1WFKA

Fyve domain of fyve domain containing 19 protein from mus musculus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
GSSGSSGMESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTRGSSDNASKWSPPQNYKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords zinc finger, FYVE domain containing 19
publication title FYVE domain of FYVE domain containing 19 protein from Mus musculus
rcsb
source organism Mus musculus
total genus 7
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wfkA01
2MNYA 2YREA 4I7CA 3NG2A 5AITA 4P5OB 4MSXA 5TDRA 5B76A 2VNFA 3RPGC 2H0DA 1V87A 2EGPA 2L5UA 5DINA 5H9MA 2KREA 4LK9A 2G45A 4ZDTA 4I7BA 4N3WA 3PURA 2CSYA 4PTBA 2KGIA 2FSAA 5KH7A 4WZ0A 5B77A 4A49A 4WA6A 2CKLA 4YBSA 5TDWA 1MM2A 4YADA 2OXQC 4UP5A 5D1LB 1WEWA 1X4JA 5EYAF 5D1KB 4R2YA 2H0DB 2YQMA 2LGVA 3LRQA 3ZVYA 3U5NA 3RPGB 2YSMA 1WIMA 2LGKA 3RTRB 2MIQA 1WGMA 3SOUA 2MA5A 1ZBDB 3GV4A 4YBTA 4YABA 3N9MA 3O37A 4L7XA 2EA6A 2IDAA 5D1MB 4IC2A 2CKLB 3O7AA 5DKAA 2I50A 2CSZA 4GNFA 2VPEA 1MM3A 1WEMA 3L1XA 3ZPVE 1WFKA 4QF2A 2L75A 4FIPA 2K16A 4V3LC 2RSDA 2L43A 4A0CD 3IHPA 3C5KA 3KV6A 2PUYA 2C2VS 3O70A 2L0BA 1VD4A 5H1UA 5G04B 3N9OA 1U6GB 4V3KC 5H1VA 4FJCA 1BORA 2ECGA 2YURA 4BBQA 3N9LA 2K17A 2QIZA 4B7YC 5B79A 3I2DA 3LQIA 3O35A 4O64A 2VPGA 2K1JA 1JOCA 3FL2A 3L1ZB 2JMJA 3SOXA 2M1RA 2MA6A 5TBNA 2RI7A 1DVPA 1FBVA 1N87A 2M6MA 5KH9A 2BAYA 2G6QA 2F6JA 4MVTA 2AN6A 2Y1NA 2YQLA 5LKUA 5LCWB 4LLBA 4YBMA 5C11A 1Z60A 3C6WA 4UP0A 4A4CA 5JG6A 2ZETC 4L58A 3MHSA 2G43A 4CA1A 3O34A 1IYMA 3HCTA 2Y43A 2YUCA 1Z2QA 2LV9A 3T7LA 1HYIA 3U5OA 4AUQB 3DPLR 2MUMA 2VP7A 4LKAA 4UI9B 2HDPA 3U5MA 3ZNIA 1K2FA 4LJNA 2YU4A 2KR4A 3LQJA 2QICA 1Z6UA 3SOWA 2HYED 2VPDA 4A4BA 5B78A 2LGGA 4QF3A 5LKXA 4FO9A 3N9PA 2YYRA 4PPEA 3HCSA 4YATA 2ECTA 2ECIA 3PUQA 5I3LA 3ASLA 5AIUA 2VJEA 4XI1A 1WENA 2LDRA 3O33A 4GB0A 2K4DA 4YC9A 2VPBA 4AP4A 5FEYA 4Q6FA 5LKTA 2ECJA 2JMIA 5TRBA 3EB6A 5B8DA 2Y1MA 4LADB 1WILA 2MNZA 3ZYQA 4GNGA 2FUIA 2VJEB 2LQ6A 2KWNA 5C13A 2JMDA 2ECNA 2KWJA 1X4UA 1E4UA 1WEEA 4N4FA 2M3HA 5FB0A 3KNVA 2KWOA 3VK6A 3GL6A 2F42A 1WESA 4IC3A 2VJFA 3ZTGA 5J3XA 1JM7A 5G05B 2C2LA 4F52B 1VYXA 2LN0A 3M62A 3ZVZB 1RMDA 1XWHA 2QJ0A 4CCGX 4ZUXU 2XB1A 2YHOA 4R7EA 5G0FA 1G25A 2CT2A 2EODA 5B75A 1T1HA 3HTKC 2FUUA 2LRIC 2D8SA 2KU3A 2YW8A 5TABA 5LKZA 2VJFB 3O36A 3V43A 5FERA 1JM7B 1HYJA 2LGLA 1WEUA 4R8PK 3HCUA 2MD7B 1WEPA 4WZ3B 2PNXA 2UZGA 2KWKA 1CHCA 2ECVA 5KH3A 2KFTA 4BHWA 