1WFKA

Fyve domain of fyve domain containing 19 protein from mus musculus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
GSSGSSGMESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTRGSSDNASKWSPPQNYKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords zinc finger, FYVE domain containing 19
publication title FYVE domain of FYVE domain containing 19 protein from Mus musculus
rcsb
source organism Mus musculus
molecule tags Unknown function
total genus 7
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wfkA01
2KE1A 2ZETC 2L75A 1WEOA 1Z60A 2KYUA 5DKAA 4FIPA 2LRIC 4LLBA 3O34A 2MT5A 4UI9B 2YW8A 2KWOA 2HDPA 1LDKC 1N87A 1LDJB 2MA5A 4X3GA 1WESA 2XEUA 1T1HA 1BORA 1JM7A 4LKAA 3MHSA 3L1XA 4GNGA 2MD8C 3RTRB 1HYIA 5G04B 4YATA 2MA6A 2YUCA 5G05B 5KH9A 3SOXA 1F62A 4QF2A 3ZTGA 3O35A 2E6RA 3HCTA 1WEVA 1CHCA 5KH7A 4GNDA 3KV6A 4V3KC 2C2LA 3ZYQA 1WILA 2CSYA 2AN6A 3U5OA 3QZVA 2QIZA 2FUIA 4B7YC 3VK6A 2ECGA 4LK9A 2CKLB 4AYCA 4UP0A 2KWKA 3PURA 4FO9A 3GV4A 3LQJA 4R8PK 3SOWA 1WENA 3SHBA 1G25A 2K1JA 2ECIA 2LGKA 2MD7B 2VJFB 5TDWA 3T6RA 3DPLR 4R2YA 2KGIA 5D1KB 5B76A 4ZDTA 2LGVA 1WIMA 2UZGA 1V87A 2CT2A 2VJEB 2MIQA 3L11A 2LN0A 2PUYA 4PTBA 5TBNA 2H0DB 1XWHA 2C2VS 1WE9A 3FL2A 2LXPC 2MNYA 4N3WA 3PUQA 4L58A 4B86C 4LJNA 4N4FA 1K2FA 1RMDA 2K16A 3LQHA 1X4UA 3EB6A 1FP0A 5J3XA 2M1RA 2ECNA 3M99A 2KREA 5FB1A 2QJ0A 1VD4A 4A4BA 4IC2A 2VNFA 1VFYA 3M62A 2ECVA 1WEUA 2LXHC 4YBSA 2YHNA 3L1ZB 1WEWA 2Y43A 2CSZA 3KV5A 4UP5A 2ECTA 3N9NA 5EYAF 4P5OB 2XB1A 4GB0A 4Q6FA 4XI1A 4GNFA 5B77A 3ZNIA 4I7CA 5LKTA 5TRBA 2YU4A 3ZVYA 3ASLA 1Z6UA 3ZPV1 2L0BA 3O70A 4ZUXU 2LGGA 5AITA 2JRJA 5JG6A 3HCUA 2YREA 2CKLA 3IHPA 2YURA 3EB5A 4L7XA 2FUUA 3LRQA 4O64A 4AP4A 2E6SA 4AUQB 4BBQA 1U6GB 2KWJA 2M6MA 4WA6A 1X4JA 2VJFA 4YBMA 1HYJA 2KU3A 3KQIA 4ZQLA 1WEMA 2KGGA 4AYCB 2F6JA 1MM2A 1MM3A 4YC9A 5C11A 2G43A 5B79A 2QICA 5LCWB 2Y1NA 3U5NA 1Z2QA 4YABA 3ZPVE 3U5MA 3N9PA 5B78A 4NN2A 2VJEA 2MUMA 3U5PA 2VPBA 2Y1MA 2EGPA 3ZVZB 5LKZA 2ECWA 2H0DA 4LADB 3LQIA 5B8DA 2M85A 5H1UA 5DINA 2VPDA 2L5UA 3C5KA 2I50A 4MVTA 4W4UA 4I7DA 4A49A 5FEYA 1ZBDB 3PHDA 3T7LA 2JMDA 2YSJA 5H1VA 2YQMA 2L43A 2RI7A 5LKUA 1X4IA 1WFKA 3GL6A 2M3HA 5TABA 4WZ0A 4I7BA 1WEQA 2ECJA 5I3LA 2YYRA 5D1LB 4IC3A 2YT5A 5AIUA 1FBVA 2DX8A 3N9OA 1IYMA 4YADA 2YSMA 3O37A 3HCSA 4YBTA 2NAAA 1JM7B 1WGMA 3O33A 5H9MA 3MHHA 4YAXA 2KIZA 2D8SA 2HYED 4R7EA 4WZ2A 2JMJA 2PNXA 5KH3A 2EA6A 3O7AA 4GNEA 2VPGA 3DQVR 