1WFKA

Fyve domain of fyve domain containing 19 protein from mus musculus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
GSSGSSGMESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTRGSSDNASKWSPPQNYKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FYVE domain of FYVE domain containing 19 protein from Mus musculus
rcsb
source organism Mus musculus
molecule tags Unknown function
molecule keywords zinc finger, FYVE domain containing 19
total genus 7
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wfkA01
3GV4A 2LDRA 5G05B 1LDJB 4O64A 2LV9A 5G04B 2YYRA 5C11A 1WE9A 4F52B 3EB5A 5H9MA 2MD8C 1N87A 2YHNA 2VPEA 4MVTA 2Y1MA 2ZETC 2BAYA 5DINA 2HDPA 3O33A 3NG2A 1WEEA 2ECGA 2AN6A 2YUCA 4W4UA 2MNZA 2ECWA 3M63A 2L80A 2H0DA 2RSDA 4YBSA 3M99A 3N9PA 1VFYA 5AIUA 3PUQA 2YREA 4UI9B 3ZPVE 2VNFA 1WEOA 2NAAA 2DX8A 1XWHA 2ECIA 2PNXA 5DKAA 2L0BA 2QIZA 1WIMA 4UP0A 1CHCA 2LXHC 2KGGA 4S3OB 4PPEA 4N4FA 2VPBA 4QF3A 4GNGA 4A49A 2YURA 5FEYA 5KH9A 1JOCA 1MM3A 4I7DA 4LKAA 5LKZA 2Y43A 1LDKC 4B86C 4ZUXU 2M85A 2K1JA 4GNDA 5LKUA 4A4CA 3O34A 2JMIA 4IC3A 5C13A 2L75A 4IC2A 2LGVA 2L5UA 1E4UA 4WZ3B 4I7CA 2K17A 2QJ0A 3N9MA 3SOWA 2LGLA 2LXPC 2G43A 1WGMA 3ASLA 5EYAF 4R7EA 1JM7A 5H1VA 2XEUA 2YT5A 3HCSA 4L58A 5B78A 4N3WA 2C2LA 2JRJA 2KREA 2MIQA 2KWNA 5KH7A 3T7LA 5B8DA 5LKTA 1BORA 2VJFB 5D1KB 2VPGA 5TRBA 2CKLB 5AITA 2CT2A 2ECNA 3LQIA 5H1UA 4YBMA 2KYUA 3PHDA 2KIZA 5FB1A 2HYED 3EB6A 3ZVZB 2YHOA 1HYIA 5I3LA 5TDRA 4WA6A 3RTRB 4UP5A 3O70A 3N9LA 2IDAA 1X4JA 2F6JA 4TKPB 1HYJA 3PURA 4MSXA 4PTBA 3C5KA 2MUMA 5B75A 3SHBA 2Y1NA 3HTKC 1WEWA 4YBTA 2CSZA 2YSMA 4LLBA 4L7XA 5TABA 1Z2QA 2FUIA 1WESA 2CKLA 4A0CD 1WENA 3N9QA 4QF2A 2MNYA 4AVXA 2LQ6A 5H1TA 1V87A 5LKXA 5G0FA 5B79A 3T6RA 4AUQB 2ECTA 4X3GA 3ZVYA 2QICA 1F62A 1Z6UA 2JMDA 1VYXA 2ECVA 2VJFA 2XB1A 3KV6A 3O35A 4FK5A 2K16A 3C6WA 4AP4A 3VK6A 3ZNIA 4R2YA 3DPLR 1WEUA 1DVPA 1WEMA 4NN2A 3V43A 4BBQA 2MT5A 3O37A 2M3HA 1WEVA 1X4IA 4YADA 3L11A 1WILA 4A4BA 4I7BA 2F42A 2YW8A 3SOUA 3IHPA 4C9ZA 1JM7B 4AYCB 1G25A 3M62A 2EODA 3LRQA 1FP0A 1WEPA 2LRIC 2M1RA 4V3KC 2I50A 4CA1A 3FL2A 4P5OB 3ZYQA 4FIPA 3RPGC 2VJEB 3MHHA 5FERA 2MA6A 3N9OA 2VP7A 5J3XA 4GNEA 2M6MA 4LK9A 2LGKA 2E6RA 2C2VS 2YQLA 1VD4A 3ZPV1 3LQJA 2KWKA 4YAXA 3L1XA 3L1ZB 5JG6A 2KE1A 3QZVA 1RMDA 4GNFA 4CCGX 2D8SA 2YSJA 5B76A 3LQHA 1U6GB 2LGGA 4YC9A 1Z60A 2VPDA 3ZTGA 5FB0A 1T1HA 3O7AA 5TDWA 5LCWB 2FSAA 3U5MA 2K4DA 3I2DA 2H0DB 4FJCA 2CSYA 