1WFKA

Fyve domain of fyve domain containing 19 protein from mus musculus
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
GSSGSSGMESRCYGCAVKFTLFKKEYGCKNCGRAFCNGCLSFSALVPRAGNTQQKVCKQCHTILTRGSSDNASKWSPPQNYKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords zinc finger, FYVE domain containing 19
publication title FYVE domain of FYVE domain containing 19 protein from Mus musculus
rcsb
source organism Mus musculus
molecule tags Unknown function
total genus 7
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1wfkA01
2VNFA 2NAAA 2F42A 3O37A 3U5OA 2MNZA 2KWJA 2D8SA 2LXPC 2K17A 2PNXA 5AIUA 4R2YA 3V43A 1E4UA 3HTKC 4NN2A 5D1KB 2FUUA 1U6GB 3ZNIA 1X4IA 5C11A 3L11A 1WENA 4GNFA 2CKLB 3DQVR 3HCUA 5KH9A 1WE9A 2YSJA 5AITA 4YBMA 5H1VA 2AN6A 5B79A 1JOCA 2YYRA 4LADB 5H1UA 2MA6A 4ZDTA 2ECNA 2EA6A 4B86C 3RPGC 1BORA 2I50A 1FBVA 3ZTGA 4FK5A 4YATA 1X4JA 1HYIA 5B75A 4AYCA 4AVXA 2EGPA 3I2DA 2L0BA 2KYUA 1XWHA 4GNEA 2KGIA 3MHHA 3O33A 1IYMA 4C9ZA 1WIMA 1X4UA 5G0FA 2H0DA 3C6WA 5FERA 1ZBDB 3N9PA 2K1JA 3KQIA 4I7CA 5TDWA 2JRJA 2MIQA 1FP0A 2JMDA 3IHPA 3PHDA 4O64A 4YAXA 2VJFA 2LGGA 2ECGA 2L5UA 2L75A 1VFYA 4L58A 2XEUA 2CSZA 1WEPA 4ZUXU 2YURA 2KREA 2VPDA 4Q6FA 2MA5A 2OXQC 3NG2A 3L1ZB 5B76A 2LRIC 1WEQA 2VPBA 1WEVA 2ZETC 4AYCB 3DPLR 5TRBA 2M85A 4P5OB 5B78A 2MD8C 4UI9B 5H9MA 2QIZA 2H0DB 3VK6A 5G05B 3QZVA 1LDKC 5FEYA 4PTBA 4IC3A 5LKUA 2G45A 2L43A 2MT5A 2VJFB 1CHCA 5FB0A 2LGLA 2VJEB 2C2LA 4R7EA 5TABA 4B7YC 3U5PA 2ECIA 1MM2A 1Z2QA 5D1MB 2L80A 3SOUA 3N9NA 2ECTA 3M99A 4CCGX 4YBSA 5TBNA 4A4CA 3N9LA 5B8DA 4YC9A 3EB5A 2F6NA 4BHWA 3SOXA 2M1RA 3ZVYA 2ECWA 2M6MA 3ZPVE 3C5KA 4X3GA 2MD7B 2KIZA 3PURA 3LQJA 2ECVA 2C2VS 3N9MA 3O36A 1DVPA 2Y1MA 4MVTA 4N4FA 2KWKA 5EYAF 4AP4A 3LRQA 4UP5A 3T7LA 3HCTA 1WEUA 2LGKA 4R8PK 2RSDA 5J3XA 4LK9A 4S3OC 1WFKA 1LDJB 2JMIA 1V87A 5H1TA 1VD4A 2FSAA 2DX8A 3N9QA 2UZGA 2G6QA 4WZ2A 5JG6A 2CKLA 4XI1A 5B77A 2IDAA 4LLBA 3SHBA 2ECJA 4A4BA 4YABA 4TKPB 1WEOA 3RPGB 1HYJA 5KH7A 4BBQA 2LDRA 