4C9ZA 2F6NA 3N9LA 5D1MB 4A4CA 1JOCA 5C13A 4CA1A 1WEEA 2KR4A 2YQLA 2FSAA 2G6QA 2K17A 3HTKC 5H1TA 2LDRA 2IDAA 2K4DA 3N9MA 3I2DA 4S3OB 4TKPB 2JMIA 1E4UA 3N9QA 4WZ3B 1DVPA 2VP7A 2LV9A 2VPEA 2L80A 4AVXA 1WEPA 3C6WA 2OXQC 4V3LC 2LGLA 3SOUA 3RPGB 4F52B 1VYXA 4A0CD 2EODA 2YHOA 5G0FA 5FB0A 3KNVA 4S3OC 5LKXA 2F42A 4QF3A 2LQ6A 3O36A 4PPEA 4BHWA 4CCGX 2MNZA 3RPGC 3V43A 2G45A 2KFTA 4FJCA 5TDRA 2RSDA 2BAYA 2KWNA 5B75A 4FK5A 5FERA 3NG2A 4MSXA 3M63A
chains in the Genus database with same CATH superfamily
2KE1A 2ZETC 2L75A 1WEOA 1Z60A 2KYUA 5DKAA 4FIPA 2LRIC 4LLBA 3O34A 2MT5A 4UI9B 2YW8A 2OWAA 2KWOA 2HDPA 1LDKC 3O47A 1N87A 1LDJB 2MA5A 4OGEA 4X3GA 1WESA 2XEUA 3DWDA 1T1HA 4QQ4A 4F1PA 1BORA 1JM7A 4LKAA 3MHSA 3L1XA 4GNGA 2MD8C 3RTRB 1HYIA 5G04B 4YATA 2MA6A 2YUCA 5G05B 5KH9A 3SOXA 1F62A 4QF2A 2IQJA 3ZTGA 3O35A 2E6RA 3HCTA 1WEVA 1CHCA 5KH7A 4GNDA 3KV6A 4V3KC 2C2LA 3ZYQA 3KDEC 1WILA 2CSYA 2AN6A 3U5OA 3QZVA 2QIZA 2FUIA 3MDBC 2XOCA 2JUNA 4B7YC 3VK6A 2ECGA 4LK9A 2CKLB 4AYCA 4UP0A 3M7KA 2KWKA 3PURA 4FO9A 3GV4A 3LQJA 4R8PK 3SOWA 1WENA 3SHBA 1G25A 2K1JA 2ECIA 2LGKA 2MD7B 2VJFB 5TDWA 3FAOA 3T6RA 3DPLR 5SVIA 4R2YA 2KGIA 5D1KB 2FD4A 5B76A 2DJAA 3E2DA 4ZDTA 2LGVA 1WIMA 2UZGA 1V87A 2XP0A 2CT2A 2RR4A 2VJEB 2MIQA 3L11A 2LN0A 2PUYA 4PTBA 5TBNA 2H0DB 1XWHA 2C2VS 1WE9A 3FL2A 2LXPC 2CRWA 2MNYA 4N3WA 2XOZA 3PUQA 4L58A 4B86C 4LJNA 4N4FA 2EXUA 1K2FA 1RMDA 2K16A 3LQHA 1X4UA 3EB6A 1FP0A 5J3XA 2M1RA 4O62A 2ECNA 3M99A 2KREA 5FB1A 2QJ0A 1VD4A 4A4BA 4IC2A 2VNFA 1VFYA 3M62A 2ECVA 1WEUA 2LXHC 4YBSA 2YHNA 3L1ZB 1WEWA 2Y43A 2CSZA 3KV5A 4UP5A 2ECTA 3N9NA 5EYAF 4P5OB 2XB1A 4GB0A 1MBMA 4Q6FA 4XI1A 4GNFA 5B77A 3ZNIA 4I7CA 5LKTA 5TRBA 2YU4A 3ZVYA 3ASLA 1Z6UA 3ZPV1 2L0BA 3O70A 3Q1DA 2D8UA 4ZUXU 2LGGA 5AITA 3H7HA 2JRJA 5JG6A 3HCUA 2YREA 2CKLA 3IHPA 3JUEA 2YURA 3EB5A 4L7XA 2FUUA 3LRQA 4O64A 4AP4A 2E6SA 4AUQB 4BBQA 1U6GB 2EGMA 2KWJA 2M6MA 4WA6A 1X4JA 2VJFA 4YBMA 1HYJA 2KU3A 3PLWA 3KQIA 4ZQLA 2XOYA 2CONA 1WEMA 2KGGA 4AYCB 2F6JA 3SUBA 1MM2A 1MM3A 4YC9A 5C11A 2G43A 5B79A 2P57A 2QICA 5LCWB 2Y1NA 3U5NA 1Z2QA 4YABA 3ZPVE 3U5MA 3N9PA 5B78A 4NN2A 2VJEA 2MUMA 3U5PA 2VPBA 2Y1MA 2EGPA 3ZVZB 5LKZA 5SVYA 2ECWA 2H0DA 2CSVA 4LADB 3LQIA 5B8DA 2M85A 5H1UA 5DINA 2YVRA 2VPDA 2L5UA 3C5KA 2I50A 2L7PA 4MVTA 4W4UA 4I7DA 4A49A 5FEYA 1ZBDB 5SVXA 3PHDA 3T7LA 2JMDA 2YSJA 5H1VA 2YQMA 2L43A 2RI7A 5LKUA 1X4IA 1WFKA 3GL6A 3FJUB 2M3HA 5TABA 4WZ0A 4I7BA 1WEQA 2ECJA 5I3LA 