3DQVR 3GL6A 2OXQC 3HCTA 4FO9A 2RI7A 3KNVA 3O36A 5KH3A 3MHSA 4S3OC 2YU4A 1IYMA 2UZGA 2EA6A 4R8PK 2KWJA 2KFTA 4V3LC 4WZ2A 2KWOA 3SOXA 4YATA 4B7YC 2LN0A 4GB0A 4ZDTA 3KV5A 3U5PA 2FUUA 4LJNA 5B77A 2L43A 3U5NA 2MD7B 4Q6FA 2EGPA 2ECJA 2G6QA 5TBNA 2KGIA 2JMJA 1WEQA 1X4UA 3HCUA 3N9NA 2E6SA 2F6NA 2YQMA 2VJEA 4LADB 2PUYA 1K2FA 1FBVA 4XI1A 4YABA 2MA5A 4BHWA 4WZ0A 5D1MB 3U5OA 5D1LB 3RPGB 4AYCA 1WFKA 2KR4A 4ZQLA 1MM2A 2G45A 2KU3A 3KQIA 1ZBDB
chains in the Genus database with same CATH superfamily
3GV4A 2LDRA 5G05B 1LDJB 4O64A 2LV9A 5G04B 2YYRA 5C11A 1WE9A 4F52B 3EB5A 5H9MA 2MD8C 1N87A 4QQ4A 2YHNA 2VPEA 3SUBA 4MVTA 2Y1MA 2ZETC 2BAYA 5DINA 2HDPA 1MBMA 3O33A 3NG2A 1WEEA 2ECGA 2AN6A 2YUCA 4W4UA 2MNZA 2ECWA 3M63A 2L80A 2H0DA 2RSDA 4YBSA 3M99A 3PLWA 3N9PA 1VFYA 5AIUA 3PUQA 2YREA 2XOZA 3O47A 4UI9B 3ZPVE 3JUEA 2KKXA 1WEOA 2VNFA 2CRWA 2DX8A 2NAAA 3LVRE 1XWHA 2ECIA 2PNXA 5DKAA 2L0BA 2QIZA 1WIMA 4UP0A 1CHCA 2LXHC 2KGGA 4S3OB 4PPEA 4N4FA 2VPBA 4QF3A 5SVXA 4GNGA 4A49A 2YURA 5FEYA 5KH9A 1JOCA 1MM3A 2CONA 4I7DA 4LKAA 5LKZA 2Y43A 1LDKC 4B86C 2KKYA 4ZUXU 2EGMA 2M85A 2K1JA 4GNDA 5LKUA 4A4CA 3O34A 2JMIA 4IC3A 5C13A 2L75A 4IC2A 2L7PA 2LGVA 1DCQA 2L5UA 1E4UA 4WZ3B 4I7CA 2K17A 2QJ0A 2P57A 4F1PA 3N9MA 3SOWA 2LGLA 2LXPC 2G43A 1WGMA 3ASLA 5EYAF 4R7EA 1JM7A 5H1VA 2XEUA 2YT5A 4OGCA 3HCSA 2CSVA 2E61A 4L58A 5B78A 4N3WA 2C2LA 2JRJA 2KREA 2MIQA 3FEHA 2KWNA 5KH7A 3T7LA 5B8DA 5LKTA 1BORA 2VJFB 5D1KB 2DJAA 2VPGA 5TRBA 2CKLB 3H7HA 5AITA 2CT2A 2ECNA 3LQIA 5H1UA 4YBMA 2KYUA 3PHDA 2LAUA 3FJUB 4Z0RA 2KIZA 5FB1A 2HYED 3T9KA 3EB6A 3ZVZB 2YHOA 1HYIA 5I3LA 5TDRA 4WA6A 3RTRB 4UP5A 3O70A 3N9LA 2IDAA 2EXUA 1X4JA 2F6JA 4TKPB 1HYJA 3PURA 4MSXA 4PTBA 3C5KA 2MUMA 5B75A 3SHBA 2Y1NA 3HTKC 1WEWA 4YBTA 2CSZA 2YSMA 2FFWA 4LLBA 4L7XA 5TABA 1Z2QA 2FUIA 1WESA 2CKLA 4A0CD 1WENA 3N9QA 4QF2A 2MNYA 4AVXA 2LQ6A 5H1TA 1V87A 5LKXA 5G0FA 5B79A 3T6RA 4AUQB 2ECTA 4X3GA 3ZVYA 2QICA 5SVIA 1F62A 1Z6UA 2JMDA 2XOYA 1VYXA 2ECVA 2VJFA 2XB1A 2D8UA 3KV6A 3O35A 4FK5A 2K16A 3C6WA 4AP4A 2JUNA 3VK6A 3ZNIA 4R2YA 3DPLR 1WEUA 2DSMA 1DVPA 1WEMA 4NN2A 3V43A 4BBQA 2MT5A 3O37A 2M3HA 1WEVA 1X4IA 4YADA 3L11A 4O62A 1WILA 4A4BA 4I7BA 2IQJA 2F42A 2YW8A 3SOUA 3IHPA 4C9ZA 1JM7B 4AYCB 1G25A 3M62A 2EODA 3LRQA 3FAOA 2M13A 1FP0A 1WEPA 2LRIC 2M1RA 4V3KC 2I50A 4CA1A 3FL2A 4P5OB 2CRRA 3ZYQA 4FIPA 3E2DA 2VJEB 3RPGC 3MHHA 5FERA 2MA6A 3FANA 3M7KA 3N9OA 2VP7A 5J3XA 2JM3A 2M6MA 4GNEA 4LK9A 2LGKA 