A;  3L1Z B;  5H1U A;  3RPG B;  1WEN A;  5B76 A;  3KQI A;  5B8D A;  3ZPV 1;  2CKL B;  3V43 A;  2KFT A;  2NAA A;  1JM7 B;  2ZET C;  4WZ3 B;  2PUY A;  2MNZ A;  2C2V S;  5LKX A;  3O33 A;  2KWJ A;  2CT2 A;  2ECT A;  2K17 A;  4O64 A;  2L0B A;  3U5N A;  1BOR A;  1LDJ B;  3I2D A;  5C13 A;  3U5O A;  2KU3 A;  2MA6 A;  2KWN A;  2EA6 A;  1RMD A;  3L11 A;  4IC3 A;  1MM3 A;  4YBS A;  2L80 A;  3ZPV E;  2YRE A;  2KRE A;  5AIU A;  3ZTG A;  4GB0 A;  2IDA A;  3O36 A;  4LJN A;  2UZG A;  5B78 A;  1X4I A;  4I7B A;  4CA1 A;  3M62 A;  2LXH C;  4V3L C;  2E6S A;  1DVP A;  2ECG A;  4I7D A;  4AYC A;  2E6R A;  5FB1 A;  1FP0 A;  1HYJ A;  1JOC A;  2YUC A;  4L58 A;  2KGG A;  2AN6 A;  3SOX A;  4CCG X;  3HCT A;  2LGG A;  1FBV A;  2ECI A;  3SHB A;  5KH9 A;  2YU4 A;  3N9M A;  2MA5 A;  1WGM A;  1N87 A;  3U5P A;  2YHO A;  2QJ0 A;  2MD7 B;  2I50 A;  4GNF A;  3O34 A;  3QZV A;  1WEP A;  4FO9 A;  5JG6 A;  2VP7 A;  2EGP A;  3N9P A;  4FK5 A;  2RI7 A;  1Z6U A;  4R8P K;  4ZDT A;  5D1L B;  5B77 A;  2VJE B;  1CHC A;  2MNY A;  2Y1M A;  4XI1 A;  3M63 A;  3ZYQ A;  3N9L A;  2JRJ A;  1VYX A;  3IHP A;  2EOD A;  5KH7 A;  2ECV A;  1JM7 A;  4AUQ B;  5DIN A;  5LCW B;  4W4U A;  5H1T A;  5J3X A;  2BAY A;  3LQI A;  2LDR A;  4ZQL A;  4FJC A;  4UP0 A;  1WIM A;  2VPG A;  1WEQ A;  2LXP C;  3L1X A;  4TKP B;  1WEE A;  2K16 A;  1G25 A;  4YBM A;  4BHW A;  2YW8 A;  2FUI A;  2KR4 A;  4WZ2 A;  2D8S A;  2RSD A;  2G6Q A;  4I7C A;  2MD8 C;  1T1H A;  5LKU A;  2G43 A;  2LRI C;  3KV5 A;  1WEM A;  1WEO A;  3T7L A;  1WEV A;  3N9N A;  2YYR A;  4YAT A;  4GNG A;  4YAB A;  2M85 A;  4P5O B;  5DKA A;  5I3L A;  4AP4 A;  2XB1 A;  2LGK A;  4R7E A;  5C11 A;  1Z2Q A;  3LRQ A;  5H1V A;  2HYE D;  2FSA A;  3EB5 A;  2CSY A;  1WEW A;  2KYU A;  2M3H A;  2F6J A;  2MUM A;  4S3O C;  5AIT A;  3ZVZ B;  4PTB A;  3O37 A;  4AVX A;  4LK9 A;  5TBN A;  2H0D A;  1WEU A;  5D1M B;  2F42 A;  2MIQ A;  3RPG C;  4X3G A;  3FL2 A;  3GV4 A;  4GNE A;  2KWK A;  1U6G B;  4A4B A;  4C9Z A;  1MM2 A;  5B79 A;  2H0D B;  3EB6 A;  3C6W A;  5EYA F;  3DPL R;  4YAD A;  4FIP A;  3LQJ A;  3NG2 A;  3HTK C;  2VJE A;  3O35 A;  3N9O A;  3KV6 A;  1VD4 A;  5KH3 A;  4QF3 A; 
#chains in the Genus database with same CATH topology
