1WFKA

Fyve domain of fyve domain containing 19 protein from mus musculus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
GSSGSSGMESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTRGSSDNASKWSPPQNYKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FYVE domain of FYVE domain containing 19 protein from Mus musculus
rcsb
source organism Mus musculus
molecule tags Unknown function
molecule keywords zinc finger, FYVE domain containing 19
total genus 7
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wfkA01
2AN6A 5DINA 1JOCA 1RMDA 3LQHA 2YQLA 3ZYQA 4PPEA 4A4CA 4LKAA 1DVPA 2L75A 2YSMA 2VPGA 2KFTA 4L58A 2ECNA 4GNEA 5DKAA 4L7XA 2MIQA 1X4IA 4PTBA 5LCWB 2VNFA 3HCUA 4V3LC 1WILA 2VPDA 3ZPVE 1HYJA 1Z60A 4ZUXU 2LGLA 4A4BA 2VJFA 3LRQA 2ZETC 3O7AA 2XB1A 5TDRA 2D8SA 4X3GA 4YBMA 4LK9A 2ECIA 2K17A 5H1TA 2LXPC 3U5OA 3ZTGA 2MT5A 2I50A 5AIUA 1Z2QA 5LKUA 5B78A 4AUQB 2ECTA 5G0FA 2MNYA 2K1JA 3ZVZB 3ZNIA 3GV4A 4WZ2A 4GNGA 2CT2A 2H0DB 4V3KC 1N87A 4AP4A 1JM7A 4NN2A 4A0CD 1U6GB 2K16A 2LRIC 4R8PK 2M85A 2M1RA 4FK5A 2LGGA 3KNVA 2C2VS 3O36A 3MHHA 1MM2A 3DQVR 4AYCB 3MHSA 2YHNA 3SOUA 3C5KA 2JMJA 2M6MA 4B86C 1FBVA 3T6RA 3N9MA 1V87A 2KR4A 5G05B 4UP5A 2F42A 2RSDA 4S3OB 4BBQA 1G25A 4MVTA 5H1UA 2HYED 2G45A 2YW8A 5LKTA 2C2LA 2H0DA 2LGVA 2VJFB 3QZVA 4MSXA 4XI1A 5D1KB 3VK6A 3N9LA 1HYIA 3M62A 1X4JA 2YQMA 2MUMA 2EODA 4TKPB 4GNFA 2Y43A 2E6SA 2QICA 2L0BA 2L43A 5H9MA 4R2YA 2ECWA 2LDRA 2YUCA 4Q6FA 5FB0A 2LQ6A 4I7CA 2VJEA 5C13A 5I3LA 5TDWA 5G04B 4GNDA 2K4DA 2G43A 1WEQA 5LKZA 5TBNA 5KH7A 2Y1NA 4FO9A 1WEPA 2KE1A 2M3HA 3N9NA 4YABA 2YYRA 5AITA 2CSZA 3ZPV1 5LKXA 3U5NA 1VYXA 3GL6A 5FB1A 3ZVYA 2ECVA 4I7DA 2KYUA 3LQJA 2FUIA 3U5MA 2ECJA 4FIPA 4S3OC 1VD4A 3SHBA 1BORA 4YBTA 3M99A 5H1VA 3KQIA 3RPGB 2YU4A 3O34A 2CKLB 3LQIA 2CSYA 2VPBA 2JRJA 4QF2A 2LGKA 3O35A 2IDAA 2ECGA 3C6WA 2KWJA 4LJNA 3U5PA 2LN0A 2FUUA 3HTKC 4N4FA 1MM3A 1WEOA 2Y1MA 1XWHA 2F6JA 4YADA 2QIZA 1F62A 2L5UA 3O37A 1WFKA 4W4UA 2YREA 1LDJB 1FP0A 1WEUA 3IHPA 5B77A 2KREA 1WEVA 3HCTA 3SOXA 3ASLA 5TRBA 4N3WA 4BHWA 2EGPA 4CA1A 2KIZA 4ZDTA 4R7EA 2XEUA 2OXQC 2PNXA 4YBSA 5D1MB 2MNZA 3I2DA 1LDKC 2JMDA 4WZ3B 1K2FA 2VJEB 1Z6UA 2PUYA 1CHCA 2YT5A 3N9OA 4IC3A 4B7YC 3N9QA 2KGIA 4O64A 2DX8A 1WEEA 1IYMA 5FEYA 4LLBA 5J3XA 3RPGC 1ZBDB 3O70A 1WEMA 2L80A 4YAXA 1WESA 4LADB 1WIMA 4AVXA 4I7BA 2RI7A 3N9PA 3V43A 3PHDA 3KV6A 2E6RA 4WZ0A 1WEWA 2KWOA 4WA6A 1T1HA 3M63A 5EYAF 2G6QA 3FL2A 3PURA 