2E6RA 2C2VS 2YQLA 1VD4A 3ZPV1 3LQJA 2KWKA 4YAXA 3L1XA 3L1ZB 5JG6A 2KE1A 3LVQE 3QZVA 1RMDA 4GNFA 3FM8C 4CCGX 2D8SA 2YSJA 2B0OE 3LJUX 5B76A 3LQHA 1U6GB 2LGGA 4YC9A 1Z60A 2VPDA 3ZTGA 5FB0A 1T1HA 3O7AA 5TDWA 5LCWB 2FSAA 3U5MA 2K4DA 4H9DA 2MKEA 3I2DA 2H0DB 4FJCA 3DWDA 2CSYA 2FD4A 3DQVR 3GL6A 2OXQC 3HCTA 4FO9A 2RI7A 3KNVA 3O36A 5KH3A 4OGEA 3MHSA 4S3OC 2YU4A 3DDTA 1IYMA 2UZGA 2XP0A 2EA6A 4R8PK 2KWJA 2KFTA 4V3LC 3Q1DA 4WZ2A 2KWOA 3SOXA 4YATA 2YVRA 2LN0A 4B7YC 4GB0A 4ZDTA 3KV5A 3U5PA 2FUUA 2XOCA 4LJNA 5B77A 2L43A 3U5NA 2MD7B 4Q6FA 2EGPA 4Z0OA 2ECJA 2RR4A 2G6QA 5TBNA 2KGIA 2JMJA 1WEQA 1X4UA 3HCUA 3N9NA 2E6SA 2F6NA 2YQMA 2VJEA 3MDBC 4LADB 2PUYA 1K2FA 1FBVA 4XI1A 4YABA 2MA5A 3KDEC 5K3QA 4BHWA 4WZ0A 3LDYA 5D1MB 3U5OA 5D1LB 2OWAA 3RPGB 5SVYA 4AYCA 1WFKA 2KR4A 5SVIB 4ZQLA 1MM2A 2G45A 2KU3A 3KQIA 1ZBDB
chains in the Genus database with same CATH topology
3GV4A 2LDRA 5G05B 1LDJB 4O64A 2LV9A 5G04B 2YYRA 5C11A 1WE9A 4F52B 3EB5A 5H9MA 2MD8C 1N87A 2YHNA 2VPEA 4MVTA 2Y1MA 2ZETC 2BAYA 5DINA 2HDPA 3O33A 3NG2A 1WEEA 2ECGA 2AN6A 2YUCA 4W4UA 2MNZA 2ECWA 3M63A 2L80A 2H0DA 2RSDA 4YBSA 3M99A 3N9PA 1VFYA 5AIUA 3PUQA 2YREA 4UI9B 3ZPVE 2VNFA 1WEOA 2NAAA 2DX8A 1XWHA 2ECIA 2PNXA 5DKAA 2L0BA 2QIZA 1WIMA 4UP0A 1CHCA 2LXHC 2KGGA 4S3OB 4PPEA 4N4FA 2VPBA 4QF3A 4GNGA 4A49A 2YURA 5FEYA 5KH9A 1JOCA 1MM3A 4I7DA 4LKAA 5LKZA 2Y43A 1LDKC 4B86C 4ZUXU 2M85A 2K1JA 4GNDA 5LKUA 4A4CA 3O34A 2JMIA 4IC3A 5C13A 2L75A 4IC2A 2LGVA 2L5UA 1E4UA 4WZ3B 4I7CA 2K17A 2QJ0A 3N9MA 3SOWA 2LGLA 2LXPC 2G43A 1WGMA 3ASLA 5EYAF 4R7EA 1JM7A 5H1VA 2XEUA 2YT5A 3HCSA 4L58A 5B78A 4N3WA 2C2LA 2JRJA 2KREA 2MIQA 2KWNA 5KH7A 3T7LA 5B8DA 5LKTA 1BORA 2VJFB 5D1KB 2VPGA 5TRBA 2CKLB 5AITA 2CT2A 2ECNA 3LQIA 5H1UA 4YBMA 2KYUA 3PHDA 2KIZA 5FB1A 2HYED 3EB6A 3ZVZB 2YHOA 1HYIA 5I3LA 5TDRA 4WA6A 3RTRB 4UP5A 3O70A 3N9LA 2IDAA 1X4JA 2F6JA 4TKPB 1HYJA 3PURA 4MSXA 4PTBA 3C5KA 2MUMA 5B75A 3SHBA 2Y1NA 3HTKC 1WEWA 4YBTA 2CSZA 2YSMA 4LLBA 4L7XA 5TABA 1Z2QA 2FUIA 1WESA 2CKLA 4A0CD 1WENA 3N9QA 4QF2A 2MNYA 4AVXA 2LQ6A 5H1TA 1V87A 5LKXA 5G0FA 5B79A 3T6RA 4AUQB 2ECTA 4X3GA 3ZVYA 2QICA 1F62A 1Z6UA 2JMDA 1VYXA 2ECVA 2VJFA 2XB1A 3KV6A 3O35A 4FK5A 2K16A 3C6WA 4AP4A 3VK6A 3ZNIA 4R2YA 3DPLR 1WEUA 1DVPA 1WEMA 4NN2A 3V43A 4BBQA 2MT5A 3O37A 2M3HA 1WEVA 1X4IA 4YADA 3L11A 1WILA 4A4BA 4I7BA 2F42A 2YW8A 3SOUA 3IHPA 4C9ZA 1JM7B 4AYCB 1G25A 3M62A 2EODA 3LRQA 1FP0A 1WEPA 2LRIC 2M1RA 4V3KC 2I50A 