1LDKC 3N9NA 1WEVA 4TKPB 2KIZA 4YAXA 3ZPV1 3DQVR 1F62A 4FK5A 2F6NA 2KYUA 3SHBA 2NAAA 3M99A 3M63A 2L80A 5FB1A 2JRJA 4WZ2A 2E6RA 2DX8A 4B86C 2LXPC 4ZQLA 2KE1A 3N9QA 3QZVA 1X4IA 2MD8C 4I7DA 2M85A 3T6RA 2XEUA 4S3OC 4AYCA 4GNEA 4GNDA 3U5PA 3KV5A 4C9ZA 2YSJA 2YHNA 3EB5A 3KQIA 4X3GA 1WEQA 2YT5A 2MT5A 1WEOA 2LXHC 2ECWA 3LQHA 2E6SA 3MHHA 4AVXA 1FP0A 4NN2A 4W4UA 1LDJB 4AYCB 3PHDA 1VFYA 3L11A 1WE9A 2KGGA 4S3OB 5H1TA
chains in the Genus database with same CATH superfamily
2MNYA 2KKXA 2YREA 4I7CA 3NG2A 5AITA 4P5OB 4MSXA 5TDRA 5B76A 2VNFA 3RPGC 2H0DA 1V87A 2EGPA 2L5UA 5DINA 5H9MA 2KREA 4LK9A 2G45A 4ZDTA 4I7BA 3H7HA 4N3WA 3PURA 2CSYA 4PTBA 2KGIA 2FSAA 5KH7A 3DWDA 3M7KA 4WZ0A 5B77A 4A49A 4WA6A 2CKLA 4YBSA 5TDWA 1MM2A 2XP0A 4YADA 2OXQC 4UP5A 5D1LB 1DCQA 1WEWA 3LJUX 1X4JA 5EYAF 5D1KB 4R2YA 2H0DB 2YQMA 3FANA 2LGVA 3LRQA 3ZVYA 3U5NA 3RPGB 2YSMA 1WIMA 2LGKA 3RTRB 2MIQA 1WGMA 3SOUA 2MA5A 1ZBDB 3GV4A 4YBTA 4YABA 4H9DA 3N9MA 3O37A 4L7XA 2EA6A 2CONA 2IDAA 5D1MB 4IC2A 2CKLB 3O7AA 5DKAA 2I50A 2CSZA 4GNFA 2VPEA 1MM3A 1WEMA 3L1XA 3ZPVE 1WFKA 4QF2A 3LDYA 2L75A 4FIPA 2K16A 4V3LC 2RSDA 2L43A 4A0CD 3IHPA 3C5KA 2CRRA 3KV6A 2PUYA 2C2VS 3O70A 2L0BA 4Z0RA 1VD4A 5H1UA 5G04B 3N9OA 1U6GB 4V3KC 5H1VA 4FJCA 1BORA 2ECGA 2YURA 4BBQA 3N9LA 2K17A 2QIZA 4B7YC 5B79A 3I2DA 2JM3A 3LQIA 3O35A 4O64A 2VPGA 2K1JA 3FEHA 1JOCA 3FL2A 3L1ZB 2JMJA 3SOXA 2M1RA 2L7PA 2MA6A 5TBNA 2RI7A 4OGCA 3Q1DA 1DVPA 1FBVA 1N87A 2MKEA 2M6MA 5KH9A 2BAYA 2G6QA 2F6JA 4MVTA 2AN6A 2Y1NA 2YQLA 5LKUA 2LAUA 4Z0OA 5LCWB 4LLBA 4YBMA 5C11A 1Z60A 3E2DA 3C6WA 4UP0A 4A4CA 5JG6A 2ZETC 4L58A 3MHSA 2G43A 4CA1A 3O34A 1IYMA 3HCTA 2Y43A 2YUCA 1Z2QA 2LV9A 3T7LA 1HYIA 3U5OA 4AUQB 5SVYA 3DPLR 2MUMA 2VP7A 4LKAA 4UI9B 2HDPA 3U5MA 3O47A 3ZNIA 1K2FA 2EGMA 4LJNA 2DSMA 2YU4A 2KR4A 2JUNA 3LQJA 2QICA 1Z6UA 3SOWA 2HYED 2VPDA 4A4BA 5B78A 2LGGA 3LVRE 4QF3A 2XOYA 5LKXA 4FO9A 3N9PA 2KKYA 2YYRA 4PPEA 3HCSA 4YATA 2ECTA 2ECIA 2YVRA 3PUQA 4O62A 5I3LA 3ASLA 5AIUA 2VJEA 4XI1A 1WENA 2LDRA 5SVIA 3O33A 4GB0A 2K4DA 4YC9A 2VPBA 4AP4A 5FEYA 3PLWA 4Q6FA 5LKTA 2ECJA 2JMIA 5TRBA 3EB6A 2XOZA 5B8DA 2B0OE 3T9KA 2Y1MA 4LADB 1WILA 2MNZA 2CSVA 3ZYQA 4GNGA 2FUIA 2VJEB 2LQ6A 5SVIB 2KWNA 5C13A 2JMDA 2ECNA 2KWJA 1X4UA 1E4UA 2RR4A 1WEEA 2OWAA 4N4FA 2M3HA 5FB0A 3KNVA 2KWOA 3VK6A 3GL6A 2F42A 1WESA 4IC3A 2VJFA 3ZTGA 5J3XA 1JM7A 5G05B 2XOCA 2C2LA 4F52B 3LVQE 1VYXA 2LN0A 3SUBA 3M62A 3ZVZB 1RMDA 1XWHA 2QJ0A 4CCGX 4ZUXU 2XB1A 2YHOA 4R7EA 5G0FA 3JUEA 1G25A 2CT2A 2EODA 5B75A 2FD4A 1T1HA 3HTKC 2FUUA 2LRIC 2IQJA 2D8SA 2KU3A 2YW8A 5TABA 5LKZA 2VJFB 3O36A 3V43A 5FERA 1JM7B 1HYJA 2LGLA 1WEUA 4R8PK 3HCUA 2MD7B 1WEPA 4WZ3B 2PNXA 2UZGA 2KWKA 1CHCA 2ECVA 5KH3A 2KFTA 4BHWA 1LDKC 3N9NA 2FFWA 3FJUB 1WEVA 4TKPB 2KIZA 4YAXA 3ZPV1 3DQVR 1F62A 4FK5A 2F6NA 4QQ4A 2KYUA 2M13A 3SHBA 2NAAA 3M99A 3M63A 2L80A 5FB1A 2JRJA 2E61A 4WZ2A 2E6RA 2DX8A 4B86C 2LXPC 4ZQLA 2EXUA 2KE1A 3N9QA 3QZVA 1X4IA 2MD8C 4I7DA 2M85A 2XEUA 3T6RA 3FM8C 5SVXA 4S3OC 3MDBC 4AYCA 4GNEA 4GNDA 3U5PA 3KV5A 4C9ZA 2YSJA 2YHNA 2P57A 2CRWA 3KDEC 1MBMA 3EB5A 3KQIA 4X3GA 4F1PA 1WEQA 2YT5A 2D8UA 4OGEA 2MT5A 1WEOA 2LXHC 2DJAA 2ECWA 3LQHA 2E6SA 3MHHA 4AVXA 1FP0A 5K3QA 4NN2A 4W4UA 1LDJB 4AYCB 3PHDA 3DDTA 1VFYA 3L11A 1WE9A 3FAOA 2KGGA 4S3OB 5H1TA
chains in the Genus database with same CATH topology
2MNYA 2YREA 4I7CA 3NG2A 5AITA 4P5OB 4MSXA 5TDRA 5B76A 2VNFA 3RPGC 2H0DA 1V87A 2EGPA 2L5UA 5DINA 5H9MA 2KREA 4LK9A 2G45A 4ZDTA 4I7BA 4N3WA 3PURA 2CSYA 4PTBA 2KGIA 2FSAA 5KH7A 4WZ0A 5B77A 4A49A 4WA6A 2CKLA 4YBSA 5TDWA 1MM2A 4YADA 2OXQC 4UP5A 5D1LB 1WEWA 1X4JA 5EYAF 5D1KB 4R2YA 2H0DB 2YQMA 2LGVA 3LRQA 3ZVYA 3U5NA 3RPGB 2YSMA 1WIMA 2LGKA 3RTRB 2MIQA 1WGMA 3SOUA 2MA5A 1ZBDB 3GV4A 4YBTA 4YABA 3N9MA 3O37A 4L7XA 2EA6A 2IDAA 5D1MB 4IC2A 2CKLB 3O7AA 5DKAA 2I50A 2CSZA 4GNFA 2VPEA 1MM3A 1WEMA 3L1XA 3ZPVE 1WFKA 4QF2A 2L75A 4FIPA 2K16A 4V3LC 2RSDA 2L43A 4A0CD 3IHPA 3C5KA 3KV6A 2PUYA 2C2VS 3O70A 2L0BA 1VD4A 5H1UA 5G04B 3N9OA 1U6GB 4V3KC 5H1VA 4FJCA 1BORA 2ECGA 2YURA 4BBQA 3N9LA 2K17A 2QIZA 4B7YC 5B79A 3I2DA 3LQIA 3O35A 4O64A 2VPGA 2K1JA 1JOCA 3FL2A 3L1ZB 2JMJA 3SOXA 2M1RA 2MA6A 5TBNA 2RI7A 1DVPA 1FBVA 1N87A 2M6MA 5KH9A 2BAYA 2G6QA 2F6JA 4MVTA 2AN6A 2Y1NA 2YQLA 5LKUA 5LCWB 4LLBA 4YBMA 5C11A 1Z60A 3C6WA 4UP0A 4A4CA 5JG6A 2ZETC 4L58A 3MHSA 2G43A 4CA1A 3O34A 1IYMA 3HCTA 2Y43A 2YUCA 1Z2QA 2LV9A 3T7LA 1HYIA 3U5OA 4AUQB 3DPLR 2MUMA 2VP7A 4LKAA 4UI9B 2HDPA 3U5MA 3ZNIA 1K2FA 4LJNA 2YU4A 2KR4A 3LQJA 2QICA 1Z6UA 3SOWA 2HYED 2VPDA 4A4BA 5B78A 2LGGA 4QF3A 5LKXA 4FO9A 3N9PA 2YYRA 4PPEA 3HCSA 4YATA 2ECTA 2ECIA 3PUQA 5I3LA 3ASLA 5AIUA 2VJEA 4XI1A 1WENA 2LDRA 3O33A 4GB0A 2K4DA 4YC9A 2VPBA 4AP4A 5FEYA 4Q6FA 5LKTA 2ECJA 2JMIA 5TRBA 3EB6A 5B8DA 2Y1MA 4LADB 1WILA 2MNZA 3ZYQA 4GNGA 2FUIA 2VJEB 2LQ6A 2KWNA 5C13A 2JMDA 2ECNA 2KWJA 1X4UA 1E4UA 1WEEA 4N4FA 2M3HA 5FB0A 3KNVA 2KWOA 3VK6A 3GL6A 2F42A 