4YC9A 2KU3A 3L11A 4FJCA 3PUQA 4ZQLA 2KWNA 2YHOA 2VPEA 3RTRB 2NAAA 3T7LA 4UI9B 1WENA 1JM7B 2F6NA 5D1LB 4UP0A 5C11A 5KH9A 4AYCA 3DPLR 4A49A 2MA5A 2HDPA 2YSJA 2YURA 3EB6A 3L1XA 4IC2A 4F52B 1VFYA 2CKLA 5B76A 2KWKA 3O33A 2EA6A 4C9ZA 2VP7A 3HCSA 5FERA 1WGMA 4CCGX 2KGGA 3KV5A 4YATA 2QJ0A 3EB5A 3L1ZB 2MD8C 5KH3A 2UZGA 1WE9A 4GB0A 5JG6A 1X4UA 5B75A 3NG2A 4P5OB 2LV9A 1E4UA 2JMIA 5B79A 5TABA 2MA6A 2MD7B 5B8DA 2BAYA 2FSAA 2LXHC 3SOWA 4QF3A
chains in the Genus database with same CATH superfamily
2AN6A 5DINA 1JOCA 1RMDA 3LQHA 2B0OE 2YQLA 3ZYQA 4PPEA 4A4CA 4LKAA 1DVPA 2L75A 2YSMA 2VPGA 2CRRA 2KFTA 4L58A 2ECNA 4GNEA 5DKAA 3JUEA 4L7XA 2MIQA 1X4IA 4PTBA 5LCWB 2VNFA 3HCUA 4V3LC 2XOYA 1WILA 2VPDA 4Z0RA 3ZPVE 1HYJA 1Z60A 4ZUXU 2LGLA 4A4BA 2VJFA 3LRQA 2ZETC 3O7AA 2XB1A 5TDRA 2D8SA 4X3GA 4YBMA 4LK9A 2ECIA 2K17A 5H1TA 2LXPC 3U5OA 3ZTGA 2MT5A 2EXUA 2D8UA 2I50A 5AIUA 3FM8C 1Z2QA 3E2DA 5LKUA 5B78A 4AUQB 2ECTA 4F1PA 5SVYA 3Q1DA 5SVIA 5G0FA 2MNYA 2K1JA 3ZVZB 3ZNIA 2JM3A 3GV4A 4WZ2A 1DCQA 2CRWA 2CT2A 2H0DB 4GNGA 4V3KC 3T9KA 1N87A 4AP4A 1JM7A 2EGMA 4NN2A 4A0CD 1U6GB 2K16A 2LRIC 4R8PK 3O47A 2M85A 2M1RA 4FK5A 2LGGA 3KNVA 4QQ4A 2C2VS 3O36A 3MHHA 1MM2A 2XOZA 3DQVR 3LDYA 4AYCB 3MHSA 2YHNA 3SOUA 3C5KA 2JMJA 2M6MA 4B86C 1FBVA 3N9MA 3T6RA 1V87A 3DDTA 2KR4A 5G05B 3FAOA 4UP5A 2F42A 2RSDA 4S3OB 4BBQA 1G25A 3PLWA 4MVTA 5H1UA 2HYED 2G45A 2YW8A 5LKTA 2C2LA 2H0DA 2LGVA 2VJFB 3QZVA 4MSXA 4XI1A 5D1KB 3VK6A 1MBMA 3N9LA 1HYIA 3M62A 1X4JA 2YQMA 2MUMA 2EODA 4TKPB 4GNFA 2Y43A 2E6SA 2QICA 2L0BA 2FD4A 2L43A 2KKYA 5H9MA 4R2YA 2ECWA 2LDRA 2YUCA 4Q6FA 5FB0A 2LQ6A 2XP0A 4I7CA 2VJEA 5C13A 5I3LA 5TDWA 5G04B 4OGCA 4GNDA 2K4DA 2G43A 1WEQA 2M13A 5LKZA 5TBNA 5KH7A 2Y1NA 4FO9A 1WEPA 2KE1A 2M3HA 2IQJA 5SVXA 3N9NA 4YABA 2YYRA 5AITA 2CSZA 3ZPV1 5LKXA 3U5NA 1VYXA 3GL6A 3SUBA 5FB1A 3ZVYA 2ECVA 4I7DA 2KYUA 3LQJA 2YVRA 2FUIA 3U5MA 2ECJA 4FIPA 4S3OC 1VD4A 3SHBA 2XOCA 1BORA 4YBTA 3LVRE 3M99A 5H1VA 3KQIA 3RPGB 2YU4A 3O34A 2CKLB 3LQIA 2CSYA 2VPBA 2DJAA 2JRJA 4QF2A 2LGKA 3O35A 2IDAA 2ECGA 3C6WA 2KKXA 2KWJA 2CONA 4LJNA 3U5PA 2LN0A 2FUUA 3HTKC 4N4FA 1MM3A 1WEOA 2Y1MA 1XWHA 3FANA 3MDBC 2F6JA 4YADA 2QIZA 1F62A 2L5UA 2RR4A 3O37A 1WFKA 4W4UA 2YREA 2L7PA 1LDJB 1FP0A 1WEUA 3IHPA 5B77A 2KREA 1WEVA 3HCTA 3SOXA 3ASLA 5TRBA 4N3WA 4BHWA 2EGPA 4CA1A 2KIZA 4ZDTA 4R7EA 2XEUA 2OXQC 2PNXA 4O62A 4YBSA 5D1MB 2MNZA 3M7KA 2LAUA 3I2DA 1LDKC 2JMDA 2E61A 4WZ3B 1K2FA 2VJEB 1Z6UA 