4CA1A 3FL2A 4P5OB 3ZYQA 4FIPA 3RPGC 2VJEB 3MHHA 5FERA 2MA6A 3N9OA 2VP7A 5J3XA 4GNEA 2M6MA 4LK9A 2LGKA 2E6RA 2C2VS 2YQLA 1VD4A 3ZPV1 3LQJA 2KWKA 4YAXA 3L1XA 3L1ZB 5JG6A 2KE1A 3QZVA 1RMDA 4GNFA 4CCGX 2D8SA 2YSJA 5B76A 3LQHA 1U6GB 2LGGA 4YC9A 1Z60A 2VPDA 3ZTGA 5FB0A 1T1HA 3O7AA 5TDWA 5LCWB 2FSAA 3U5MA 2K4DA 3I2DA 2H0DB 4FJCA 2CSYA 3DQVR 3GL6A 2OXQC 3HCTA 4FO9A 2RI7A 3KNVA 3O36A 5KH3A 3MHSA 4S3OC 2YU4A 1IYMA 2UZGA 2EA6A 4R8PK 2KWJA 2KFTA 4V3LC 4WZ2A 2KWOA 3SOXA 4YATA 4B7YC 2LN0A 4GB0A 4ZDTA 3KV5A 3U5PA 2FUUA 4LJNA 5B77A 2L43A 3U5NA 2MD7B 4Q6FA 2EGPA 2ECJA 2G6QA 5TBNA 2KGIA 2JMJA 1WEQA 1X4UA 3HCUA 3N9NA 2E6SA 2F6NA 2YQMA 2VJEA 4LADB 2PUYA 1K2FA 1FBVA 4XI1A 4YABA 2MA5A 4BHWA 4WZ0A 5D1MB 3U5OA 5D1LB 3RPGB 4AYCA 1WFKA 2KR4A 4ZQLA 1MM2A 2G45A 2KU3A 3KQIA 1ZBDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV4 A;  2LDR A;  5G05 B;  1LDJ B;  4O64 A;  2LV9 A;  5G04 B;  2YYR A;  5C11 A;  1WE9 A;  4F52 B;  3EB5 A;  5H9M A;  2MD8 C;  1N87 A;  2YHN A;  2VPE A;  4MVT A;  2Y1M A;  2ZET C;  2BAY A;  5DIN A;  2HDP A;  3O33 A;  3NG2 A;  1WEE A;  2ECG A;  2AN6 A;  2YUC A;  4W4U A;  2MNZ A;  2ECW A;  3M63 A;  2L80 A;  2H0D A;  2RSD A;  4YBS A;  3M99 A;  3N9P A;  1VFY A;  5AIU A;  3PUQ A;  2YRE A;  4UI9 B;  3ZPV E;  2VNF A;  1WEO A;  2NAA A;  2DX8 A;  1XWH A;  2ECI A;  2PNX A;  5DKA A;  2L0B A;  2QIZ A;  1WIM A;  4UP0 A;  1CHC A;  2LXH C;  2KGG A;  4S3O B;  4PPE A;  4N4F A;  2VPB A;  4QF3 A;  4GNG A;  4A49 A;  2YUR A;  5FEY A;  5KH9 A;  1JOC A;  1MM3 A;  4I7D A;  4LKA A;  5LKZ A;  2Y43 A;  1LDK C;  4B86 C;  4ZUX U;  2M85 A;  2K1J A;  4GND A;  5LKU A;  4A4C A;  3O34 A;  2JMI A;  4IC3 A;  5C13 A;  2L75 A;  4IC2 A;  2LGV A;  2L5U A;  1E4U A;  4WZ3 B;  4I7C A;  2K17 A;  2QJ0 A;  3N9M A;  3SOW A;  2LGL A;  2LXP C;  2G43 A;  1WGM A;  3ASL A;  5EYA F;  4R7E A;  1JM7 A;  5H1V A;  2XEU A;  2YT5 A;  3HCS A;  4L58 A;  5B78 A;  4N3W A;  2C2L A;  2JRJ A;  2KRE A;  2MIQ A;  2KWN A;  5KH7 A;  3T7L A;  5B8D A;  5LKT A;  1BOR A;  2VJF B;  5D1K B;  2VPG A;  5TRB A;  2CKL B;  5AIT A;  2CT2 A;  2ECN A;  3LQI A;  5H1U A;  4YBM A;  2KYU A;  3PHD A;  2KIZ A;  5FB1 A;  2HYE D;  3EB6 A;  3ZVZ B;  2YHO A;  1HYI A;  5I3L A;  5TDR A;  4WA6 A;  3RTR B;  4UP5 A;  3O70 A;  3N9L A;  2IDA A;  1X4J A;  2F6J A;  4TKP B;  1HYJ A;  3PUR A;  4MSX A;  4PTB A;  3C5K A;  2MUM A;  5B75 A;  3SHB A;  2Y1N A;  3HTK C;  1WEW A;  4YBT A;  2CSZ A;  2YSM A;  4LLB A;  4L7X A;  5TAB A;  1Z2Q A;  2FUI A;  1WES A;  2CKL A;  4A0C D;  1WEN A;  3N9Q A;  4QF2 A;  2MNY A;  4AVX A;  2LQ6 A;  5H1T A;  1V87 A;  5LKX A;  5G0F A;  5B79 A;  3T6R A;  4AUQ B;  2ECT A;  4X3G A;  3ZVY A;  2QIC A;  1F62 A;  1Z6U A;  2JMD A;  1VYX A;  2ECV A;  2VJF A;  2XB1 A;  3KV6 A;  3O35 A;  4FK5 A;  2K16 A;  3C6W A;  4AP4 A;  3VK6 A;  3ZNI A;  4R2Y A;  3DPL R;  1WEU A;  1DVP A;  1WEM A;  4NN2 A;  3V43 A;  4BBQ A;  2MT5 A;  3O37 A;  2M3H A;  1WEV A;  1X4I A;  4YAD A;  3L11 A;  1WIL A;  4A4B A;  4I7B A;  2F42 A;  2YW8 A;  3SOU A;  3IHP A;  4C9Z A;  1JM7 B;  4AYC B;  1G25 A;  3M62 A;  2EOD A;  3LRQ A;  1FP0 A;  1WEP A;  2LRI C;  2M1R A;  4V3K C;  2I50 A;  4CA1 A;  3FL2 A;  4P5O B;  3ZYQ A;  4FIP A;  3RPG C;  2VJE B;  3MHH A;  5FER A;  2MA6 A;  3N9O A;  2VP7 A;  5J3X A;  4GNE A;  2M6M A;  4LK9 A;  2LGK A;  2E6R A;  2C2V S;  2YQL A;  1VD4 A;  3ZPV 1;  3LQJ A;  2KWK A;  4YAX A;  3L1X A;  3L1Z B;  5JG6 A;  2KE1 A;  3QZV A;  1RMD A;  4GNF A;  4CCG X;  2D8S A;  2YSJ A;  5B76 A;  3LQH A;  1U6G B;  2LGG A;  4YC9 A;  1Z60 A;  2VPD A;  3ZTG A;  5FB0 A;  1T1H A;  3O7A A;  5TDW A;  5LCW B;  2FSA A;  3U5M A;  2K4D A;  3I2D A;  2H0D B;  4FJC A;  2CSY A;  3DQV R;  3GL6 A;  2OXQ C;  3HCT A;  4FO9 A;  2RI7 A;  3KNV A;  3O36 A;  5KH3 A;  3MHS A;  4S3O C;  2YU4 A;  1IYM A;  2UZG A;  2EA6 A;  4R8P K;  2KWJ A;  2KFT A;  4V3L C;  4WZ2 A;  2KWO A;  3SOX A;  4YAT A;  4B7Y C;  2LN0 A;  4GB0 A;  4ZDT A;  3KV5 A;  3U5P A;  2FUU A;  4LJN A;  5B77 A;  2L43 A;  3U5N A;  2MD7 B;  4Q6F A;  2EGP A;  2ECJ A;  2G6Q A;  5TBN A;  2KGI A;  2JMJ A;  1WEQ A;  1X4U A;  3HCU A;  3N9N A;  2E6S A;  2F6N A;  2YQM A;  2VJE A;  4LAD B;  2PUY A;  1K2F A;  1FBV A;  4XI1 A;  4YAB A;  2MA5 A;  4BHW A;  4WZ0 A;  5D1M B;  3U5O A;  5D1L B;  3RPG B;  4AYC A;  1WFK A;  2KR4 A;  4ZQL A;  1MM2 A;  2G45 A;  2KU3 A;  3KQI A;  1ZBD B; 
#chains in the Genus database with same CATH topology
 3GV4 A;  2LDR A;  5G05 B;  1LDJ B;  4O64 A;  2LV9 A;  5G04 B;  2YYR A;  5C11 A;  1WE9 A;  4F52 B;  3EB5 A;  5H9M A;  2MD8 C;  1N87 A;  4QQ4 A;  2YHN A;  2VPE A;  3SUB A;  4MVT A;  2Y1M A;  2ZET C;  2BAY A;  5DIN A;  2HDP A;  1MBM A;  3O33 A;  3NG2 A;  1WEE A;  2ECG A;  2AN6 A;  2YUC A;  4W4U A;  2MNZ A;  2ECW A;  3M63 A;  2L80 A;  2H0D A;  2RSD A;  4YBS A;  3M99 A;  3PLW A;  3N9P A;  1VFY A;  5AIU A;  3PUQ A;  2YRE A;  2XOZ A;  