2YYRA 5D1LB 4IC3A 2YT5A 3FEHA 4Z0OA 5AIUA 1FBVA 2DX8A 2LAUA 3DDTA 3N9OA 1IYMA 4YADA 2M13A 2YSMA 3LVRE 3O37A 3HCSA 4Z0RA 4YBTA 2NAAA 1JM7B 4OGCA 1WGMA 3FM8C 3O33A 5H9MA 3MHHA 4YAXA 2KIZA 2D8SA 2HYED 4R7EA 4WZ2A 2JMJA 2PNXA 4H9DA 5KH3A 2EA6A 3O7AA 4GNEA 3LVQE 2VPGA 3DQVR 4C9ZA 2F6NA 3N9LA 5D1MB 1DCQA 4A4CA 1JOCA 5C13A 4CA1A 1WEEA 2KR4A 2YQLA 2FSAA 2G6QA 2K17A 3HTKC 3LJUX 5H1TA 2LDRA 2IDAA 2K4DA 3N9MA 3I2DA 4S3OB 4TKPB 2JMIA 1E4UA 3N9QA 4WZ3B 1DVPA 2VP7A 2E61A 2LV9A 2VPEA 2L80A 4AVXA 3LDYA 2DSMA 1WEPA 2KKYA 2MKEA 2OXQC 3C6WA 4V3LC 5K3QA 2LGLA 3RPGB 3SOUA 4F52B 1VYXA 4A0CD 2EODA 2YHOA 5G0FA 5FB0A 3KNVA 4S3OC 5LKXA 2F42A 2FFWA 4QF3A 2LQ6A 5SVIB 3O36A 2KKXA 3T9KA 4PPEA 4BHWA 2B0OE 4CCGX 2MNZA 3RPGC 3V43A 2G45A 3FANA 2KFTA 4FJCA 5TDRA 2RSDA 2JM3A 2BAYA 2KWNA 5B75A 4FK5A 5FERA 3NG2A 4MSXA 3M63A 2CRRA
chains in the Genus database with same CATH topology
2KE1A 2ZETC 2L75A 1WEOA 1Z60A 2KYUA 5DKAA 4FIPA 2LRIC 4LLBA 3O34A 2MT5A 4UI9B 2YW8A 2KWOA 2HDPA 1LDKC 1N87A 1LDJB 2MA5A 4X3GA 1WESA 2XEUA 1T1HA 1BORA 1JM7A 4LKAA 3MHSA 3L1XA 4GNGA 2MD8C 3RTRB 1HYIA 5G04B 4YATA 2MA6A 2YUCA 5G05B 5KH9A 3SOXA 1F62A 4QF2A 3ZTGA 3O35A 2E6RA 3HCTA 1WEVA 1CHCA 5KH7A 4GNDA 3KV6A 4V3KC 2C2LA 3ZYQA 1WILA 2CSYA 2AN6A 3U5OA 3QZVA 2QIZA 2FUIA 4B7YC 3VK6A 2ECGA 4LK9A 2CKLB 4AYCA 4UP0A 2KWKA 3PURA 4FO9A 3GV4A 3LQJA 4R8PK 3SOWA 1WENA 3SHBA 1G25A 2K1JA 2ECIA 2LGKA 2MD7B 2VJFB 5TDWA 3T6RA 3DPLR 4R2YA 2KGIA 5D1KB 5B76A 4ZDTA 2LGVA 1WIMA 2UZGA 1V87A 2CT2A 2VJEB 2MIQA 3L11A 2LN0A 2PUYA 4PTBA 5TBNA 2H0DB 1XWHA 2C2VS 1WE9A 3FL2A 2LXPC 2MNYA 4N3WA 3PUQA 4L58A 4B86C 4LJNA 4N4FA 1K2FA 1RMDA 2K16A 3LQHA 1X4UA 3EB6A 1FP0A 5J3XA 2M1RA 2ECNA 3M99A 2KREA 5FB1A 2QJ0A 1VD4A 4A4BA 4IC2A 2VNFA 1VFYA 3M62A 2ECVA 1WEUA 2LXHC 4YBSA 2YHNA 3L1ZB 1WEWA 2Y43A 2CSZA 3KV5A 4UP5A 2ECTA 3N9NA 5EYAF 4P5OB 2XB1A 4GB0A 4Q6FA 4XI1A 4GNFA 5B77A 3ZNIA 4I7CA 5LKTA 5TRBA 2YU4A 3ZVYA 3ASLA 1Z6UA 3ZPV1 2L0BA 3O70A 4ZUXU 2LGGA 5AITA 2JRJA 5JG6A 3HCUA 2YREA 2CKLA 3IHPA 2YURA 3EB5A 4L7XA 2FUUA 3LRQA 4O64A 4AP4A 2E6SA 4AUQB 4BBQA 1U6GB 2KWJA 2M6MA 4WA6A 1X4JA 2VJFA 4YBMA 1HYJA 2KU3A 3KQIA 4ZQLA 1WEMA 2KGGA 4AYCB 2F6JA 1MM2A 1MM3A 4YC9A 5C11A 2G43A 5B79A 2QICA 5LCWB 2Y1NA 3U5NA 1Z2QA 4YABA 3ZPVE 3U5MA 3N9PA 5B78A 4NN2A 2VJEA 2MUMA 3U5PA 2VPBA 2Y1MA 2EGPA 3ZVZB 5LKZA 2ECWA 2H0DA 4LADB 3LQIA 5B8DA 2M85A 5H1UA 5DINA 2VPDA 2L5UA 3C5KA 2I50A 4MVTA 4W4UA 4I7DA 4A49A 5FEYA 