2PUYA 1CHCA 2DSMA 2YT5A 3N9OA 4IC3A 4B7YC 3N9QA 2KGIA 4O64A 2DX8A 1WEEA 1IYMA 2CSVA 5FEYA 4LLBA 5J3XA 3RPGC 2OWAA 1ZBDB 2P57A 5SVIB 3O70A 3FEHA 1WEMA 2L80A 4YAXA 1WESA 4LADB 1WIMA 4AVXA 4I7BA 2RI7A 3N9PA 3V43A 3PHDA 3KV6A 2E6RA 4WZ0A 1WEWA 2KWOA 4WA6A 4Z0OA 1T1HA 3M63A 5EYAF 2G6QA 3FL2A 3PURA 4YC9A 2KU3A 3L11A 4FJCA 2FFWA 3PUQA 4ZQLA 2KWNA 2YHOA 2VPEA 3RTRB 2NAAA 3H7HA 4OGEA 3T7LA 5K3QA 4UI9B 1WENA 1JM7B 2F6NA 5D1LB 4UP0A 5C11A 5KH9A 4AYCA 3DPLR 3LVQE 2MA5A 2YSJA 2HDPA 4A49A 2MKEA 2YURA 3EB6A 3L1XA 4IC2A 4F52B 1VFYA 2CKLA 3KDEC 5B76A 2KWKA 3O33A 2EA6A 4C9ZA 2VP7A 3LJUX 3HCSA 5FERA 1WGMA 4CCGX 2KGGA 3KV5A 4YATA 2QJ0A 3EB5A 3L1ZB 3FJUB 2MD8C 5KH3A 2UZGA 1WE9A 4GB0A 5JG6A 1X4UA 5B75A 3NG2A 4P5OB 2LV9A 3DWDA 4H9DA 1E4UA 2JMIA 5B79A 5TABA 2MA6A 2MD7B 5B8DA 2BAYA 2FSAA 2JUNA 2LXHC 3SOWA 4QF3A
chains in the Genus database with same CATH topology
2AN6A 5DINA 1JOCA 1RMDA 3LQHA 2YQLA 3ZYQA 4PPEA 4A4CA 4LKAA 1DVPA 2L75A 2YSMA 2VPGA 2KFTA 4L58A 2ECNA 4GNEA 5DKAA 4L7XA 2MIQA 1X4IA 4PTBA 5LCWB 2VNFA 3HCUA 4V3LC 1WILA 2VPDA 3ZPVE 1HYJA 1Z60A 4ZUXU 2LGLA 4A4BA 2VJFA 3LRQA 2ZETC 3O7AA 2XB1A 5TDRA 2D8SA 4X3GA 4YBMA 4LK9A 2ECIA 2K17A 5H1TA 2LXPC 3U5OA 3ZTGA 2MT5A 2I50A 5AIUA 1Z2QA 5LKUA 5B78A 4AUQB 2ECTA 5G0FA 2MNYA 2K1JA 3ZVZB 3ZNIA 3GV4A 4WZ2A 4GNGA 2CT2A 2H0DB 4V3KC 1N87A 4AP4A 1JM7A 4NN2A 4A0CD 1U6GB 2K16A 2LRIC 4R8PK 2M85A 2M1RA 4FK5A 2LGGA 3KNVA 2C2VS 3O36A 3MHHA 1MM2A 3DQVR 4AYCB 3MHSA 2YHNA 3SOUA 3C5KA 2JMJA 2M6MA 4B86C 1FBVA 3T6RA 3N9MA 1V87A 2KR4A 5G05B 4UP5A 2F42A 2RSDA 4S3OB 4BBQA 1G25A 4MVTA 5H1UA 2HYED 2G45A 2YW8A 5LKTA 2C2LA 2H0DA 2LGVA 2VJFB 3QZVA 4MSXA 4XI1A 5D1KB 3VK6A 3N9LA 1HYIA 3M62A 1X4JA 2YQMA 2MUMA 2EODA 4TKPB 4GNFA 2Y43A 2E6SA 2QICA 2L0BA 2L43A 5H9MA 4R2YA 2ECWA 2LDRA 2YUCA 4Q6FA 5FB0A 2LQ6A 4I7CA 2VJEA 5C13A 5I3LA 5TDWA 5G04B 4GNDA 2K4DA 2G43A 1WEQA 5LKZA 5TBNA 5KH7A 2Y1NA 4FO9A 1WEPA 2KE1A 2M3HA 3N9NA 4YABA 2YYRA 5AITA 2CSZA 3ZPV1 5LKXA 3U5NA 1VYXA 3GL6A 5FB1A 3ZVYA 2ECVA 4I7DA 2KYUA 3LQJA 2FUIA 3U5MA 2ECJA 4FIPA 4S3OC 1VD4A 3SHBA 1BORA 4YBTA 3M99A 5H1VA 3KQIA 3RPGB 2YU4A 3O34A 2CKLB 3LQIA 2CSYA 2VPBA 2JRJA 4QF2A 2LGKA 3O35A 2IDAA 2ECGA 3C6WA 2KWJA 4LJNA 3U5PA 2LN0A 2FUUA 3HTKC 4N4FA 1MM3A 1WEOA 2Y1MA 1XWHA 2F6JA 4YADA 2QIZA 1F62A 2L5UA 3O37A 1WFKA 4W4UA 2YREA 1LDJB 1FP0A 1WEUA 3IHPA 5B77A 2KREA 1WEVA 3HCTA 3SOXA 3ASLA 5TRBA 4N3WA 4BHWA 2EGPA 4CA1A 2KIZA 4ZDTA 4R7EA 