 2XP0 A;  3SOU A;  3PUQ A;  1ZBD B;  1VFY A;  3U5M A;  3VK6 A;  2XOZ A;  2M6M A;  5SVI B;  4QF2 A;  4Q6F A;  2JUN A;  2LQ6 A;  2Y43 A;  3PUR A;  2VPB A;  2ECN A;  4IC2 A;  2LV9 A;  3GL6 A;  3ZVY A;  4YBT A;  3HCU A;  2YQL A;  5D1K B;  3T6R A;  3MHH A;  5G0F A;  5FER A;  2IQJ A;  4N3W A;  3FAN A;  3ASL A;  1HYI A;  2JMJ A;  4LKA A;  3O7A A;  5LKZ A;  2Y1N A;  3DDT A;  2ECW A;  4NN2 A;  1WFK A;  4H9D A;  4ZUX U;  1V87 A;  2XOC A;  5TAB A;  4A4C A;  2L5U A;  2LAU A;  2OWA A;  5G04 B;  2VPD A;  5TDW A;  2CSZ A;  4UP5 A;  1X4U A;  1WE9 A;  1IYM A;  4YC9 A;  3Q1D A;  5SVY A;  2KWO A;  2LGL A;  4LAD B;  3ZNI A;  4L7X A;  3E2D A;  5SVX A;  2G45 A;  2QIC A;  4B7Y C;  4A49 A;  2K1J A;  2L7P A;  3DQV R;  1WES A;  3O70 A;  3PHD A;  4F1P A;  1X4J A;  2PNX A;  2VPE A;  1Z60 A;  4MSX A;  4V3K C;  2L43 A;  2YSJ A;  4WA6 A;  4B86 C;  1F62 A;  4N4F A;  3C5K A;  3M99 A;  5H9M A;  2LGV A;  5B75 A;  3SOW A;  2YHN A;  4Z0R A;  4PPE A;  2CRR A;  4A0C D;  3MDB C;  2VNF A;  4F52 B;  2OXQ C;  4WZ0 A;  1XWH A;  3N9Q A;  2CON A;  2KGI A;  4AYC B;  5SVI A;  5TRB A;  5TDR A;  4R2Y A;  2K4D A;  2JMD A;  2F6N A;  2YQM A;  2YSM A;  2L75 A;  2ECJ A;  4LLB A;  1WIL A;  2M1R A;  3KNV A;  2C2L A;  3MHS A;  1DCQ A;  5FB0 A;  2LN0 A;  2FUU A;  2QIZ A;  2YT5 A;  2KIZ A;  5FEY A;  3M7K A;  4MVT A;  3HCS A;  4GND A;  2HDP A;  3T9K A;  2KE1 A;  3RTR B;  2XEU A;  2VJF A;  2MT5 A;  2YUR A;  1E4U A;  4BBQ A;  1K2F A;  2CKL A;  3LQH A;  4UI9 B;  1LDK C;  4S3O B;  5G05 B;  5LKT A;  2DX8 A;  2JMI A;  2VJF B;  4YAX A;  3L1Z B;  5H1U A;  3RPG B;  1WEN A;  5B76 A;  3KQI A;  2DSM A;  5B8D A;  3ZPV 1;  2CKL B;  2FFW A;  3V43 A;  4O62 A;  2KFT A;  2NAA A;  1JM7 B;  2ZET C;  4WZ3 B;  2PUY A;  2MNZ A;  3FM8 C;  3JUE A;  2C2V S;  5LKX A;  3O33 A;  2KWJ A;  2MKE A;  2CT2 A;  2ECT A;  2K17 A;  4O64 A;  2L0B A;  3SUB A;  3U5N A;  1BOR A;  1LDJ B;  3I2D A;  5C13 A;  3U5O A;  2FD4 A;  2P57 A;  2YVR A;  2KU3 A;  2MA6 A;  2KWN A;  3DWD A;  2EA6 A;  1RMD A;  3L11 A;  4IC3 A;  1MM3 A;  4YBS A;  2L80 A;  3ZPV E;  2YRE A;  2KRE A;  2EXU A;  5AIU A;  3ZTG A;  4GB0 A;  2IDA A;  3O36 A;  4LJN A;  2UZG A;  5B78 A;  1X4I A;  4I7B A;  4CA1 A;  3M62 A;  3LVR E;  2LXH C;  2JM3 A;  4V3L C;  2E6S A;  1DVP A;  2ECG A;  4I7D A;  4AYC A;  2E6R A;  5FB1 A;  1FP0 A;  1HYJ A;  1JOC A;  2KKX A;  2YUC A;  4L58 A;  2KGG A;  2XOY A;  2AN6 A;  2CRW A;  4OGC A;  3SOX A;  4CCG X;  3HCT A;  2LGG A;  1FBV A;  2ECI A;  3SHB A;  5KH9 A;  2YU4 A;  3N9M A;  2MA5 A;  1WGM A;  2M13 A;  1N87 A;  3O47 A;  3U5P A;  2YHO A;  2B0O E;  2QJ0 A;  2MD7 B;  2I50 A;  4GNF A;  3O34 A;  3QZV A;  1WEP A;  4FO9 A;  5JG6 A;  2VP7 A;  2EGP A;  3PLW A;  2RR4 A;  3N9P A;  4FK5 A;  2RI7 A;  3FAO A;  