4IC2A 2YT5A 3M62A 2KE1A 1WEWA 4FO9A 3HCSA 3FL2A 5LKXA 3EB6A 4I7DA 3RTRB 3N9OA 1N87A 5FB1A 3GL6A 3PUQA 2LQ6A 2KWOA 3KV5A 4PPEA 3M63A 4FIPA 2VPGA 2VP7A 5LKTA 1Z6UA 2KU3A 4GNDA 2EODA 3ZVZB 5I3LA 3GV4A 4QF2A 4S3OB 2KWNA 2HYED 4GB0A 3KNVA 2Y1NA 4LJNA 2YREA 3SOWA 4MSXA 2MUMA 5D1LB 2KR4A 4W4UA 2LXHC 4FJCA 1F62A 2E6SA 2QJ0A 3O34A 4L7XA 2G43A 4V3KC 2YHNA 4YBTA 1Z60A 4WZ0A 4QF3A 4ZQLA 2MNYA 3O7AA 2JMJA 3O70A 1JM7A 4N3WA 2YQLA 3LQIA 2FUIA 1WGMA 2F6JA 3LQHA 5C13A 4F52B 5LKZA 1MM3A 1WESA 4A0CD 4GNGA 1WEMA 5G04B 2YW8A 3ZPV1 3ZYQA 2YSMA 5KH3A 3U5NA 2YUCA 1RMDA 3O35A 5TDRA 3ASLA 4I7BA 3L1XA 2M3HA 4CA1A 4A49A 2YHOA 4V3LC 2K16A 2YU4A 2XB1A 2RI7A 4WA6A 5DKAA 2KFTA 2LV9A 1JM7B 4LKAA 4WZ3B 3U5MA 3MHSA 1T1HA 2K4DA 1WILA 2VJEA 4AUQB 2LN0A 2CSYA 4UP0A 2E6RA 1K2FA 2LGVA 3KV6A 2VPEA 2CT2A 1G25A 2Y43A 1VYXA 2BAYA 2HDPA 2QICA 2YQMA 5DINA 5LCWB 2PUYA 1WEEA 2KGGA 4YADA 3T6RA
chains in the Genus database with same CATH superfamily
2VNFA 4OGEA 2NAAA 2F42A 3O37A 4OGCA 3U5OA 2MNZA 2KWJA 2D8SA 2LXPC 2FD4A 2K17A 2PNXA 5AIUA 2CRWA 5SVIA 4R2YA 3V43A 1E4UA 1DCQA 3HTKC 4NN2A 5D1KB 2FUUA 1U6GB 3ZNIA 1X4IA 5C11A 3L11A 1WENA 4GNFA 2CKLB 3DQVR 3HCUA 5KH9A 1WE9A 2YSJA 5AITA 4YBMA 5H1VA 2AN6A 5B79A 3LVQE 2M13A 1JOCA 2XOCA 2YYRA 3FJUB 4LADB 5H1UA 3FAOA 2MA6A 3FM8C 4ZDTA 2ECNA 2EA6A 4B86C 3LVRE 3RPGC 5SVIB 1BORA 2I50A 1FBVA 3ZTGA 4FK5A 4YATA 1X4JA 2XOYA 1HYIA 5B75A 4AYCA 4AVXA 2EGPA 3I2DA 2L0BA 2KYUA 1XWHA 4GNEA 2EGMA 2KGIA 3MHHA 3O33A 1IYMA 4C9ZA 1WIMA 3T9KA 3PLWA 1X4UA 5G0FA 2H0DA 3LJUX 3C6WA 5FERA 1ZBDB 3N9PA 2K1JA 3KQIA 4I7CA 5TDWA 2JRJA 2MIQA 3LDYA 1FP0A 2JMDA 3IHPA 3PHDA 4O64A 4YAXA 2VJFA 2LGGA 2ECGA 2L5UA 2L75A 1VFYA 2DJAA 4L58A 2XEUA 5K3QA 2CSZA 1WEPA 4ZUXU 2YURA 2KREA 2VPDA 3FEHA 4Q6FA 2MA5A 2OXQC 3NG2A 3L1ZB 2EXUA 5B76A 2LRIC 1WEQA 2VPBA 3Q1DA 1WEVA 2ZETC 4AYCB 3DPLR 5TRBA 2CSVA 2M85A 4P5OB 1MBMA 5B78A 2MD8C 4UI9B 5H9MA 2QIZA 2H0DB 2XP0A 3VK6A 5G05B 3JUEA 3QZVA 1LDKC 5FEYA 4PTBA 4IC3A 5LKUA 2IQJA 2G45A 