2XEUA 2OXQC 2PNXA 4YBSA 5D1MB 2MNZA 3I2DA 1LDKC 2JMDA 4WZ3B 1K2FA 2VJEB 1Z6UA 2PUYA 1CHCA 2YT5A 3N9OA 4IC3A 4B7YC 3N9QA 2KGIA 4O64A 2DX8A 1WEEA 1IYMA 5FEYA 4LLBA 5J3XA 3RPGC 1ZBDB 3O70A 1WEMA 2L80A 4YAXA 1WESA 4LADB 1WIMA 4AVXA 4I7BA 2RI7A 3N9PA 3V43A 3PHDA 3KV6A 2E6RA 4WZ0A 1WEWA 2KWOA 4WA6A 1T1HA 3M63A 5EYAF 2G6QA 3FL2A 3PURA 4YC9A 2KU3A 3L11A 4FJCA 3PUQA 4ZQLA 2KWNA 2YHOA 2VPEA 3RTRB 2NAAA 3T7LA 4UI9B 1WENA 1JM7B 2F6NA 5D1LB 4UP0A 5C11A 5KH9A 4AYCA 3DPLR 4A49A 2MA5A 2HDPA 2YSJA 2YURA 3EB6A 3L1XA 4IC2A 4F52B 1VFYA 2CKLA 5B76A 2KWKA 3O33A 2EA6A 4C9ZA 2VP7A 3HCSA 5FERA 1WGMA 4CCGX 2KGGA 3KV5A 4YATA 2QJ0A 3EB5A 3L1ZB 2MD8C 5KH3A 2UZGA 1WE9A 4GB0A 5JG6A 1X4UA 5B75A 3NG2A 4P5OB 2LV9A 1E4UA 2JMIA 5B79A 5TABA 2MA6A 2MD7B 5B8DA 2BAYA 2FSAA 2LXHC 3SOWA 4QF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AN6 A;  5DIN A;  1JOC A;  1RMD A;  3LQH A;  2YQL A;  3ZYQ A;  4PPE A;  4A4C A;  4LKA A;  1DVP A;  2L75 A;  2YSM A;  2VPG A;  2KFT A;  4L58 A;  2ECN A;  4GNE A;  5DKA A;  4L7X A;  2MIQ A;  1X4I A;  4PTB A;  5LCW B;  2VNF A;  3HCU A;  4V3L C;  1WIL A;  2VPD A;  3ZPV E;  1HYJ A;  1Z60 A;  4ZUX U;  2LGL A;  4A4B A;  2VJF A;  3LRQ A;  2ZET C;  3O7A A;  2XB1 A;  5TDR A;  2D8S A;  4X3G A;  4YBM A;  4LK9 A;  2ECI A;  2K17 A;  5H1T A;  2LXP C;  3U5O A;  3ZTG A;  2MT5 A;  2I50 A;  5AIU A;  1Z2Q A;  5LKU A;  5B78 A;  4AUQ B;  2ECT A;  5G0F A;  2MNY A;  2K1J A;  3ZVZ B;  3ZNI A;  3GV4 A;  4WZ2 A;  4GNG A;  2CT2 A;  2H0D B;  4V3K C;  1N87 A;  4AP4 A;  1JM7 A;  4NN2 A;  4A0C D;  1U6G B;  2K16 A;  2LRI C;  4R8P K;  2M85 A;  2M1R A;  4FK5 A;  2LGG A;  3KNV A;  2C2V S;  3O36 A;  3MHH A;  1MM2 A;  3DQV R;  4AYC B;  3MHS A;  2YHN A;  3SOU A;  3C5K A;  2JMJ A;  2M6M A;  4B86 C;  1FBV A;  3T6R A;  3N9M A;  1V87 A;  2KR4 A;  5G05 B;  4UP5 A;  2F42 A;  2RSD A;  4S3O B;  4BBQ A;  1G25 A;  4MVT A;  5H1U A;  2HYE D;  2G45 A;  2YW8 A;  5LKT A;  2C2L A;  2H0D A;  2LGV A;  2VJF B;  3QZV A;  4MSX A;  4XI1 A;  5D1K B;  3VK6 A;  3N9L A;  1HYI A;  3M62 A;  1X4J A;  2YQM A;  2MUM A;  2EOD A;  4TKP B;  4GNF A;  2Y43 A;  2E6S A;  2QIC A;  2L0B A;  2L43 A;  5H9M A;  4R2Y A;  2ECW A;  2LDR A;  2YUC A;  4Q6F A;  5FB0 A;  2LQ6 A;  4I7C A;  2VJE A;  5C13 A;  5I3L A;  5TDW A;  5G04 B;  4GND A;  2K4D A;  2G43 A;  1WEQ A;  5LKZ A;  5TBN A;  5KH7 A;  2Y1N A;  4FO9 A;  1WEP A;  2KE1 A;  2M3H A;  3N9N A;  4YAB A;  2YYR A;  5AIT