1WESA 4IC3A 2VJFA 3ZTGA 5J3XA 1JM7A 5G05B 2C2LA 4F52B 1VYXA 2LN0A 3M62A 3ZVZB 1RMDA 1XWHA 2QJ0A 4CCGX 4ZUXU 2XB1A 2YHOA 4R7EA 5G0FA 1G25A 2CT2A 2EODA 5B75A 1T1HA 3HTKC 2FUUA 2LRIC 2D8SA 2KU3A 2YW8A 5TABA 5LKZA 2VJFB 3O36A 3V43A 5FERA 1JM7B 1HYJA 2LGLA 1WEUA 4R8PK 3HCUA 2MD7B 1WEPA 4WZ3B 2PNXA 2UZGA 2KWKA 1CHCA 2ECVA 5KH3A 2KFTA 4BHWA 1LDKC 3N9NA 1WEVA 4TKPB 2KIZA 4YAXA 3ZPV1 3DQVR 1F62A 4FK5A 2F6NA 2KYUA 3SHBA 2NAAA 3M99A 3M63A 2L80A 5FB1A 2JRJA 4WZ2A 2E6RA 2DX8A 4B86C 2LXPC 4ZQLA 2KE1A 3N9QA 3QZVA 1X4IA 2MD8C 4I7DA 2M85A 3T6RA 2XEUA 4S3OC 4AYCA 4GNEA 4GNDA 3U5PA 3KV5A 4C9ZA 2YSJA 2YHNA 3EB5A 3KQIA 4X3GA 1WEQA 2YT5A 2MT5A 1WEOA 2LXHC 2ECWA 3LQHA 2E6SA 3MHHA 4AVXA 1FP0A 4NN2A 4W4UA 1LDJB 4AYCB 3PHDA 1VFYA 3L11A 1WE9A 2KGGA 4S3OB 5H1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNY A;  2YRE A;  4I7C A;  3NG2 A;  5AIT A;  4P5O B;  4MSX A;  5TDR A;  5B76 A;  2VNF A;  3RPG C;  2H0D A;  1V87 A;  2EGP A;  2L5U A;  5DIN A;  5H9M A;  2KRE A;  4LK9 A;  2G45 A;  4ZDT A;  4I7B A;  4N3W A;  3PUR A;  2CSY A;  4PTB A;  2KGI A;  2FSA A;  5KH7 A;  4WZ0 A;  5B77 A;  4A49 A;  4WA6 A;  2CKL A;  4YBS A;  5TDW A;  1MM2 A;  4YAD A;  2OXQ C;  4UP5 A;  5D1L B;  1WEW A;  1X4J A;  5EYA F;  5D1K B;  4R2Y A;  2H0D B;  2YQM A;  2LGV A;  3LRQ A;  3ZVY A;  3U5N A;  3RPG B;  2YSM A;  1WIM A;  2LGK A;  3RTR B;  2MIQ A;  1WGM A;  3SOU A;  2MA5 A;  1ZBD B;  3GV4 A;  4YBT A;  4YAB A;  3N9M A;  3O37 A;  4L7X A;  2EA6 A;  2IDA A;  5D1M B;  4IC2 A;  2CKL B;  3O7A A;  5DKA A;  2I50 A;  2CSZ A;  4GNF A;  2VPE A;  1MM3 A;  1WEM A;  3L1X A;  3ZPV E;  1WFK A;  4QF2 A;  2L75 A;  4FIP A;  2K16 A;  4V3L C;  2RSD A;  2L43 A;  4A0C D;  3IHP A;  3C5K A;  3KV6 A;  2PUY A;  2C2V S;  3O70 A;  2L0B A;  1VD4 A;  5H1U A;  5G04 B;  3N9O A;  1U6G B;  4V3K C;  5H1V A;  4FJC A;  1BOR A;  2ECG A;  2YUR A;  4BBQ A;  3N9L A;  2K17 A;  2QIZ A;  4B7Y C;  5B79 A;  3I2D A;  3LQI A;  3O35 A;  4O64 A;  2VPG A;  2K1J A;  1JOC A;  3FL2 A;  3L1Z B;  2JMJ A;  3SOX A;  2M1R A;  2MA6 A;  5TBN A;  2RI7 A;  1DVP A;  1FBV A;  1N87 A;  2M6M A;  5KH9 A;  2BAY A;  2G6Q A;  2F6J A;  4MVT A;  2AN6 A;  2Y1N A;  2YQL A;  5LKU A;  5LCW B;  4LLB A;  4YBM A;  5C11 A;  1Z60 A;  3C6W A;  4UP0 A;  4A4C A;  5JG6 A;  2ZET C;  4L58 A;  3MHS A;  2G43 A;  4CA1 A;  3O34 A;  1IYM A;  3HCT A;  2Y43 A;  2YUC A;  1Z2Q A;  2LV9 A;  3T7L A;  1HYI A;  3U5O A;  4AUQ B;  