1ZBDB 3PHDA 3T7LA 2JMDA 2YSJA 5H1VA 2YQMA 2L43A 2RI7A 5LKUA 1X4IA 1WFKA 3GL6A 2M3HA 5TABA 4WZ0A 4I7BA 1WEQA 2ECJA 5I3LA 2YYRA 5D1LB 4IC3A 2YT5A 5AIUA 1FBVA 2DX8A 3N9OA 1IYMA 4YADA 2YSMA 3O37A 3HCSA 4YBTA 2NAAA 1JM7B 1WGMA 3O33A 5H9MA 3MHHA 4YAXA 2KIZA 2D8SA 2HYED 4R7EA 4WZ2A 2JMJA 2PNXA 5KH3A 2EA6A 3O7AA 4GNEA 2VPGA 3DQVR 4C9ZA 2F6NA 3N9LA 5D1MB 4A4CA 1JOCA 5C13A 4CA1A 1WEEA 2KR4A 2YQLA 2FSAA 2G6QA 2K17A 3HTKC 5H1TA 2LDRA 2IDAA 2K4DA 3N9MA 3I2DA 4S3OB 4TKPB 2JMIA 1E4UA 3N9QA 4WZ3B 1DVPA 2VP7A 2LV9A 2VPEA 2L80A 4AVXA 1WEPA 3C6WA 2OXQC 4V3LC 2LGLA 3SOUA 3RPGB 4F52B 1VYXA 4A0CD 2EODA 2YHOA 5G0FA 5FB0A 3KNVA 4S3OC 5LKXA 2F42A 4QF3A 2LQ6A 3O36A 4PPEA 4BHWA 4CCGX 2MNZA 3RPGC 3V43A 2G45A 2KFTA 4FJCA 5TDRA 2RSDA 2BAYA 2KWNA 5B75A 4FK5A 5FERA 3NG2A 4MSXA 3M63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KE1 A;  2ZET C;  2L75 A;  1WEO A;  1Z60 A;  2KYU A;  5DKA A;  4FIP A;  2LRI C;  4LLB A;  3O34 A;  2MT5 A;  4UI9 B;  2YW8 A;  2KWO A;  2HDP A;  1LDK C;  1N87 A;  1LDJ B;  2MA5 A;  4X3G A;  1WES A;  2XEU A;  1T1H A;  1BOR A;  1JM7 A;  4LKA A;  3MHS A;  3L1X A;  4GNG A;  2MD8 C;  3RTR B;  1HYI A;  5G04 B;  4YAT A;  2MA6 A;  2YUC A;  5G05 B;  5KH9 A;  3SOX A;  1F62 A;  4QF2 A;  3ZTG A;  3O35 A;  2E6R A;  3HCT A;  1WEV A;  1CHC A;  5KH7 A;  4GND A;  3KV6 A;  4V3K C;  2C2L A;  3ZYQ A;  1WIL A;  2CSY A;  2AN6 A;  3U5O A;  3QZV A;  2QIZ A;  2FUI A;  4B7Y C;  3VK6 A;  2ECG A;  4LK9 A;  2CKL B;  4AYC A;  4UP0 A;  2KWK A;  3PUR A;  4FO9 A;  3GV4 A;  3LQJ A;  4R8P K;  3SOW A;  1WEN A;  3SHB A;  1G25 A;  2K1J A;  2ECI A;  2LGK A;  2MD7 B;  2VJF B;  5TDW A;  3T6R A;  3DPL R;  4R2Y A;  2KGI A;  5D1K B;  5B76 A;  4ZDT A;  2LGV A;  1WIM A;  2UZG A;  1V87 A;  2CT2 A;  2VJE B;  2MIQ A;  3L11 A;  2LN0 A;  2PUY A;  4PTB A;  5TBN A;  2H0D B;  1XWH A;  2C2V S;  1WE9 A;  3FL2 A;  2LXP C;  2MNY A;  4N3W A;  3PUQ A;  4L58 A;  4B86 C;  4LJN A;  4N4F A;  1K2F A;  1RMD A;  2K16 A;  3LQH A;  1X4U A;  3EB6 A;  1FP0 A;  5J3X A;  2M1R A;  2ECN A;  3M99 A;  2KRE A;  5FB1 A;  2QJ0 A;  1VD4 A;  4A4B A;  4IC2 A;  2VNF A;  1VFY A;  3M62 A;  2ECV A;  1WEU A;  2LXH C;  4YBS A;  2YHN A;  3L1Z B;  1WEW A;  2Y43 A;  2CSZ A;  3KV5 A;  4UP5 A;  2ECT A;  3N9N A;  5EYA F;  4P5O B;  2XB1 A;  4GB0 A;  4Q6F A;  4XI1 A;  4GNF A;  5B77 A;  3ZNI A;  4I7C A;  5LKT A;  5TRB A;  2YU4 A;  3ZVY A;  3ASL A;  1Z6U A;  3ZPV 1;  2L0B A;  3O70 