2L43A 2KKYA 2MT5A 2VJFB 1CHCA 5FB0A 2LGLA 2VJEB 4F1PA 2C2LA 4R7EA 5TABA 4B7YC 2DSMA 3U5PA 2ECIA 1MM2A 2B0OE 1Z2QA 5D1MB 2CRRA 3MDBC 2L80A 3SOUA 3N9NA 2ECTA 3M99A 4CCGX 4YBSA 5TBNA 4A4CA 3N9LA 5B8DA 4YC9A 3EB5A 4Z0RA 2LAUA 3E2DA 2F6NA 4BHWA 3SOXA 2M1RA 3ZVYA 2ECWA 2M6MA 3ZPVE 3C5KA 4X3GA 2MD7B 2KIZA 3PURA 3SUBA 2P57A 3LQJA 2ECVA 2C2VS 3N9MA 3O36A 1DVPA 2Y1MA 2YVRA 4MVTA 4N4FA 2XOZA 2KWKA 5EYAF 4AP4A 3LRQA 4UP5A 3T7LA 3HCTA 1WEUA 2E61A 2LGKA 4R8PK 2RSDA 5J3XA 4LK9A 4S3OC 1WFKA 1LDJB 2JMIA 1V87A 2D8UA 5H1TA 1VD4A 2FSAA 2DX8A 3N9QA 3KDEC 2UZGA 2G6QA 4WZ2A 4O62A 5JG6A 2CKLA 4XI1A 5B77A 2IDAA 4LLBA 3SHBA 2ECJA 4A4BA 4YABA 4Z0OA 4TKPB 1WEOA 3RPGB 1HYJA 5KH7A 5SVXA 4BBQA 2LDRA 2OWAA 4IC2A 3M7KA 2YT5A 3M62A 2KE1A 1WEWA 2KKXA 4FO9A 3HCSA 3H7HA 3FL2A 5LKXA 3EB6A 4I7DA 3RTRB 3N9OA 2JM3A 1N87A 5FB1A 3GL6A 3PUQA 2LQ6A 2KWOA 3KV5A 4PPEA 3M63A 4FIPA 2VPGA 2VP7A 5LKTA 1Z6UA 2KU3A 4GNDA 2EODA 3ZVZB 5I3LA 3GV4A 4QF2A 4S3OB 2KWNA 2HYED 4GB0A 3KNVA 2Y1NA 4LJNA 2YREA 3SOWA 4MSXA 2MUMA 5D1LB 2KR4A 4W4UA 2LXHC 4FJCA 1F62A 2MKEA 2E6SA 2QJ0A 3O34A 4L7XA 2G43A 4V3KC 2YHNA 4YBTA 1Z60A 4WZ0A 4QF3A 4ZQLA 2MNYA 3O7AA 2JMJA 3O70A 1JM7A 4N3WA 2YQLA 3LQIA 2JUNA 2FUIA 5SVYA 1WGMA 2F6JA 3LQHA 5C13A 4F52B 5LKZA 1MM3A 1WESA 4A0CD 4GNGA 1WEMA 5G04B 4QQ4A 2L7PA 2YW8A 3ZPV1 3ZYQA 3DDTA 2YSMA 5KH3A 3U5NA 2YUCA 4H9DA 1RMDA 3O35A 5TDRA 3ASLA 4I7BA 3L1XA 2M3HA 4CA1A 4A49A 2YHOA 4V3LC 2K16A 2YU4A 2XB1A 2CONA 2RI7A 4WA6A 3FANA 5DKAA 2KFTA 2LV9A 1JM7B 2FFWA 4LKAA 4WZ3B 3U5MA 3MHSA 1T1HA 2K4DA 1WILA 2VJEA 4AUQB 2LN0A 2CSYA 3DWDA 4UP0A 2E6RA 1K2FA 2LGVA 3KV6A 2VPEA 2CT2A 1G25A 2RR4A 2Y43A 1VYXA 2BAYA 2HDPA 2QICA 2YQMA 5DINA 5LCWB 2PUYA 1WEEA 3O47A 2KGGA 4YADA 3T6RA
chains in the Genus database with same CATH topology