A;  2CSZ A;  3ZPV 1;  5LKX A;  3U5N A;  1VYX A;  3GL6 A;  5FB1 A;  3ZVY A;  2ECV A;  4I7D A;  2KYU A;  3LQJ A;  2FUI A;  3U5M A;  2ECJ A;  4FIP A;  4S3O C;  1VD4 A;  3SHB A;  1BOR A;  4YBT A;  3M99 A;  5H1V A;  3KQI A;  3RPG B;  2YU4 A;  3O34 A;  2CKL B;  3LQI A;  2CSY A;  2VPB A;  2JRJ A;  4QF2 A;  2LGK A;  3O35 A;  2IDA A;  2ECG A;  3C6W A;  2KWJ A;  4LJN A;  3U5P A;  2LN0 A;  2FUU A;  3HTK C;  4N4F A;  1MM3 A;  1WEO A;  2Y1M A;  1XWH A;  2F6J A;  4YAD A;  2QIZ A;  1F62 A;  2L5U A;  3O37 A;  1WFK A;  4W4U A;  2YRE A;  1LDJ B;  1FP0 A;  1WEU A;  3IHP A;  5B77 A;  2KRE A;  1WEV A;  3HCT A;  3SOX A;  3ASL A;  5TRB A;  4N3W A;  4BHW A;  2EGP A;  4CA1 A;  2KIZ A;  4ZDT A;  4R7E A;  2XEU A;  2OXQ C;  2PNX A;  4YBS A;  5D1M B;  2MNZ A;  3I2D A;  1LDK C;  2JMD A;  4WZ3 B;  1K2F A;  2VJE B;  1Z6U A;  2PUY A;  1CHC A;  2YT5 A;  3N9O A;  4IC3 A;  4B7Y C;  3N9Q A;  2KGI A;  4O64 A;  2DX8 A;  1WEE A;  1IYM A;  5FEY A;  4LLB A;  5J3X A;  3RPG C;  1ZBD B;  3O70 A;  1WEM A;  2L80 A;  4YAX A;  1WES A;  4LAD B;  1WIM A;  4AVX A;  4I7B A;  2RI7 A;  3N9P A;  3V43 A;  3PHD A;  3KV6 A;  2E6R A;  4WZ0 A;  1WEW A;  2KWO A;  4WA6 A;  1T1H A;  3M63 A;  5EYA F;  2G6Q A;  3FL2 A;  3PUR A;  4YC9 A;  2KU3 A;  3L11 A;  4FJC A;  3PUQ A;  4ZQL A;  2KWN A;  2YHO A;  2VPE A;  3RTR B;  2NAA A;  3T7L A;  4UI9 B;  1WEN A;  1JM7 B;  2F6N A;  5D1L B;  4UP0 A;  5C11 A;  5KH9 A;  4AYC A;  3DPL R;  4A49 A;  2MA5 A;  2HDP A;  2YSJ A;  2YUR A;  3EB6 A;  3L1X A;  4IC2 A;  4F52 B;  1VFY A;  2CKL A;  5B76 A;  2KWK A;  3O33 A;  2EA6 A;  4C9Z A;  2VP7 A;  3HCS A;  5FER A;  1WGM A;  4CCG X;  2KGG A;  3KV5 A;  4YAT A;  2QJ0 A;  3EB5 A;  3L1Z B;  2MD8 C;  5KH3 A;  2UZG A;  1WE9 A;  4GB0 A;  5JG6 A;  1X4U A;  5B75 A;  3NG2 A;  4P5O B;  2LV9 A;  1E4U A;  2JMI A;  5B79 A;  5TAB A;  2MA6 A;  2MD7 B;  5B8D A;  2BAY A;  2FSA A;  2LXH C;  3SOW A;  4QF3 A; 
#chains in the Genus database with same CATH topology
 2AN6 A;  5DIN A;  1JOC A;  1RMD A;  3LQH A;  2B0O E;  2YQL A;  3ZYQ A;  4PPE A;  4A4C A;  4LKA A;  1DVP A;  2L75 A;  2YSM A;  2VPG A;  2CRR A;  2KFT A;  4L58 A;  2ECN A;  4GNE A;  5DKA A;  3JUE A;  4L7X A;  2MIQ A;  1X4I A;  4PTB A;  5LCW B;  2VNF A;  3HCU A;  4V3L C;  2XOY A;  1WIL A;  2VPD A;  4Z0R A;  3ZPV E;  1HYJ A;  1Z60 A;  4ZUX U;  2LGL A;  4A4B A;  2VJF A;  3LRQ A;  2ZET C;  3O7A A;  2XB1 A;  5TDR A;  2D8S A;  4X3G A;  