A;  4ZUX U;  2LGG A;  5AIT A;  2JRJ A;  5JG6 A;  3HCU A;  2YRE A;  2CKL A;  3IHP A;  2YUR A;  3EB5 A;  4L7X A;  2FUU A;  3LRQ A;  4O64 A;  4AP4 A;  2E6S A;  4AUQ B;  4BBQ A;  1U6G B;  2KWJ A;  2M6M A;  4WA6 A;  1X4J A;  2VJF A;  4YBM A;  1HYJ A;  2KU3 A;  3KQI A;  4ZQL A;  1WEM A;  2KGG A;  4AYC B;  2F6J A;  1MM2 A;  1MM3 A;  4YC9 A;  5C11 A;  2G43 A;  5B79 A;  2QIC A;  5LCW B;  2Y1N A;  3U5N A;  1Z2Q A;  4YAB A;  3ZPV E;  3U5M A;  3N9P A;  5B78 A;  4NN2 A;  2VJE A;  2MUM A;  3U5P A;  2VPB A;  2Y1M A;  2EGP A;  3ZVZ B;  5LKZ A;  2ECW A;  2H0D A;  4LAD B;  3LQI A;  5B8D A;  2M85 A;  5H1U A;  5DIN A;  2VPD A;  2L5U A;  3C5K A;  2I50 A;  4MVT A;  4W4U A;  4I7D A;  4A49 A;  5FEY A;  1ZBD B;  3PHD A;  3T7L A;  2JMD A;  2YSJ A;  5H1V A;  2YQM A;  2L43 A;  2RI7 A;  5LKU A;  1X4I A;  1WFK A;  3GL6 A;  2M3H A;  5TAB A;  4WZ0 A;  4I7B A;  1WEQ A;  2ECJ A;  5I3L A;  2YYR A;  5D1L B;  4IC3 A;  2YT5 A;  5AIU A;  1FBV A;  2DX8 A;  3N9O A;  1IYM A;  4YAD A;  2YSM A;  3O37 A;  3HCS A;  4YBT A;  2NAA A;  1JM7 B;  1WGM A;  3O33 A;  5H9M A;  3MHH A;  4YAX A;  2KIZ A;  2D8S A;  2HYE D;  4R7E A;  4WZ2 A;  2JMJ A;  2PNX A;  5KH3 A;  2EA6 A;  3O7A A;  4GNE A;  2VPG A;  3DQV R;  4C9Z A;  2F6N A;  3N9L A;  5D1M B;  4A4C A;  1JOC A;  5C13 A;  4CA1 A;  1WEE A;  2KR4 A;  2YQL A;  2FSA A;  2G6Q A;  2K17 A;  3HTK C;  5H1T A;  2LDR A;  2IDA A;  2K4D A;  3N9M A;  3I2D A;  4S3O B;  4TKP B;  2JMI A;  1E4U A;  3N9Q A;  4WZ3 B;  1DVP A;  2VP7 A;  2LV9 A;  2VPE A;  2L80 A;  4AVX A;  1WEP A;  3C6W A;  2OXQ C;  4V3L C;  2LGL A;  3SOU A;  3RPG B;  4F52 B;  1VYX A;  4A0C D;  2EOD A;  2YHO A;  5G0F A;  5FB0 A;  3KNV A;  4S3O C;  5LKX A;  2F42 A;  4QF3 A;  2LQ6 A;  3O36 A;  4PPE A;  4BHW A;  4CCG X;  2MNZ A;  3RPG C;  3V43 A;  2G45 A;  2KFT A;  4FJC A;  5TDR A;  2RSD A;  2BAY A;  2KWN A;  5B75 A;  4FK5 A;  5FER A;  3NG2 A;  4MSX A;  3M63 A; 
#chains in the Genus database with same CATH topology
 2KE1 A;  2ZET C;  2L75 A;  1WEO A;  1Z60 A;  2KYU A;  5DKA A;  4FIP A;  2LRI C;  4LLB A;  3O34 A;  2MT5 A;  4UI9 B;  2YW8 A;  2OWA A;  2KWO A;  2HDP A;  1LDK C;  3O47 A;  1N87 A;  1LDJ B;  2MA5 A;  4OGE A;  4X3G A;  1WES A;  2XEU A;  3DWD A;  1T1H A;  4QQ4 A;  4F1P A;  1BOR A;  1JM7 A;  4LKA A;  3MHS A;  3L1X A;  4GNG A;  2MD8 C;  3RTR B;  1HYI A;  5G04 B;  4YAT A;  2MA6 A;  2YUC A;  5G05 B;  5KH9 A;  3SOX A;  1F62 A;  4QF2 A;  