2VNFA 2NAAA 2F42A 3O37A 3U5OA 2MNZA 2KWJA 2D8SA 2LXPC 2K17A 2PNXA 5AIUA 4R2YA 3V43A 1E4UA 3HTKC 4NN2A 5D1KB 2FUUA 1U6GB 3ZNIA 1X4IA 5C11A 3L11A 1WENA 4GNFA 2CKLB 3DQVR 3HCUA 5KH9A 1WE9A 2YSJA 5AITA 4YBMA 5H1VA 2AN6A 5B79A 1JOCA 2YYRA 4LADB 5H1UA 2MA6A 4ZDTA 2ECNA 2EA6A 4B86C 3RPGC 1BORA 2I50A 1FBVA 3ZTGA 4FK5A 4YATA 1X4JA 1HYIA 5B75A 4AYCA 4AVXA 2EGPA 3I2DA 2L0BA 2KYUA 1XWHA 4GNEA 2KGIA 3MHHA 3O33A 1IYMA 4C9ZA 1WIMA 1X4UA 5G0FA 2H0DA 3C6WA 5FERA 1ZBDB 3N9PA 2K1JA 3KQIA 4I7CA 5TDWA 2JRJA 2MIQA 1FP0A 2JMDA 3IHPA 3PHDA 4O64A 4YAXA 2VJFA 2LGGA 2ECGA 2L5UA 2L75A 1VFYA 4L58A 2XEUA 2CSZA 1WEPA 4ZUXU 2YURA 2KREA 2VPDA 4Q6FA 2MA5A 2OXQC 3NG2A 3L1ZB 5B76A 2LRIC 1WEQA 2VPBA 1WEVA 2ZETC 4AYCB 3DPLR 5TRBA 2M85A 4P5OB 5B78A 2MD8C 4UI9B 5H9MA 2QIZA 2H0DB 3VK6A 5G05B 3QZVA 1LDKC 5FEYA 4PTBA 4IC3A 5LKUA 2G45A 2L43A 2MT5A 2VJFB 1CHCA 5FB0A 2LGLA 2VJEB 2C2LA 4R7EA 5TABA 4B7YC 3U5PA 2ECIA 1MM2A 1Z2QA 5D1MB 2L80A 3SOUA 3N9NA 2ECTA 3M99A 4CCGX 4YBSA 5TBNA 4A4CA 3N9LA 5B8DA 4YC9A 3EB5A 2F6NA 4BHWA 3SOXA 2M1RA 3ZVYA 2ECWA 2M6MA 3ZPVE 3C5KA 4X3GA 2MD7B 2KIZA 3PURA 3LQJA 2ECVA 2C2VS 3N9MA 3O36A 1DVPA 2Y1MA 4MVTA 4N4FA 2KWKA 5EYAF 4AP4A 3LRQA 4UP5A 3T7LA 3HCTA 1WEUA 2LGKA 4R8PK 2RSDA 5J3XA 4LK9A 4S3OC 1WFKA 1LDJB 2JMIA 1V87A 5H1TA 1VD4A 2FSAA 2DX8A 3N9QA 2UZGA 2G6QA 4WZ2A 5JG6A 2CKLA 4XI1A 5B77A 2IDAA 4LLBA 3SHBA 2ECJA 4A4BA 4YABA 4TKPB 1WEOA 3RPGB 1HYJA 5KH7A 4BBQA 2LDRA 4IC2A 2YT5A 3M62A 2KE1A 1WEWA 4FO9A 3HCSA 3FL2A 5LKXA 3EB6A 4I7DA 3RTRB 3N9OA 1N87A 5FB1A 3GL6A 3PUQA 2LQ6A 2KWOA 3KV5A 4PPEA 3M63A 4FIPA 2VPGA 2VP7A 5LKTA 1Z6UA 2KU3A 4GNDA 2EODA 3ZVZB 5I3LA 3GV4A 4QF2A 4S3OB 2KWNA 2HYED 4GB0A 3KNVA 2Y1NA 4LJNA 2YREA 3SOWA 4MSXA 2MUMA 5D1LB 2KR4A 4W4UA 2LXHC 4FJCA 1F62A 2E6SA 2QJ0A 3O34A 4L7XA 2G43A 4V3KC 2YHNA 4YBTA 1Z60A 4WZ0A 4QF3A 4ZQLA 2MNYA 3O7AA 2JMJA 3O70A 1JM7A 4N3WA 2YQLA 3LQIA 2FUIA 1WGMA 2F6JA 3LQHA 5C13A 4F52B 5LKZA 1MM3A 1WESA 4A0CD 4GNGA 1WEMA 5G04B 2YW8A 3ZPV1 3ZYQA 2YSMA 5KH3A 3U5NA 2YUCA 1RMDA 3O35A 5TDRA 3ASLA 4I7BA 3L1XA 2M3HA 4CA1A 4A49A 2YHOA 4V3LC 2K16A 2YU4A 2XB1A 2RI7A 4WA6A 5DKAA 2KFTA 2LV9A 1JM7B 4LKAA 4WZ3B 3U5MA 3MHSA 1T1HA 2K4DA 1WILA 2VJEA 4AUQB 2LN0A 2CSYA 4UP0A 