3DPL R;  2MUM A;  2VP7 A;  4LKA A;  4UI9 B;  2HDP A;  3U5M A;  3ZNI A;  1K2F A;  4LJN A;  2YU4 A;  2KR4 A;  3LQJ A;  2QIC A;  1Z6U A;  3SOW A;  2HYE D;  2VPD A;  4A4B A;  5B78 A;  2LGG A;  4QF3 A;  5LKX A;  4FO9 A;  3N9P A;  2YYR A;  4PPE A;  3HCS A;  4YAT A;  2ECT A;  2ECI A;  3PUQ A;  5I3L A;  3ASL A;  5AIU A;  2VJE A;  4XI1 A;  1WEN A;  2LDR A;  3O33 A;  4GB0 A;  2K4D A;  4YC9 A;  2VPB A;  4AP4 A;  5FEY A;  4Q6F A;  5LKT A;  2ECJ A;  2JMI A;  5TRB A;  3EB6 A;  5B8D A;  2Y1M A;  4LAD B;  1WIL A;  2MNZ A;  3ZYQ A;  4GNG A;  2FUI A;  2VJE B;  2LQ6 A;  2KWN A;  5C13 A;  2JMD A;  2ECN A;  2KWJ A;  1X4U A;  1E4U A;  1WEE A;  4N4F A;  2M3H A;  5FB0 A;  3KNV A;  2KWO A;  3VK6 A;  3GL6 A;  2F42 A;  1WES A;  4IC3 A;  2VJF A;  3ZTG A;  5J3X A;  1JM7 A;  5G05 B;  2C2L A;  4F52 B;  1VYX A;  2LN0 A;  3M62 A;  3ZVZ B;  1RMD A;  1XWH A;  2QJ0 A;  4CCG X;  4ZUX U;  2XB1 A;  2YHO A;  4R7E A;  5G0F A;  1G25 A;  2CT2 A;  2EOD A;  5B75 A;  1T1H A;  3HTK C;  2FUU A;  2LRI C;  2D8S A;  2KU3 A;  2YW8 A;  5TAB A;  5LKZ A;  2VJF B;  3O36 A;  3V43 A;  5FER A;  1JM7 B;  1HYJ A;  2LGL A;  1WEU A;  4R8P K;  3HCU A;  2MD7 B;  1WEP A;  4WZ3 B;  2PNX A;  2UZG A;  2KWK A;  1CHC A;  2ECV A;  5KH3 A;  2KFT A;  4BHW A;  1LDK C;  3N9N A;  1WEV A;  4TKP B;  2KIZ A;  4YAX A;  3ZPV 1;  3DQV R;  1F62 A;  4FK5 A;  2F6N A;  2KYU A;  3SHB A;  2NAA A;  3M99 A;  3M63 A;  2L80 A;  5FB1 A;  2JRJ A;  4WZ2 A;  2E6R A;  2DX8 A;  4B86 C;  2LXP C;  4ZQL A;  2KE1 A;  3N9Q A;  3QZV A;  1X4I A;  2MD8 C;  4I7D A;  2M85 A;  3T6R A;  2XEU A;  4S3O C;  4AYC A;  4GNE A;  4GND A;  3U5P A;  3KV5 A;  4C9Z A;  2YSJ A;  2YHN A;  3EB5 A;  3KQI A;  4X3G A;  1WEQ A;  2YT5 A;  2MT5 A;  1WEO A;  2LXH C;  2ECW A;  3LQH A;  2E6S A;  3MHH A;  4AVX A;  1FP0 A;  4NN2 A;  4W4U A;  1LDJ B;  4AYC B;  3PHD A;  1VFY A;  3L11 A;  1WE9 A;  2KGG A;  4S3O B;  5H1T A; 
#chains in the Genus database with same CATH topology
 2MNY A;  2KKX A;  2YRE A;  4I7C A;  3NG2 A;  5AIT A;  4P5O B;  4MSX A;  5TDR A;  5B76 A;  2VNF A;  3RPG C;  2H0D A;  1V87 A;  2EGP A;  2L5U A;  5DIN A;  5H9M A;  2KRE A;  4LK9 A;  2G45 A;  4ZDT A;  4I7B A;  3H7H A;  4N3W A;  3PUR A;  2CSY A;  4PTB A;  2KGI A;  2FSA A;  5KH7 A;  3DWD A;  3M7K A;  4WZ0 A;  5B77 A;  4A49 A;  4WA6 A;  2CKL A;  4YBS A;  5TDW A;  1MM2 A;  2XP0 A;  4YAD A;  2OXQ C;  4UP5 A;  5D1L B;  1DCQ A;  1WEW A;  3LJU X;  