3O47 A;  4UI9 B;  3ZPV E;  3JUE A;  2KKX A;  1WEO A;  2VNF A;  2CRW A;  2DX8 A;  2NAA A;  3LVR E;  1XWH A;  2ECI A;  2PNX A;  5DKA A;  2L0B A;  2QIZ A;  1WIM A;  4UP0 A;  1CHC A;  2LXH C;  2KGG A;  4S3O B;  4PPE A;  4N4F A;  2VPB A;  4QF3 A;  5SVX A;  4GNG A;  4A49 A;  2YUR A;  5FEY A;  5KH9 A;  1JOC A;  1MM3 A;  2CON A;  4I7D A;  4LKA A;  5LKZ A;  2Y43 A;  1LDK C;  4B86 C;  2KKY A;  4ZUX U;  2EGM A;  2M85 A;  2K1J A;  4GND A;  5LKU A;  4A4C A;  3O34 A;  2JMI A;  4IC3 A;  5C13 A;  2L75 A;  4IC2 A;  2L7P A;  2LGV A;  1DCQ A;  2L5U A;  1E4U A;  4WZ3 B;  4I7C A;  2K17 A;  2QJ0 A;  2P57 A;  4F1P A;  3N9M A;  3SOW A;  2LGL A;  2LXP C;  2G43 A;  1WGM A;  3ASL A;  5EYA F;  4R7E A;  1JM7 A;  5H1V A;  2XEU A;  2YT5 A;  4OGC A;  3HCS A;  2CSV A;  2E61 A;  4L58 A;  5B78 A;  4N3W A;  2C2L A;  2JRJ A;  2KRE A;  2MIQ A;  3FEH A;  2KWN A;  5KH7 A;  3T7L A;  5B8D A;  5LKT A;  1BOR A;  2VJF B;  5D1K B;  2DJA A;  2VPG A;  5TRB A;  2CKL B;  3H7H A;  5AIT A;  2CT2 A;  2ECN A;  3LQI A;  5H1U A;  4YBM A;  2KYU A;  3PHD A;  2LAU A;  3FJU B;  4Z0R A;  2KIZ A;  5FB1 A;  2HYE D;  3T9K A;  3EB6 A;  3ZVZ B;  2YHO A;  1HYI A;  5I3L A;  5TDR A;  4WA6 A;  3RTR B;  4UP5 A;  3O70 A;  3N9L A;  2IDA A;  2EXU A;  1X4J A;  2F6J A;  4TKP B;  1HYJ A;  3PUR A;  4MSX A;  4PTB A;  3C5K A;  2MUM A;  5B75 A;  3SHB A;  2Y1N A;  3HTK C;  1WEW A;  4YBT A;  2CSZ A;  2YSM A;  2FFW A;  4LLB A;  4L7X A;  5TAB A;  1Z2Q A;  2FUI A;  1WES A;  2CKL A;  4A0C D;  1WEN A;  3N9Q A;  4QF2 A;  2MNY A;  4AVX A;  2LQ6 A;  5H1T A;  1V87 A;  5LKX A;  5G0F A;  5B79 A;  3T6R A;  4AUQ B;  2ECT A;  4X3G A;  3ZVY A;  2QIC A;  5SVI A;  1F62 A;  1Z6U A;  2JMD A;  2XOY A;  1VYX A;  2ECV A;  2VJF A;  2XB1 A;  2D8U A;  3KV6 A;  3O35 A;  4FK5 A;  2K16 A;  3C6W A;  4AP4 A;  2JUN A;  3VK6 A;  3ZNI A;  4R2Y A;  3DPL R;  1WEU A;  2DSM A;  1DVP A;  1WEM A;  4NN2 A;  3V43 A;  4BBQ A;  2MT5 A;  3O37 A;  2M3H A;  1WEV A;  1X4I A;  4YAD A;  3L11 A;  4O62 A;  1WIL A;  4A4B A;  4I7B A;  2IQJ A;  2F42 A;  2YW8 A;  3SOU A;  3IHP A;  4C9Z A;  1JM7 B;  4AYC B;  1G25 A;  3M62 A;  2EOD A;  3LRQ A;  3FAO A;  2M13 A;  1FP0 A;  1WEP A;  2LRI C;  2M1R A;  4V3K C;  2I50 A;  4CA1 A;  3FL2 A;  4P5O B;  2CRR A;  3ZYQ A;  4FIP A;  3E2D A;  2VJE B;  3RPG C;  3MHH A;  5FER A;  2MA6 A;  3FAN A;  3M7K A;  3N9O A;  2VP7 A;  5J3X A;  2JM3 A;  2M6M A;  4GNE A;  4LK9 A;  2LGK A;  2E6R