2E6RA 1K2FA 2LGVA 3KV6A 2VPEA 2CT2A 1G25A 2Y43A 1VYXA 2BAYA 2HDPA 2QICA 2YQMA 5DINA 5LCWB 2PUYA 1WEEA 2KGGA 4YADA 3T6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VNF A;  2NAA A;  2F42 A;  3O37 A;  3U5O A;  2MNZ A;  2KWJ A;  2D8S A;  2LXP C;  2K17 A;  2PNX A;  5AIU A;  4R2Y A;  3V43 A;  1E4U A;  3HTK C;  4NN2 A;  5D1K B;  2FUU A;  1U6G B;  3ZNI A;  1X4I A;  5C11 A;  3L11 A;  1WEN A;  4GNF A;  2CKL B;  3DQV R;  3HCU A;  5KH9 A;  1WE9 A;  2YSJ A;  5AIT A;  4YBM A;  5H1V A;  2AN6 A;  5B79 A;  1JOC A;  2YYR A;  4LAD B;  5H1U A;  2MA6 A;  4ZDT A;  2ECN A;  2EA6 A;  4B86 C;  3RPG C;  1BOR A;  2I50 A;  1FBV A;  3ZTG A;  4FK5 A;  4YAT A;  1X4J A;  1HYI A;  5B75 A;  4AYC A;  4AVX A;  2EGP A;  3I2D A;  2L0B A;  2KYU A;  1XWH A;  4GNE A;  2KGI A;  3MHH A;  3O33 A;  1IYM A;  4C9Z A;  1WIM A;  1X4U A;  5G0F A;  2H0D A;  3C6W A;  5FER A;  1ZBD B;  3N9P A;  2K1J A;  3KQI A;  4I7C A;  5TDW A;  2JRJ A;  2MIQ A;  1FP0 A;  2JMD A;  3IHP A;  3PHD A;  4O64 A;  4YAX A;  2VJF A;  2LGG A;  2ECG A;  2L5U A;  2L75 A;  1VFY A;  4L58 A;  2XEU A;  2CSZ A;  1WEP A;  4ZUX U;  2YUR A;  2KRE A;  2VPD A;  4Q6F A;  2MA5 A;  2OXQ C;  3NG2 A;  3L1Z B;  5B76 A;  2LRI C;  1WEQ A;  2VPB A;  1WEV A;  2ZET C;  4AYC B;  3DPL R;  5TRB A;  2M85 A;  4P5O B;  5B78 A;  2MD8 C;  4UI9 B;  5H9M A;  2QIZ A;  2H0D B;  3VK6 A;  5G05 B;  3QZV A;  1LDK C;  5FEY A;  4PTB A;  4IC3 A;  5LKU A;  2G45 A;  2L43 A;  2MT5 A;  2VJF B;  1CHC A;  5FB0 A;  2LGL A;  2VJE B;  2C2L A;  4R7E A;  5TAB A;  4B7Y C;  3U5P A;  2ECI A;  1MM2 A;  1Z2Q A;  5D1M B;  2L80 A;  3SOU A;  3N9N A;  2ECT A;  3M99 A;  4CCG X;  4YBS A;  5TBN A;  4A4C A;  3N9L A;  5B8D A;  4YC9 A;  3EB5 A;  2F6N A;  4BHW A;  3SOX A;  2M1R A;  3ZVY A;  2ECW A;  2M6M A;  3ZPV E;  3C5K A;  4X3G A;  2MD7 B;  2KIZ A;  3PUR A;  3LQJ A;  2ECV A;  2C2V S;  3N9M A;  3O36 A;  1DVP A;  2Y1M A;  4MVT A;  4N4F A;  2KWK A;  5EYA F;  4AP4 A;  3LRQ A;  4UP5 A;  3T7L A;  3HCT A;  