1X4J A;  5EYA F;  5D1K B;  4R2Y A;  2H0D B;  2YQM A;  3FAN A;  2LGV A;  3LRQ A;  3ZVY A;  3U5N A;  3RPG B;  2YSM A;  1WIM A;  2LGK A;  3RTR B;  2MIQ A;  1WGM A;  3SOU A;  2MA5 A;  1ZBD B;  3GV4 A;  4YBT A;  4YAB A;  4H9D A;  3N9M A;  3O37 A;  4L7X A;  2EA6 A;  2CON A;  2IDA A;  5D1M B;  4IC2 A;  2CKL B;  3O7A A;  5DKA A;  2I50 A;  2CSZ A;  4GNF A;  2VPE A;  1MM3 A;  1WEM A;  3L1X A;  3ZPV E;  1WFK A;  4QF2 A;  3LDY A;  2L75 A;  4FIP A;  2K16 A;  4V3L C;  2RSD A;  2L43 A;  4A0C D;  3IHP A;  3C5K A;  2CRR A;  3KV6 A;  2PUY A;  2C2V S;  3O70 A;  2L0B A;  4Z0R A;  1VD4 A;  5H1U A;  5G04 B;  3N9O A;  1U6G B;  4V3K C;  5H1V A;  4FJC A;  1BOR A;  2ECG A;  2YUR A;  4BBQ A;  3N9L A;  2K17 A;  2QIZ A;  4B7Y C;  5B79 A;  3I2D A;  2JM3 A;  3LQI A;  3O35 A;  4O64 A;  2VPG A;  2K1J A;  3FEH A;  1JOC A;  3FL2 A;  3L1Z B;  2JMJ A;  3SOX A;  2M1R A;  2L7P A;  2MA6 A;  5TBN A;  2RI7 A;  4OGC A;  3Q1D A;  1DVP A;  1FBV A;  1N87 A;  2MKE A;  2M6M A;  5KH9 A;  2BAY A;  2G6Q A;  2F6J A;  4MVT A;  2AN6 A;  2Y1N A;  2YQL A;  5LKU A;  2LAU A;  4Z0O A;  5LCW B;  4LLB A;  4YBM A;  5C11 A;  1Z60 A;  3E2D A;  3C6W A;  4UP0 A;  4A4C A;  5JG6 A;  2ZET C;  4L58 A;  3MHS A;  2G43 A;  4CA1 A;  3O34 A;  1IYM A;  3HCT A;  2Y43 A;  2YUC A;  1Z2Q A;  2LV9 A;  3T7L A;  1HYI A;  3U5O A;  4AUQ B;  5SVY A;  3DPL R;  2MUM A;  2VP7 A;  4LKA A;  4UI9 B;  2HDP A;  3U5M A;  3O47 A;  3ZNI A;  1K2F A;  2EGM A;  4LJN A;  2DSM A;  2YU4 A;  2KR4 A;  2JUN A;  3LQJ A;  2QIC A;  1Z6U A;  3SOW A;  2HYE D;  2VPD A;  4A4B A;  5B78 A;  2LGG A;  3LVR E;  4QF3 A;  2XOY A;  5LKX A;  4FO9 A;  3N9P A;  2KKY A;  2YYR A;  4PPE A;  3HCS A;  4YAT A;  2ECT A;  2ECI A;  2YVR A;  3PUQ A;  4O62 A;  5I3L A;  3ASL A;  5AIU A;  2VJE A;  4XI1 A;  1WEN A;  2LDR A;  5SVI A;  3O33 A;  4GB0 A;  2K4D A;  4YC9 A;  2VPB A;  4AP4 A;  5FEY A;  3PLW A;  4Q6F A;  5LKT A;  2ECJ A;  2JMI A;  5TRB A;  3EB6 A;  2XOZ A;  5B8D A;  2B0O E;  3T9K A;  2Y1M A;  4LAD B;  1WIL A;  2MNZ A;  2CSV A;  3ZYQ A;  4GNG A;  2FUI A;  2VJE B;  2LQ6 A;  5SVI B;  2KWN A;  5C13 A;  2JMD A;  2ECN A;  2KWJ A;  1X4U A;  1E4U A;  2RR4 A;  1WEE A;  2OWA A;  4N4F A;  2M3H A;  5FB0 A;  3KNV A;  2KWO A;  3VK6 A;  3GL6 A;  2F42 A;  1WES A;  4IC3 A;  2VJF A;  3ZTG A;  5J3X A;  1JM7 A;  5G05 B;  2XOC A;  2C2L A;  4F52 B;  3LVQ E;  1VYX A;  2LN0 A;  3SUB A;  3M62 A;  3ZVZ B;  1RMD A;  1XWH A;  2QJ0 