1Z6U A;  4R8P K;  4ZDT A;  5D1L B;  5B77 A;  2VJE B;  3LDY A;  1CHC A;  3FJU B;  2MNY A;  2Y1M A;  4XI1 A;  3M63 A;  2EGM A;  3ZYQ A;  3N9L A;  2JRJ A;  1VYX A;  3IHP A;  2EOD A;  5KH7 A;  2ECV A;  1JM7 A;  4AUQ B;  3FEH A;  5DIN A;  5LCW B;  4W4U A;  5H1T A;  5J3X A;  2BAY A;  3LQI A;  2LDR A;  4ZQL A;  4FJC A;  2E61 A;  4UP0 A;  1WIM A;  2VPG A;  1WEQ A;  2LXP C;  3L1X A;  4TKP B;  1WEE A;  2K16 A;  1G25 A;  4YBM A;  4BHW A;  2YW8 A;  2FUI A;  2KR4 A;  4WZ2 A;  3KDE C;  2D8S A;  2RSD A;  2G6Q A;  4I7C A;  2MD8 C;  1T1H A;  3LJU X;  5LKU A;  2G43 A;  2LRI C;  3H7H A;  3KV5 A;  1WEM A;  1WEO A;  3T7L A;  1WEV A;  3N9N A;  2YYR A;  4YAT A;  4GNG A;  4YAB A;  2M85 A;  4P5O B;  2D8U A;  5DKA A;  5I3L A;  4AP4 A;  2XB1 A;  2LGK A;  4R7E A;  5C11 A;  1Z2Q A;  3LRQ A;  2DJA A;  5K3Q A;  5H1V A;  2HYE D;  2FSA A;  4Z0O A;  3EB5 A;  2CSY A;  1WEW A;  2KYU A;  2M3H A;  2F6J A;  2MUM A;  4S3O C;  5AIT A;  3ZVZ B;  4PTB A;  2KKY A;  3O37 A;  4AVX A;  4LK9 A;  5TBN A;  2H0D A;  1WEU A;  5D1M B;  2F42 A;  2MIQ A;  3RPG C;  4X3G A;  3FL2 A;  3GV4 A;  3LVQ E;  4GNE A;  2KWK A;  1U6G B;  4A4B A;  4C9Z A;  1MM2 A;  5B79 A;  2H0D B;  3EB6 A;  3C6W A;  5EYA F;  4QQ4 A;  3DPL R;  4YAD A;  4FIP A;  3LQJ A;  3NG2 A;  4OGE A;  3HTK C;  2VJE A;  3O35 A;  3N9O A;  3KV6 A;  1VD4 A;  1MBM A;  5KH3 A;  2CSV A;  4QF3 A; 
#chains in the Genus database with same CATH homology
 3SOU A;  3PUQ A;  1ZBD B;  1VFY A;  3U5M A;  3VK6 A;  2M6M A;  4QF2 A;  4Q6F A;  2LQ6 A;  2Y43 A;  3PUR A;  2VPB A;  2ECN A;  4IC2 A;  2LV9 A;  3GL6 A;  3ZVY A;  4YBT A;  3HCU A;  2YQL A;  5D1K B;  3T6R A;  3MHH A;  5G0F A;  5FER A;  4N3W A;  3ASL A;  1HYI A;  2JMJ A;  4LKA A;  3O7A A;  5LKZ A;  2Y1N A;  2ECW A;  4NN2 A;  1WFK A;  4ZUX U;  1V87 A;  5TAB A;  4A4C A;  2L5U A;  5G04 B;  2VPD A;  5TDW A;  2CSZ A;  4UP5 A;  1X4U A;  1WE9 A;  1IYM A;  4YC9 A;  2KWO A;  2LGL A;  4LAD B;  3ZNI A;  4L7X A;  2G45 A;  2QIC A;  4B7Y C;  4A49 A;  2K1J A;  3DQV R;  1WES A;  3O70 A;  3PHD A;  1X4J A;  2PNX A;  2VPE A;  1Z60 A;  4MSX A;  4V3K C;  2L43 A;  2YSJ A;  4WA6 A;  4B86 C;  1F62 A;  4N4F A;  3C5K A;  3M99 A;  5H9M A;  2LGV A;  5B75 A;  3SOW A;  2YHN A;  4PPE A;  4A0C D;  2VNF A;  4F52 B;  2OXQ C;  4WZ0 A;  1XWH A;  3N9Q A;  2KGI A;  4AYC B;  5TRB A;  5TDR A;  4R2Y A;  2K4D A;  2JMD A;  2F6N A;  2YQM A;  2YSM A;  2L75 A;  2ECJ A;  4LLB A;  1WIL A;  2M1R A;  3KNV A;  2C2L A;  3MHS A;  5FB0 A;  2LN0 A;  