4YBM A;  4LK9 A;  2ECI A;  2K17 A;  5H1T A;  2LXP C;  3U5O A;  3ZTG A;  2MT5 A;  2EXU A;  2D8U A;  2I50 A;  5AIU A;  3FM8 C;  1Z2Q A;  3E2D A;  5LKU A;  5B78 A;  4AUQ B;  2ECT A;  4F1P A;  5SVY A;  3Q1D A;  5SVI A;  5G0F A;  2MNY A;  2K1J A;  3ZVZ B;  3ZNI A;  2JM3 A;  3GV4 A;  4WZ2 A;  1DCQ A;  2CRW A;  2CT2 A;  2H0D B;  4GNG A;  4V3K C;  3T9K A;  1N87 A;  4AP4 A;  1JM7 A;  2EGM A;  4NN2 A;  4A0C D;  1U6G B;  2K16 A;  2LRI C;  4R8P K;  3O47 A;  2M85 A;  2M1R A;  4FK5 A;  2LGG A;  3KNV A;  4QQ4 A;  2C2V S;  3O36 A;  3MHH A;  1MM2 A;  2XOZ A;  3DQV R;  3LDY A;  4AYC B;  3MHS A;  2YHN A;  3SOU A;  3C5K A;  2JMJ A;  2M6M A;  4B86 C;  1FBV A;  3N9M A;  3T6R A;  1V87 A;  3DDT A;  2KR4 A;  5G05 B;  3FAO A;  4UP5 A;  2F42 A;  2RSD A;  4S3O B;  4BBQ A;  1G25 A;  3PLW A;  4MVT A;  5H1U A;  2HYE D;  2G45 A;  2YW8 A;  5LKT A;  2C2L A;  2H0D A;  2LGV A;  2VJF B;  3QZV A;  4MSX A;  4XI1 A;  5D1K B;  3VK6 A;  1MBM A;  3N9L A;  1HYI A;  3M62 A;  1X4J A;  2YQM A;  2MUM A;  2EOD A;  4TKP B;  4GNF A;  2Y43 A;  2E6S A;  2QIC A;  2L0B A;  2FD4 A;  2L43 A;  2KKY A;  5H9M A;  4R2Y A;  2ECW A;  2LDR A;  2YUC A;  4Q6F A;  5FB0 A;  2LQ6 A;  2XP0 A;  4I7C A;  2VJE A;  5C13 A;  5I3L A;  5TDW A;  5G04 B;  4OGC A;  4GND A;  2K4D A;  2G43 A;  1WEQ A;  2M13 A;  5LKZ A;  5TBN A;  5KH7 A;  2Y1N A;  4FO9 A;  1WEP A;  2KE1 A;  2M3H A;  2IQJ A;  5SVX A;  3N9N A;  4YAB A;  2YYR A;  5AIT A;  2CSZ A;  3ZPV 1;  5LKX A;  3U5N A;  1VYX A;  3GL6 A;  3SUB A;  5FB1 A;  3ZVY A;  2ECV A;  4I7D A;  2KYU A;  3LQJ A;  2YVR A;  2FUI A;  3U5M A;  2ECJ A;  4FIP A;  4S3O C;  1VD4 A;  3SHB A;  2XOC A;  1BOR A;  4YBT A;  3LVR E;  3M99 A;  5H1V A;  3KQI A;  3RPG B;  2YU4 A;  3O34 A;  2CKL B;  3LQI A;  2CSY A;  2VPB A;  2DJA A;  2JRJ A;  4QF2 A;  2LGK A;  3O35 A;  2IDA A;  2ECG A;  3C6W A;  2KKX A;  2KWJ A;  2CON A;  4LJN A;  3U5P A;  2LN0 A;  2FUU A;  3HTK C;  4N4F A;  1MM3 A;  1WEO A;  2Y1M A;  1XWH A;  3FAN A;  3MDB C;  2F6J A;  4YAD A;  2QIZ A;  1F62 A;  2L5U A;  2RR4 A;  3O37 A;  1WFK A;  4W4U A;  2YRE A;  2L7P A;  1LDJ B;  1FP0 A;  1WEU A;  3IHP A;  5B77 A;  2KRE A;  1WEV A;  3HCT A;  3SOX A;  3ASL A;  5TRB A;  4N3W A;  4BHW A;  2EGP A;  4CA1 A;  2KIZ A;  4ZDT A;  4R7E A;  2XEU A;  2OXQ C;  2PNX A;  4O62 A;  4YBS A;  5D1M B;  2MNZ A;  3M7K A;  2LAU A;  3I2D A;  1LDK C;  2JMD A;  2E61 A;  4WZ3 B;  1K2F A;  2VJE B;  1Z6U A;  2PUY