2IQJ A;  3ZTG A;  3O35 A;  2E6R A;  3HCT A;  1WEV A;  1CHC A;  5KH7 A;  4GND A;  3KV6 A;  4V3K C;  2C2L A;  3ZYQ A;  3KDE C;  1WIL A;  2CSY A;  2AN6 A;  3U5O A;  3QZV A;  2QIZ A;  2FUI A;  3MDB C;  2XOC A;  2JUN A;  4B7Y C;  3VK6 A;  2ECG A;  4LK9 A;  2CKL B;  4AYC A;  4UP0 A;  3M7K A;  2KWK A;  3PUR A;  4FO9 A;  3GV4 A;  3LQJ A;  4R8P K;  3SOW A;  1WEN A;  3SHB A;  1G25 A;  2K1J A;  2ECI A;  2LGK A;  2MD7 B;  2VJF B;  5TDW A;  3FAO A;  3T6R A;  3DPL R;  5SVI A;  4R2Y A;  2KGI A;  5D1K B;  2FD4 A;  5B76 A;  2DJA A;  3E2D A;  4ZDT A;  2LGV A;  1WIM A;  2UZG A;  1V87 A;  2XP0 A;  2CT2 A;  2RR4 A;  2VJE B;  2MIQ A;  3L11 A;  2LN0 A;  2PUY A;  4PTB A;  5TBN A;  2H0D B;  1XWH A;  2C2V S;  1WE9 A;  3FL2 A;  2LXP C;  2CRW A;  2MNY A;  4N3W A;  2XOZ A;  3PUQ A;  4L58 A;  4B86 C;  4LJN A;  4N4F A;  2EXU A;  1K2F A;  1RMD A;  2K16 A;  3LQH A;  1X4U A;  3EB6 A;  1FP0 A;  5J3X A;  2M1R A;  4O62 A;  2ECN A;  3M99 A;  2KRE A;  5FB1 A;  2QJ0 A;  1VD4 A;  4A4B A;  4IC2 A;  2VNF A;  1VFY A;  3M62 A;  2ECV A;  1WEU A;  2LXH C;  4YBS A;  2YHN A;  3L1Z B;  1WEW A;  2Y43 A;  2CSZ A;  3KV5 A;  4UP5 A;  2ECT A;  3N9N A;  5EYA F;  4P5O B;  2XB1 A;  4GB0 A;  1MBM A;  4Q6F A;  4XI1 A;  4GNF A;  5B77 A;  3ZNI A;  4I7C A;  5LKT A;  5TRB A;  2YU4 A;  3ZVY A;  3ASL A;  1Z6U A;  3ZPV 1;  2L0B A;  3O70 A;  3Q1D A;  2D8U A;  4ZUX U;  2LGG A;  5AIT A;  3H7H A;  2JRJ A;  5JG6 A;  3HCU A;  2YRE A;  2CKL A;  3IHP A;  3JUE A;  2YUR A;  3EB5 A;  4L7X A;  2FUU A;  3LRQ A;  4O64 A;  4AP4 A;  2E6S A;  4AUQ B;  4BBQ A;  1U6G B;  2EGM A;  2KWJ A;  2M6M A;  4WA6 A;  1X4J A;  2VJF A;  4YBM A;  1HYJ A;  2KU3 A;  3PLW A;  3KQI A;  4ZQL A;  2XOY A;  2CON A;  1WEM A;  2KGG A;  4AYC B;  2F6J A;  3SUB A;  1MM2 A;  1MM3 A;  4YC9 A;  5C11 A;  2G43 A;  5B79 A;  2P57 A;  2QIC A;  5LCW B;  2Y1N A;  3U5N A;  1Z2Q A;  4YAB A;  3ZPV E;  3U5M A;  3N9P A;  5B78 A;  4NN2 A;  2VJE A;  2MUM A;  3U5P A;  2VPB A;  2Y1M A;  2EGP A;  3ZVZ B;  5LKZ A;  5SVY A;  2ECW A;  2H0D A;  2CSV A;  4LAD B;  3LQI A;  5B8D A;  2M85 A;  5H1U A;  5DIN A;  2YVR A;  2VPD A;  2L5U A;  3C5K A;  2I50 A;  2L7P A;  4MVT A;  4W4U A;  4I7D A;  4A49 A;  5FEY A;  1ZBD B;  5SVX A;  3PHD A;  3T7L A;  2JMD A;  2YSJ A;  5H1V A;  2YQM A;  2L43 A;  2RI7 A;  5LKU A;  1X4I A;  1WFK A;  3GL6 A;  3FJU B;  2M3H A;  5TAB A;  4WZ0 A;  4I7B A;  1WEQ A;  2ECJ A;  5I3L A;  2YYR A;  5D1L