1WEU A;  2LGK A;  4R8P K;  2RSD A;  5J3X A;  4LK9 A;  4S3O C;  1WFK A;  1LDJ B;  2JMI A;  1V87 A;  5H1T A;  1VD4 A;  2FSA A;  2DX8 A;  3N9Q A;  2UZG A;  2G6Q A;  4WZ2 A;  5JG6 A;  2CKL A;  4XI1 A;  5B77 A;  2IDA A;  4LLB A;  3SHB A;  2ECJ A;  4A4B A;  4YAB A;  4TKP B;  1WEO A;  3RPG B;  1HYJ A;  5KH7 A;  4BBQ A;  2LDR A;  4IC2 A;  2YT5 A;  3M62 A;  2KE1 A;  1WEW A;  4FO9 A;  3HCS A;  3FL2 A;  5LKX A;  3EB6 A;  4I7D A;  3RTR B;  3N9O A;  1N87 A;  5FB1 A;  3GL6 A;  3PUQ A;  2LQ6 A;  2KWO A;  3KV5 A;  4PPE A;  3M63 A;  4FIP A;  2VPG A;  2VP7 A;  5LKT A;  1Z6U A;  2KU3 A;  4GND A;  2EOD A;  3ZVZ B;  5I3L A;  3GV4 A;  4QF2 A;  4S3O B;  2KWN A;  2HYE D;  4GB0 A;  3KNV A;  2Y1N A;  4LJN A;  2YRE A;  3SOW A;  4MSX A;  2MUM A;  5D1L B;  2KR4 A;  4W4U A;  2LXH C;  4FJC A;  1F62 A;  2E6S A;  2QJ0 A;  3O34 A;  4L7X A;  2G43 A;  4V3K C;  2YHN A;  4YBT A;  1Z60 A;  4WZ0 A;  4QF3 A;  4ZQL A;  2MNY A;  3O7A A;  2JMJ A;  3O70 A;  1JM7 A;  4N3W A;  2YQL A;  3LQI A;  2FUI A;  1WGM A;  2F6J A;  3LQH A;  5C13 A;  4F52 B;  5LKZ A;  1MM3 A;  1WES A;  4A0C D;  4GNG A;  1WEM A;  5G04 B;  2YW8 A;  3ZPV 1;  3ZYQ A;  2YSM A;  5KH3 A;  3U5N A;  2YUC A;  1RMD A;  3O35 A;  5TDR A;  3ASL A;  4I7B A;  3L1X A;  2M3H A;  4CA1 A;  4A49 A;  2YHO A;  4V3L C;  2K16 A;  2YU4 A;  2XB1 A;  2RI7 A;  4WA6 A;  5DKA A;  2KFT A;  2LV9 A;  1JM7 B;  4LKA A;  4WZ3 B;  3U5M A;  3MHS A;  1T1H A;  2K4D A;  1WIL A;  2VJE A;  4AUQ B;  2LN0 A;  2CSY A;  4UP0 A;  2E6R A;  1K2F A;  2LGV A;  3KV6 A;  2VPE A;  2CT2 A;  1G25 A;  2Y43 A;  1VYX A;  2BAY A;  2HDP A;  2QIC A;  2YQM A;  5DIN A;  5LCW B;  2PUY A;  1WEE A;  2KGG A;  4YAD A;  3T6R A; 
#chains in the Genus database with same CATH topology