A;  1CHC A;  2DSM A;  2YT5 A;  3N9O A;  4IC3 A;  4B7Y C;  3N9Q A;  2KGI A;  4O64 A;  2DX8 A;  1WEE A;  1IYM A;  2CSV A;  5FEY A;  4LLB A;  5J3X A;  3RPG C;  2OWA A;  1ZBD B;  2P57 A;  5SVI B;  3O70 A;  3FEH A;  1WEM A;  2L80 A;  4YAX A;  1WES A;  4LAD B;  1WIM A;  4AVX A;  4I7B A;  2RI7 A;  3N9P A;  3V43 A;  3PHD A;  3KV6 A;  2E6R A;  4WZ0 A;  1WEW A;  2KWO A;  4WA6 A;  4Z0O A;  1T1H A;  3M63 A;  5EYA F;  2G6Q A;  3FL2 A;  3PUR A;  4YC9 A;  2KU3 A;  3L11 A;  4FJC A;  2FFW A;  3PUQ A;  4ZQL A;  2KWN A;  2YHO A;  2VPE A;  3RTR B;  2NAA A;  3H7H A;  4OGE A;  3T7L A;  5K3Q A;  4UI9 B;  1WEN A;  1JM7 B;  2F6N A;  5D1L B;  4UP0 A;  5C11 A;  5KH9 A;  4AYC A;  3DPL R;  3LVQ E;  2MA5 A;  2YSJ A;  2HDP A;  4A49 A;  2MKE A;  2YUR A;  3EB6 A;  3L1X A;  4IC2 A;  4F52 B;  1VFY A;  2CKL A;  3KDE C;  5B76 A;  2KWK A;  3O33 A;  2EA6 A;  4C9Z A;  2VP7 A;  3LJU X;  3HCS A;  5FER A;  1WGM A;  4CCG X;  2KGG A;  3KV5 A;  4YAT A;  2QJ0 A;  3EB5 A;  3L1Z B;  3FJU B;  2MD8 C;  5KH3 A;  2UZG A;  1WE9 A;  4GB0 A;  5JG6 A;  1X4U A;  5B75 A;  3NG2 A;  4P5O B;  2LV9 A;  3DWD A;  4H9D A;  1E4U A;  2JMI A;  5B79 A;  5TAB A;  2MA6 A;  2MD7 B;  5B8D A;  2BAY A;  2FSA A;  2JUN A;  2LXH C;  3SOW A;  4QF3 A; 
#chains in the Genus database with same CATH homology
 2AN6 A;  5DIN A;  1JOC A;  1RMD A;  3LQH A;  2YQL A;  3ZYQ A;  4PPE A;  4A4C A;  4LKA A;  1DVP A;  2L75 A;  2YSM A;  2VPG A;  2KFT A;  4L58 A;  2ECN A;  4GNE A;  5DKA A;  4L7X A;  2MIQ A;  1X4I A;  4PTB A;  5LCW B;  2VNF A;  3HCU A;  4V3L C;  1WIL A;  2VPD A;  3ZPV E;  1HYJ A;  1Z60 A;  4ZUX U;  2LGL A;  4A4B A;  2VJF A;  3LRQ A;  2ZET C;  3O7A A;  2XB1 A;  5TDR A;  2D8S A;  4X3G A;  4YBM A;  4LK9 A;  2ECI A;  2K17 A;  5H1T A;  2LXP C;  3U5O A;  3ZTG A;  2MT5 A;  2I50 A;  5AIU A;  1Z2Q A;  5LKU A;  5B78 A;  4AUQ B;  2ECT A;  5G0F A;  2MNY A;  2K1J A;  3ZVZ B;  3ZNI A;  3GV4 A;  4WZ2 A;  4GNG A;  2CT2 A;  2H0D B;  4V3K C;  1N87 A;  4AP4 A;  1JM7 A;  4NN2 A;  4A0C D;  1U6G B;  2K16 A;  2LRI C;  4R8P K;  2M85 A;  2M1R A;  4FK5 A;  2LGG A;  3KNV A;  2C2V S;  3O36 A;  3MHH A;  1MM2 A;  3DQV R;  4AYC B;  3MHS A;  2YHN A;  3SOU A;  3C5K A;  2JMJ A;  2M6M A;  4B86 C;  1FBV A;  3T6R A;  3N9M A;  1V87 A;  2KR4 A;  5G05 B;  4UP5 A;  2F42 A;  2RSD A;  4S3O B;  4BBQ A;  1G25 A;  4MVT A;  5H1U A;  2HYE D;  2G45 A;  2YW8 A;  5LKT A;  2C2L A;  2H0D A;  2LGV A;  2VJF B;  