A;  2C2V S;  2YQL A;  1VD4 A;  3ZPV 1;  3LQJ A;  2KWK A;  4YAX A;  3L1X A;  3L1Z B;  5JG6 A;  2KE1 A;  3LVQ E;  3QZV A;  1RMD A;  4GNF A;  3FM8 C;  4CCG X;  2D8S A;  2YSJ A;  2B0O E;  3LJU X;  5B76 A;  3LQH A;  1U6G B;  2LGG A;  4YC9 A;  1Z60 A;  2VPD A;  3ZTG A;  5FB0 A;  1T1H A;  3O7A A;  5TDW A;  5LCW B;  2FSA A;  3U5M A;  2K4D A;  4H9D A;  2MKE A;  3I2D A;  2H0D B;  4FJC A;  3DWD A;  2CSY A;  2FD4 A;  3DQV R;  3GL6 A;  2OXQ C;  3HCT A;  4FO9 A;  2RI7 A;  3KNV A;  3O36 A;  5KH3 A;  4OGE A;  3MHS A;  4S3O C;  2YU4 A;  3DDT A;  1IYM A;  2UZG A;  2XP0 A;  2EA6 A;  4R8P K;  2KWJ A;  2KFT A;  4V3L C;  3Q1D A;  4WZ2 A;  2KWO A;  3SOX A;  4YAT A;  2YVR A;  2LN0 A;  4B7Y C;  4GB0 A;  4ZDT A;  3KV5 A;  3U5P A;  2FUU A;  2XOC A;  4LJN A;  5B77 A;  2L43 A;  3U5N A;  2MD7 B;  4Q6F A;  2EGP A;  4Z0O A;  2ECJ A;  2RR4 A;  2G6Q A;  5TBN A;  2KGI A;  2JMJ A;  1WEQ A;  1X4U A;  3HCU A;  3N9N A;  2E6S A;  2F6N A;  2YQM A;  2VJE A;  3MDB C;  4LAD B;  2PUY A;  1K2F A;  1FBV A;  4XI1 A;  4YAB A;  2MA5 A;  3KDE C;  5K3Q A;  4BHW A;  4WZ0 A;  3LDY A;  5D1M B;  3U5O A;  5D1L B;  2OWA A;  3RPG B;  5SVY A;  4AYC A;  1WFK A;  2KR4 A;  5SVI B;  4ZQL A;  1MM2 A;  2G45 A;  2KU3 A;  3KQI A;  1ZBD B; 
#chains in the Genus database with same CATH homology
 3GV4 A;  2LDR A;  5G05 B;  1LDJ B;  4O64 A;  2LV9 A;  5G04 B;  2YYR A;  5C11 A;  1WE9 A;  4F52 B;  3EB5 A;  5H9M A;  2MD8 C;  1N87 A;  2YHN A;  2VPE A;  4MVT A;  2Y1M A;  2ZET C;  2BAY A;  5DIN A;  2HDP A;  3O33 A;  3NG2 A;  1WEE A;  2ECG A;  2AN6 A;  2YUC A;  4W4U A;  2MNZ A;  2ECW A;  3M63 A;  2L80 A;  2H0D A;  2RSD A;  4YBS A;  3M99 A;  3N9P A;  1VFY A;  5AIU A;  3PUQ A;  2YRE A;  4UI9 B;  3ZPV E;  2VNF A;  1WEO A;  2NAA A;  2DX8 A;  1XWH A;  2ECI A;  2PNX A;  5DKA A;  2L0B A;  2QIZ A;  1WIM A;  4UP0 A;  1CHC A;  2LXH C;  2KGG A;  4S3O B;  4PPE A;  4N4F A;  2VPB A;  4QF3 A;  4GNG A;  4A49 A;  2YUR A;  5FEY A;  5KH9 A;  1JOC A;  1MM3 A;  4I7D A;  4LKA A;  5LKZ A;  2Y43 A;  1LDK C;  4B86 C;  4ZUX U;  2M85 A;  2K1J A;  4GND A;  5LKU A;  4A4C A;  3O34 A;  2JMI A;  4IC3 A;  5C13 A;  2L75 A;  4IC2 A;  2LGV A;  2L5U A;  1E4U A;  4WZ3 B;  4I7C A;  2K17 A;  2QJ0 A;  3N9M A;  3SOW A;  2LGL A;  2LXP C;  2G43 A;  1WGM A;  3ASL A;  5EYA F;  4R7E A;  1JM7 A;  5H1V A;  2XEU A;  2YT5 A;  3HCS A;  4L58 A;  5B78 A;  4N3W A;  2C2L A;  2JRJ A;  2KRE A;  2MIQ A;  2KWN A;  