 2VNF A;  4OGE A;  2NAA A;  2F42 A;  3O37 A;  4OGC A;  3U5O A;  2MNZ A;  2KWJ A;  2D8S A;  2LXP C;  2FD4 A;  2K17 A;  2PNX A;  5AIU A;  2CRW A;  5SVI A;  4R2Y A;  3V43 A;  1E4U A;  1DCQ A;  3HTK C;  4NN2 A;  5D1K B;  2FUU A;  1U6G B;  3ZNI A;  1X4I A;  5C11 A;  3L11 A;  1WEN A;  4GNF A;  2CKL B;  3DQV R;  3HCU A;  5KH9 A;  1WE9 A;  2YSJ A;  5AIT A;  4YBM A;  5H1V A;  2AN6 A;  5B79 A;  3LVQ E;  2M13 A;  1JOC A;  2XOC A;  2YYR A;  3FJU B;  4LAD B;  5H1U A;  3FAO A;  2MA6 A;  3FM8 C;  4ZDT A;  2ECN A;  2EA6 A;  4B86 C;  3LVR E;  3RPG C;  5SVI B;  1BOR A;  2I50 A;  1FBV A;  3ZTG A;  4FK5 A;  4YAT A;  1X4J A;  2XOY A;  1HYI A;  5B75 A;  4AYC A;  4AVX A;  2EGP A;  3I2D A;  2L0B A;  2KYU A;  1XWH A;  4GNE A;  2EGM A;  2KGI A;  3MHH A;  3O33 A;  1IYM A;  4C9Z A;  1WIM A;  3T9K A;  3PLW A;  1X4U A;  5G0F A;  2H0D A;  3LJU X;  3C6W A;  5FER A;  1ZBD B;  3N9P A;  2K1J A;  3KQI A;  4I7C A;  5TDW A;  2JRJ A;  2MIQ A;  3LDY A;  1FP0 A;  2JMD A;  3IHP A;  3PHD A;  4O64 A;  4YAX A;  2VJF A;  2LGG A;  2ECG A;  2L5U A;  2L75 A;  1VFY A;  2DJA A;  4L58 A;  2XEU A;  5K3Q A;  2CSZ A;  1WEP A;  4ZUX U;  2YUR A;  2KRE A;  2VPD A;  3FEH A;  4Q6F A;  2MA5 A;  2OXQ C;  3NG2 A;  3L1Z B;  2EXU A;  5B76 A;  2LRI C;  1WEQ A;  2VPB A;  3Q1D A;  1WEV A;  2ZET C;  4AYC B;  3DPL R;  5TRB A;  2CSV A;  2M85 A;  4P5O B;  1MBM A;  5B78 A;  2MD8 C;  4UI9 B;  5H9M A;  2QIZ A;  2H0D B;  2XP0 A;  3VK6 A;  5G05 B;  3JUE A;  3QZV A;  1LDK C;  5FEY A;  4PTB A;  4IC3 A;  5LKU A;  2IQJ A;  2G45 A;  2L43 A;  2KKY A;  2MT5 A;  2VJF B;  1CHC A;  5FB0 A;  2LGL A;  2VJE B;  4F1P A;  2C2L A;  4R7E A;  5TAB A;  4B7Y C;  2DSM A;  3U5P A;  2ECI A;  1MM2 A;  2B0O E;  1Z2Q A;  5D1M B;  2CRR A;  3MDB C;  2L80 A;  3SOU A;  3N9N A;  2ECT A;  3M99 A;  4CCG X;  4YBS A;  5TBN A;  4A4C A;  3N9L A;  5B8D A;  4YC9 A;  3EB5 A;  4Z0R A;  2LAU A;  3E2D A;  2F6N A;  4BHW A;  3SOX A;  2M1R A;  3ZVY A;  2ECW A;  2M6M A;  3ZPV E;  3C5K A;  4X3G A;  2MD7 B;  2KIZ A;  3PUR A;  3SUB A;  2P57 A;  3LQJ A;  2ECV A;  2C2V S;  3N9M A;  3O36 A;  1DVP A;  2Y1M A;  2YVR A;  4MVT A;  4N4F A;  2XOZ A;  2KWK A;  5EYA F;  4AP4 A;  3LRQ A;  4UP5 A;  3T7L A;  3HCT A;  1WEU A;  2E61 A;  