3QZV A;  4MSX A;  4XI1 A;  5D1K B;  3VK6 A;  3N9L A;  1HYI A;  3M62 A;  1X4J A;  2YQM A;  2MUM A;  2EOD A;  4TKP B;  4GNF A;  2Y43 A;  2E6S A;  2QIC A;  2L0B A;  2L43 A;  5H9M A;  4R2Y A;  2ECW A;  2LDR A;  2YUC A;  4Q6F A;  5FB0 A;  2LQ6 A;  4I7C A;  2VJE A;  5C13 A;  5I3L A;  5TDW A;  5G04 B;  4GND A;  2K4D A;  2G43 A;  1WEQ A;  5LKZ A;  5TBN A;  5KH7 A;  2Y1N A;  4FO9 A;  1WEP A;  2KE1 A;  2M3H A;  3N9N A;  4YAB A;  2YYR A;  5AIT A;  2CSZ A;  3ZPV 1;  5LKX A;  3U5N A;  1VYX A;  3GL6 A;  5FB1 A;  3ZVY A;  2ECV A;  4I7D A;  2KYU A;  3LQJ A;  2FUI A;  3U5M A;  2ECJ A;  4FIP A;  4S3O C;  1VD4 A;  3SHB A;  1BOR A;  4YBT A;  3M99 A;  5H1V A;  3KQI A;  3RPG B;  2YU4 A;  3O34 A;  2CKL B;  3LQI A;  2CSY A;  2VPB A;  2JRJ A;  4QF2 A;  2LGK A;  3O35 A;  2IDA A;  2ECG A;  3C6W A;  2KWJ A;  4LJN A;  3U5P A;  2LN0 A;  2FUU A;  3HTK C;  4N4F A;  1MM3 A;  1WEO A;  2Y1M A;  1XWH A;  2F6J A;  4YAD A;  2QIZ A;  1F62 A;  2L5U A;  3O37 A;  1WFK A;  4W4U A;  2YRE A;  1LDJ B;  1FP0 A;  1WEU A;  3IHP A;  5B77 A;  2KRE A;  1WEV A;  3HCT A;  3SOX A;  3ASL A;  5TRB A;  4N3W A;  4BHW A;  2EGP A;  4CA1 A;  2KIZ A;  4ZDT A;  4R7E A;  2XEU A;  2OXQ C;  2PNX A;  4YBS A;  5D1M B;  2MNZ A;  3I2D A;  1LDK C;  2JMD A;  4WZ3 B;  1K2F A;  2VJE B;  1Z6U A;  2PUY A;  1CHC A;  2YT5 A;  3N9O A;  4IC3 A;  4B7Y C;  3N9Q A;  2KGI A;  4O64 A;  2DX8 A;  1WEE A;  1IYM A;  5FEY A;  4LLB A;  5J3X A;  3RPG C;  1ZBD B;  3O70 A;  1WEM A;  2L80 A;  4YAX A;  1WES A;  4LAD B;  1WIM A;  4AVX A;  4I7B A;  2RI7 A;  3N9P A;  3V43 A;  3PHD A;  3KV6 A;  2E6R A;  4WZ0 A;  1WEW A;  2KWO A;  4WA6 A;  1T1H A;  3M63 A;  5EYA F;  2G6Q A;  3FL2 A;  3PUR A;  4YC9 A;  2KU3 A;  3L11 A;  4FJC A;  3PUQ A;  4ZQL A;  2KWN A;  2YHO A;  2VPE A;  3RTR B;  2NAA A;  3T7L A;  4UI9 B;  1WEN A;  1JM7 B;  2F6N A;  5D1L B;  4UP0 A;  5C11 A;  5KH9 A;  4AYC A;  3DPL R;  4A49 A;  2MA5 A;  2HDP A;  2YSJ A;  2YUR A;  3EB6 A;  3L1X A;  4IC2 A;  4F52 B;  1VFY A;  2CKL A;  5B76 A;  2KWK A;  3O33 A;  2EA6 A;  4C9Z A;  2VP7 A;  3HCS A;  5FER A;  1WGM A;  4CCG X;  2KGG A;  3KV5 A;  4YAT A;  2QJ0 A;  3EB5 A;  3L1Z B;  2MD8 C;  5KH3 A;  2UZG A;  1WE9 A;  4GB0 A;  5JG6 A;  1X4U A;  5B75 A;  3NG2 A;  4P5O B;  2LV9 A;  1E4U A;  2JMI A;  5B79 A;  5TAB A;  2MA6 A;  2MD7 B;  5B8D A;  2BAY A;  2FSA A;  2LXH C;  3SOW A;  4QF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...