B;  4IC3 A;  2YT5 A;  3FEH A;  4Z0O A;  5AIU A;  1FBV A;  2DX8 A;  2LAU A;  3DDT A;  3N9O A;  1IYM A;  4YAD A;  2M13 A;  2YSM A;  3LVR E;  3O37 A;  3HCS A;  4Z0R A;  4YBT A;  2NAA A;  1JM7 B;  4OGC A;  1WGM A;  3FM8 C;  3O33 A;  5H9M A;  3MHH A;  4YAX A;  2KIZ A;  2D8S A;  2HYE D;  4R7E A;  4WZ2 A;  2JMJ A;  2PNX A;  4H9D A;  5KH3 A;  2EA6 A;  3O7A A;  4GNE A;  3LVQ E;  2VPG A;  3DQV R;  4C9Z A;  2F6N A;  3N9L A;  5D1M B;  1DCQ A;  4A4C A;  1JOC A;  5C13 A;  4CA1 A;  1WEE A;  2KR4 A;  2YQL A;  2FSA A;  2G6Q A;  2K17 A;  3HTK C;  3LJU X;  5H1T A;  2LDR A;  2IDA A;  2K4D A;  3N9M A;  3I2D A;  4S3O B;  4TKP B;  2JMI A;  1E4U A;  3N9Q A;  4WZ3 B;  1DVP A;  2VP7 A;  2E61 A;  2LV9 A;  2VPE A;  2L80 A;  4AVX A;  3LDY A;  2DSM A;  1WEP A;  2KKY A;  2MKE A;  2OXQ C;  3C6W A;  4V3L C;  5K3Q A;  2LGL A;  3RPG B;  3SOU A;  4F52 B;  1VYX A;  4A0C D;  2EOD A;  2YHO A;  5G0F A;  5FB0 A;  3KNV A;  4S3O C;  5LKX A;  2F42 A;  2FFW A;  4QF3 A;  2LQ6 A;  5SVI B;  3O36 A;  2KKX A;  3T9K A;  4PPE A;  4BHW A;  2B0O E;  4CCG X;  2MNZ A;  3RPG C;  3V43 A;  2G45 A;  3FAN A;  2KFT A;  4FJC A;  5TDR A;  2RSD A;  2JM3 A;  2BAY A;  2KWN A;  5B75 A;  4FK5 A;  5FER A;  3NG2 A;  4MSX A;  3M63 A;  2CRR A; 
#chains in the Genus database with same CATH homology
 2KE1 A;  2ZET C;  2L75 A;  1WEO A;  1Z60 A;  2KYU A;  5DKA A;  4FIP A;  2LRI C;  4LLB A;  3O34 A;  2MT5 A;  4UI9 B;  2YW8 A;  2KWO A;  2HDP A;  1LDK C;  1N87 A;  1LDJ B;  2MA5 A;  4X3G A;  1WES A;  2XEU A;  1T1H A;  1BOR A;  1JM7 A;  4LKA A;  3MHS A;  3L1X A;  4GNG A;  2MD8 C;  3RTR B;  1HYI A;  5G04 B;  4YAT A;  2MA6 A;  2YUC A;  5G05 B;  5KH9 A;  3SOX A;  1F62 A;  4QF2 A;  3ZTG A;  3O35 A;  2E6R A;  3HCT A;  1WEV A;  1CHC A;  5KH7 A;  4GND A;  3KV6 A;  4V3K C;  2C2L A;  3ZYQ A;  1WIL A;  2CSY A;  2AN6 A;  3U5O A;  3QZV A;  2QIZ A;  2FUI A;  4B7Y C;  3VK6 A;  2ECG A;  4LK9 A;  2CKL B;  4AYC A;  4UP0 A;  2KWK A;  3PUR A;  4FO9 A;  3GV4 A;  3LQJ A;  4R8P K;  3SOW A;  1WEN A;  3SHB A;  1G25 A;  2K1J A;  2ECI A;  2LGK A;  2MD7 B;  2VJF B;  5TDW A;  3T6R A;  3DPL R;  4R2Y A;  2KGI A;  5D1K B;  5B76 A;  4ZDT A;  2LGV A;  1WIM A;  2UZG A;  1V87 A;  2CT2 A;  2VJE B;  2MIQ A;  3L11 A;  2LN0 A;  2PUY A;  4PTB A;  5TBN A;  2H0D B;  1XWH A;  2C2V S;  1WE9 A;  3FL2 A;  2LXP C;  2MNY A;  4N3W A;  3PUQ A;  4L58 A;  4B86 C;  4LJN A;  4N4F A;  1K2F A;  1RMD A;  2K16 A;  