5KH7 A;  3T7L A;  5B8D A;  5LKT A;  1BOR A;  2VJF B;  5D1K B;  2VPG A;  5TRB A;  2CKL B;  5AIT A;  2CT2 A;  2ECN A;  3LQI A;  5H1U A;  4YBM A;  2KYU A;  3PHD A;  2KIZ A;  5FB1 A;  2HYE D;  3EB6 A;  3ZVZ B;  2YHO A;  1HYI A;  5I3L A;  5TDR A;  4WA6 A;  3RTR B;  4UP5 A;  3O70 A;  3N9L A;  2IDA A;  1X4J A;  2F6J A;  4TKP B;  1HYJ A;  3PUR A;  4MSX A;  4PTB A;  3C5K A;  2MUM A;  5B75 A;  3SHB A;  2Y1N A;  3HTK C;  1WEW A;  4YBT A;  2CSZ A;  2YSM A;  4LLB A;  4L7X A;  5TAB A;  1Z2Q A;  2FUI A;  1WES A;  2CKL A;  4A0C D;  1WEN A;  3N9Q A;  4QF2 A;  2MNY A;  4AVX A;  2LQ6 A;  5H1T A;  1V87 A;  5LKX A;  5G0F A;  5B79 A;  3T6R A;  4AUQ B;  2ECT A;  4X3G A;  3ZVY A;  2QIC A;  1F62 A;  1Z6U A;  2JMD A;  1VYX A;  2ECV A;  2VJF A;  2XB1 A;  3KV6 A;  3O35 A;  4FK5 A;  2K16 A;  3C6W A;  4AP4 A;  3VK6 A;  3ZNI A;  4R2Y A;  3DPL R;  1WEU A;  1DVP A;  1WEM A;  4NN2 A;  3V43 A;  4BBQ A;  2MT5 A;  3O37 A;  2M3H A;  1WEV A;  1X4I A;  4YAD A;  3L11 A;  1WIL A;  4A4B A;  4I7B A;  2F42 A;  2YW8 A;  3SOU A;  3IHP A;  4C9Z A;  1JM7 B;  4AYC B;  1G25 A;  3M62 A;  2EOD A;  3LRQ A;  1FP0 A;  1WEP A;  2LRI C;  2M1R A;  4V3K C;  2I50 A;  4CA1 A;  3FL2 A;  4P5O B;  3ZYQ A;  4FIP A;  3RPG C;  2VJE B;  3MHH A;  5FER A;  2MA6 A;  3N9O A;  2VP7 A;  5J3X A;  4GNE A;  2M6M A;  4LK9 A;  2LGK A;  2E6R A;  2C2V S;  2YQL A;  1VD4 A;  3ZPV 1;  3LQJ A;  2KWK A;  4YAX A;  3L1X A;  3L1Z B;  5JG6 A;  2KE1 A;  3QZV A;  1RMD A;  4GNF A;  4CCG X;  2D8S A;  2YSJ A;  5B76 A;  3LQH A;  1U6G B;  2LGG A;  4YC9 A;  1Z60 A;  2VPD A;  3ZTG A;  5FB0 A;  1T1H A;  3O7A A;  5TDW A;  5LCW B;  2FSA A;  3U5M A;  2K4D A;  3I2D A;  2H0D B;  4FJC A;  2CSY A;  3DQV R;  3GL6 A;  2OXQ C;  3HCT A;  4FO9 A;  2RI7 A;  3KNV A;  3O36 A;  5KH3 A;  3MHS A;  4S3O C;  2YU4 A;  1IYM A;  2UZG A;  2EA6 A;  4R8P K;  2KWJ A;  2KFT A;  4V3L C;  4WZ2 A;  2KWO A;  3SOX A;  4YAT A;  4B7Y C;  2LN0 A;  4GB0 A;  4ZDT A;  3KV5 A;  3U5P A;  2FUU A;  4LJN A;  5B77 A;  2L43 A;  3U5N A;  2MD7 B;  4Q6F A;  2EGP A;  2ECJ A;  2G6Q A;  5TBN A;  2KGI A;  2JMJ A;  1WEQ A;  1X4U A;  3HCU A;  3N9N A;  2E6S A;  2F6N A;  2YQM A;  2VJE A;  4LAD B;  2PUY A;  1K2F A;  1FBV A;  4XI1 A;  4YAB A;  2MA5 A;  4BHW A;  4WZ0 A;  5D1M B;  3U5O A;  5D1L B;  3RPG B;  4AYC A;  1WFK A;  2KR4 A;  4ZQL A;  1MM2 A;  2G45 A;  2KU3 A;  3KQI A;  1ZBD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...