A;  4CCG X;  4ZUX U;  2XB1 A;  2YHO A;  4R7E A;  5G0F A;  3JUE A;  1G25 A;  2CT2 A;  2EOD A;  5B75 A;  2FD4 A;  1T1H A;  3HTK C;  2FUU A;  2LRI C;  2IQJ A;  2D8S A;  2KU3 A;  2YW8 A;  5TAB A;  5LKZ A;  2VJF B;  3O36 A;  3V43 A;  5FER A;  1JM7 B;  1HYJ A;  2LGL A;  1WEU A;  4R8P K;  3HCU A;  2MD7 B;  1WEP A;  4WZ3 B;  2PNX A;  2UZG A;  2KWK A;  1CHC A;  2ECV A;  5KH3 A;  2KFT A;  4BHW A;  1LDK C;  3N9N A;  2FFW A;  3FJU B;  1WEV A;  4TKP B;  2KIZ A;  4YAX A;  3ZPV 1;  3DQV R;  1F62 A;  4FK5 A;  2F6N A;  4QQ4 A;  2KYU A;  2M13 A;  3SHB A;  2NAA A;  3M99 A;  3M63 A;  2L80 A;  5FB1 A;  2JRJ A;  2E61 A;  4WZ2 A;  2E6R A;  2DX8 A;  4B86 C;  2LXP C;  4ZQL A;  2EXU A;  2KE1 A;  3N9Q A;  3QZV A;  1X4I A;  2MD8 C;  4I7D A;  2M85 A;  2XEU A;  3T6R A;  3FM8 C;  5SVX A;  4S3O C;  3MDB C;  4AYC A;  4GNE A;  4GND A;  3U5P A;  3KV5 A;  4C9Z A;  2YSJ A;  2YHN A;  2P57 A;  2CRW A;  3KDE C;  1MBM A;  3EB5 A;  3KQI A;  4X3G A;  4F1P A;  1WEQ A;  2YT5 A;  2D8U A;  4OGE A;  2MT5 A;  1WEO A;  2LXH C;  2DJA A;  2ECW A;  3LQH A;  2E6S A;  3MHH A;  4AVX A;  1FP0 A;  5K3Q A;  4NN2 A;  4W4U A;  1LDJ B;  4AYC B;  3PHD A;  3DDT A;  1VFY A;  3L11 A;  1WE9 A;  3FAO A;  2KGG A;  4S3O B;  5H1T A; 
#chains in the Genus database with same CATH homology
 2MNY A;  2YRE A;  4I7C A;  3NG2 A;  5AIT A;  4P5O B;  4MSX A;  5TDR A;  5B76 A;  2VNF A;  3RPG C;  2H0D A;  1V87 A;  2EGP A;  2L5U A;  5DIN A;  5H9M A;  2KRE A;  4LK9 A;  2G45 A;  4ZDT A;  4I7B A;  4N3W A;  3PUR A;  2CSY A;  4PTB A;  2KGI A;  2FSA A;  5KH7 A;  4WZ0 A;  5B77 A;  4A49 A;  4WA6 A;  2CKL A;  4YBS A;  5TDW A;  1MM2 A;  4YAD A;  2OXQ C;  4UP5 A;  5D1L B;  1WEW A;  1X4J A;  5EYA F;  5D1K B;  4R2Y A;  2H0D B;  2YQM A;  2LGV A;  3LRQ A;  3ZVY A;  3U5N A;  3RPG B;  2YSM A;  1WIM A;  2LGK A;  3RTR B;  2MIQ A;  1WGM A;  3SOU A;  2MA5 A;  1ZBD B;  3GV4 A;  4YBT A;  4YAB A;  3N9M A;  3O37 A;  4L7X A;  2EA6 A;  2IDA A;  5D1M B;  4IC2 A;  2CKL B;  3O7A A;  5DKA A;  2I50 A;  2CSZ A;  4GNF A;  2VPE A;  1MM3 A;  1WEM A;  3L1X A;  3ZPV E;  1WFK A;  4QF2 A;  2L75 A;  4FIP A;  2K16 A;  4V3L C;  2RSD A;  2L43 A;  4A0C D;  3IHP A;  3C5K A;  3KV6 A;  2PUY A;  2C2V S;  3O70 A;  2L0B A;  1VD4 A;  5H1U A;  5G04 B;  3N9O A;  1U6G B;  4V3K C;  5H1V A;  4FJC A;  1BOR A;  2ECG A;  2YUR A;  4BBQ A;  3N9L A;  2K17 A;  2QIZ A;  4B7Y C;  5B79 A;  3I2D A;  3LQI A;  3O35 A;  4O64 