2FUU A;  2QIZ A;  2YT5 A;  2KIZ A;  5FEY A;  4MVT A;  3HCS A;  4GND A;  2HDP A;  2KE1 A;  3RTR B;  2XEU A;  2VJF A;  2MT5 A;  2YUR A;  1E4U A;  4BBQ A;  1K2F A;  2CKL A;  3LQH A;  4UI9 B;  1LDK C;  4S3O B;  5G05 B;  5LKT A;  2DX8 A;  2JMI A;  2VJF B;  4YAX A;  3L1Z B;  5H1U A;  3RPG B;  1WEN A;  5B76 A;  3KQI A;  5B8D A;  3ZPV 1;  2CKL B;  3V43 A;  2KFT A;  2NAA A;  1JM7 B;  2ZET C;  4WZ3 B;  2PUY A;  2MNZ A;  2C2V S;  5LKX A;  3O33 A;  2KWJ A;  2CT2 A;  2ECT A;  2K17 A;  4O64 A;  2L0B A;  3U5N A;  1BOR A;  1LDJ B;  3I2D A;  5C13 A;  3U5O A;  2KU3 A;  2MA6 A;  2KWN A;  2EA6 A;  1RMD A;  3L11 A;  4IC3 A;  1MM3 A;  4YBS A;  2L80 A;  3ZPV E;  2YRE A;  2KRE A;  5AIU A;  3ZTG A;  4GB0 A;  2IDA A;  3O36 A;  4LJN A;  2UZG A;  5B78 A;  1X4I A;  4I7B A;  4CA1 A;  3M62 A;  2LXH C;  4V3L C;  2E6S A;  1DVP A;  2ECG A;  4I7D A;  4AYC A;  2E6R A;  5FB1 A;  1FP0 A;  1HYJ A;  1JOC A;  2YUC A;  4L58 A;  2KGG A;  2AN6 A;  3SOX A;  4CCG X;  3HCT A;  2LGG A;  1FBV A;  2ECI A;  3SHB A;  5KH9 A;  2YU4 A;  3N9M A;  2MA5 A;  1WGM A;  1N87 A;  3U5P A;  2YHO A;  2QJ0 A;  2MD7 B;  2I50 A;  4GNF A;  3O34 A;  3QZV A;  1WEP A;  4FO9 A;  5JG6 A;  2VP7 A;  2EGP A;  3N9P A;  4FK5 A;  2RI7 A;  1Z6U A;  4R8P K;  4ZDT A;  5D1L B;  5B77 A;  2VJE B;  1CHC A;  2MNY A;  2Y1M A;  4XI1 A;  3M63 A;  3ZYQ A;  3N9L A;  2JRJ A;  1VYX A;  3IHP A;  2EOD A;  5KH7 A;  2ECV A;  1JM7 A;  4AUQ B;  5DIN A;  5LCW B;  4W4U A;  5H1T A;  5J3X A;  2BAY A;  3LQI A;  2LDR A;  4ZQL A;  4FJC A;  4UP0 A;  1WIM A;  2VPG A;  1WEQ A;  2LXP C;  3L1X A;  4TKP B;  1WEE A;  2K16 A;  1G25 A;  4YBM A;  4BHW A;  2YW8 A;  2FUI A;  2KR4 A;  4WZ2 A;  2D8S A;  2RSD A;  2G6Q A;  4I7C A;  2MD8 C;  1T1H A;  5LKU A;  2G43 A;  2LRI C;  3KV5 A;  1WEM A;  1WEO A;  3T7L A;  1WEV A;  3N9N A;  2YYR A;  4YAT A;  4GNG A;  4YAB A;  2M85 A;  4P5O B;  5DKA A;  5I3L A;  4AP4 A;  2XB1 A;  2LGK A;  4R7E A;  5C11 A;  1Z2Q A;  3LRQ A;  5H1V A;  2HYE D;  2FSA A;  3EB5 A;  2CSY A;  1WEW A;  2KYU A;  2M3H A;  2F6J A;  2MUM A;  4S3O C;  5AIT A;  3ZVZ B;  4PTB A;  3O37 A;  4AVX A;  4LK9 A;  5TBN A;  2H0D A;  1WEU A;  5D1M B;  2F42 A;  2MIQ A;  3RPG C;  4X3G A;  3FL2 A;  3GV4 A;  4GNE A;  2KWK A;  1U6G B;  4A4B A;  4C9Z A;  1MM2 A;  5B79 A;  2H0D B;  3EB6 A;  3C6W A;  5EYA F;  3DPL R;  4YAD A;  4FIP A;  3LQJ A;  3NG2 A;  3HTK C;  2VJE A;  3O35 A;  3N9O A;  3KV6 A;  1VD4 A;  5KH3 A;  4QF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...