3LQH A;  1X4U A;  3EB6 A;  1FP0 A;  5J3X A;  2M1R A;  2ECN A;  3M99 A;  2KRE A;  5FB1 A;  2QJ0 A;  1VD4 A;  4A4B A;  4IC2 A;  2VNF A;  1VFY A;  3M62 A;  2ECV A;  1WEU A;  2LXH C;  4YBS A;  2YHN A;  3L1Z B;  1WEW A;  2Y43 A;  2CSZ A;  3KV5 A;  4UP5 A;  2ECT A;  3N9N A;  5EYA F;  4P5O B;  2XB1 A;  4GB0 A;  4Q6F A;  4XI1 A;  4GNF A;  5B77 A;  3ZNI A;  4I7C A;  5LKT A;  5TRB A;  2YU4 A;  3ZVY A;  3ASL A;  1Z6U A;  3ZPV 1;  2L0B A;  3O70 A;  4ZUX U;  2LGG A;  5AIT A;  2JRJ A;  5JG6 A;  3HCU A;  2YRE A;  2CKL A;  3IHP A;  2YUR A;  3EB5 A;  4L7X A;  2FUU A;  3LRQ A;  4O64 A;  4AP4 A;  2E6S A;  4AUQ B;  4BBQ A;  1U6G B;  2KWJ A;  2M6M A;  4WA6 A;  1X4J A;  2VJF A;  4YBM A;  1HYJ A;  2KU3 A;  3KQI A;  4ZQL A;  1WEM A;  2KGG A;  4AYC B;  2F6J A;  1MM2 A;  1MM3 A;  4YC9 A;  5C11 A;  2G43 A;  5B79 A;  2QIC A;  5LCW B;  2Y1N A;  3U5N A;  1Z2Q A;  4YAB A;  3ZPV E;  3U5M A;  3N9P A;  5B78 A;  4NN2 A;  2VJE A;  2MUM A;  3U5P A;  2VPB A;  2Y1M A;  2EGP A;  3ZVZ B;  5LKZ A;  2ECW A;  2H0D A;  4LAD B;  3LQI A;  5B8D A;  2M85 A;  5H1U A;  5DIN A;  2VPD A;  2L5U A;  3C5K A;  2I50 A;  4MVT A;  4W4U A;  4I7D A;  4A49 A;  5FEY A;  1ZBD B;  3PHD A;  3T7L A;  2JMD A;  2YSJ A;  5H1V A;  2YQM A;  2L43 A;  2RI7 A;  5LKU A;  1X4I A;  1WFK A;  3GL6 A;  2M3H A;  5TAB A;  4WZ0 A;  4I7B A;  1WEQ A;  2ECJ A;  5I3L A;  2YYR A;  5D1L B;  4IC3 A;  2YT5 A;  5AIU A;  1FBV A;  2DX8 A;  3N9O A;  1IYM A;  4YAD A;  2YSM A;  3O37 A;  3HCS A;  4YBT A;  2NAA A;  1JM7 B;  1WGM A;  3O33 A;  5H9M A;  3MHH A;  4YAX A;  2KIZ A;  2D8S A;  2HYE D;  4R7E A;  4WZ2 A;  2JMJ A;  2PNX A;  5KH3 A;  2EA6 A;  3O7A A;  4GNE A;  2VPG A;  3DQV R;  4C9Z A;  2F6N A;  3N9L A;  5D1M B;  4A4C A;  1JOC A;  5C13 A;  4CA1 A;  1WEE A;  2KR4 A;  2YQL A;  2FSA A;  2G6Q A;  2K17 A;  3HTK C;  5H1T A;  2LDR A;  2IDA A;  2K4D A;  3N9M A;  3I2D A;  4S3O B;  4TKP B;  2JMI A;  1E4U A;  3N9Q A;  4WZ3 B;  1DVP A;  2VP7 A;  2LV9 A;  2VPE A;  2L80 A;  4AVX A;  1WEP A;  3C6W A;  2OXQ C;  4V3L C;  2LGL A;  3SOU A;  3RPG B;  4F52 B;  1VYX A;  4A0C D;  2EOD A;  2YHO A;  5G0F A;  5FB0 A;  3KNV A;  4S3O C;  5LKX A;  2F42 A;  4QF3 A;  2LQ6 A;  3O36 A;  4PPE A;  4BHW A;  4CCG X;  2MNZ A;  3RPG C;  3V43 A;  2G45 A;  2KFT A;  4FJC A;  5TDR A;  2RSD A;  2BAY A;  2KWN A;  5B75 A;  4FK5 A;  5FER A;  3NG2 A;  4MSX A;  3M63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...