A;  2VPG A;  2K1J A;  1JOC A;  3FL2 A;  3L1Z B;  2JMJ A;  3SOX A;  2M1R A;  2MA6 A;  5TBN A;  2RI7 A;  1DVP A;  1FBV A;  1N87 A;  2M6M A;  5KH9 A;  2BAY A;  2G6Q A;  2F6J A;  4MVT A;  2AN6 A;  2Y1N A;  2YQL A;  5LKU A;  5LCW B;  4LLB A;  4YBM A;  5C11 A;  1Z60 A;  3C6W A;  4UP0 A;  4A4C A;  5JG6 A;  2ZET C;  4L58 A;  3MHS A;  2G43 A;  4CA1 A;  3O34 A;  1IYM A;  3HCT A;  2Y43 A;  2YUC A;  1Z2Q A;  2LV9 A;  3T7L A;  1HYI A;  3U5O A;  4AUQ B;  3DPL R;  2MUM A;  2VP7 A;  4LKA A;  4UI9 B;  2HDP A;  3U5M A;  3ZNI A;  1K2F A;  4LJN A;  2YU4 A;  2KR4 A;  3LQJ A;  2QIC A;  1Z6U A;  3SOW A;  2HYE D;  2VPD A;  4A4B A;  5B78 A;  2LGG A;  4QF3 A;  5LKX A;  4FO9 A;  3N9P A;  2YYR A;  4PPE A;  3HCS A;  4YAT A;  2ECT A;  2ECI A;  3PUQ A;  5I3L A;  3ASL A;  5AIU A;  2VJE A;  4XI1 A;  1WEN A;  2LDR A;  3O33 A;  4GB0 A;  2K4D A;  4YC9 A;  2VPB A;  4AP4 A;  5FEY A;  4Q6F A;  5LKT A;  2ECJ A;  2JMI A;  5TRB A;  3EB6 A;  5B8D A;  2Y1M A;  4LAD B;  1WIL A;  2MNZ A;  3ZYQ A;  4GNG A;  2FUI A;  2VJE B;  2LQ6 A;  2KWN A;  5C13 A;  2JMD A;  2ECN A;  2KWJ A;  1X4U A;  1E4U A;  1WEE A;  4N4F A;  2M3H A;  5FB0 A;  3KNV A;  2KWO A;  3VK6 A;  3GL6 A;  2F42 A;  1WES A;  4IC3 A;  2VJF A;  3ZTG A;  5J3X A;  1JM7 A;  5G05 B;  2C2L A;  4F52 B;  1VYX A;  2LN0 A;  3M62 A;  3ZVZ B;  1RMD A;  1XWH A;  2QJ0 A;  4CCG X;  4ZUX U;  2XB1 A;  2YHO A;  4R7E A;  5G0F A;  1G25 A;  2CT2 A;  2EOD A;  5B75 A;  1T1H A;  3HTK C;  2FUU A;  2LRI C;  2D8S A;  2KU3 A;  2YW8 A;  5TAB A;  5LKZ A;  2VJF B;  3O36 A;  3V43 A;  5FER A;  1JM7 B;  1HYJ A;  2LGL A;  1WEU A;  4R8P K;  3HCU A;  2MD7 B;  1WEP A;  4WZ3 B;  2PNX A;  2UZG A;  2KWK A;  1CHC A;  2ECV A;  5KH3 A;  2KFT A;  4BHW A;  1LDK C;  3N9N A;  1WEV A;  4TKP B;  2KIZ A;  4YAX A;  3ZPV 1;  3DQV R;  1F62 A;  4FK5 A;  2F6N A;  2KYU A;  3SHB A;  2NAA A;  3M99 A;  3M63 A;  2L80 A;  5FB1 A;  2JRJ A;  4WZ2 A;  2E6R A;  2DX8 A;  4B86 C;  2LXP C;  4ZQL A;  2KE1 A;  3N9Q A;  3QZV A;  1X4I A;  2MD8 C;  4I7D A;  2M85 A;  3T6R A;  2XEU A;  4S3O C;  4AYC A;  4GNE A;  4GND A;  3U5P A;  3KV5 A;  4C9Z A;  2YSJ A;  2YHN A;  3EB5 A;  3KQI A;  4X3G A;  1WEQ A;  2YT5 A;  2MT5 A;  1WEO A;  2LXH C;  2ECW A;  3LQH A;  2E6S A;  3MHH A;  4AVX A;  1FP0 A;  4NN2 A;  4W4U A;  1LDJ B;  4AYC B;  3PHD A;  1VFY A;  3L11 A;  1WE9 A;  2KGG A;  4S3O B;  5H1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...