2LGK A;  4R8P K;  2RSD A;  5J3X A;  4LK9 A;  4S3O C;  1WFK A;  1LDJ B;  2JMI A;  1V87 A;  2D8U A;  5H1T A;  1VD4 A;  2FSA A;  2DX8 A;  3N9Q A;  3KDE C;  2UZG A;  2G6Q A;  4WZ2 A;  4O62 A;  5JG6 A;  2CKL A;  4XI1 A;  5B77 A;  2IDA A;  4LLB A;  3SHB A;  2ECJ A;  4A4B A;  4YAB A;  4Z0O A;  4TKP B;  1WEO A;  3RPG B;  1HYJ A;  5KH7 A;  5SVX A;  4BBQ A;  2LDR A;  2OWA A;  4IC2 A;  3M7K A;  2YT5 A;  3M62 A;  2KE1 A;  1WEW A;  2KKX A;  4FO9 A;  3HCS A;  3H7H A;  3FL2 A;  5LKX A;  3EB6 A;  4I7D A;  3RTR B;  3N9O A;  2JM3 A;  1N87 A;  5FB1 A;  3GL6 A;  3PUQ A;  2LQ6 A;  2KWO A;  3KV5 A;  4PPE A;  3M63 A;  4FIP A;  2VPG A;  2VP7 A;  5LKT A;  1Z6U A;  2KU3 A;  4GND A;  2EOD A;  3ZVZ B;  5I3L A;  3GV4 A;  4QF2 A;  4S3O B;  2KWN A;  2HYE D;  4GB0 A;  3KNV A;  2Y1N A;  4LJN A;  2YRE A;  3SOW A;  4MSX A;  2MUM A;  5D1L B;  2KR4 A;  4W4U A;  2LXH C;  4FJC A;  1F62 A;  2MKE A;  2E6S A;  2QJ0 A;  3O34 A;  4L7X A;  2G43 A;  4V3K C;  2YHN A;  4YBT A;  1Z60 A;  4WZ0 A;  4QF3 A;  4ZQL A;  2MNY A;  3O7A A;  2JMJ A;  3O70 A;  1JM7 A;  4N3W A;  2YQL A;  3LQI A;  2JUN A;  2FUI A;  5SVY A;  1WGM A;  2F6J A;  3LQH A;  5C13 A;  4F52 B;  5LKZ A;  1MM3 A;  1WES A;  4A0C D;  4GNG A;  1WEM A;  5G04 B;  4QQ4 A;  2L7P A;  2YW8 A;  3ZPV 1;  3ZYQ A;  3DDT A;  2YSM A;  5KH3 A;  3U5N A;  2YUC A;  4H9D A;  1RMD A;  3O35 A;  5TDR A;  3ASL A;  4I7B A;  3L1X A;  2M3H A;  4CA1 A;  4A49 A;  2YHO A;  4V3L C;  2K16 A;  2YU4 A;  2XB1 A;  2CON A;  2RI7 A;  4WA6 A;  3FAN A;  5DKA A;  2KFT A;  2LV9 A;  1JM7 B;  2FFW A;  4LKA A;  4WZ3 B;  3U5M A;  3MHS A;  1T1H A;  2K4D A;  1WIL A;  2VJE A;  4AUQ B;  2LN0 A;  2CSY A;  3DWD A;  4UP0 A;  2E6R A;  1K2F A;  2LGV A;  3KV6 A;  2VPE A;  2CT2 A;  1G25 A;  2RR4 A;  2Y43 A;  1VYX A;  2BAY A;  2HDP A;  2QIC A;  2YQM A;  5DIN A;  5LCW B;  2PUY A;  1WEE A;  3O47 A;  2KGG A;  4YAD A;  3T6R A; 
#chains in the Genus database with same CATH homology
 2VNF A;  2NAA A;  2F42 A;  3O37 A;  3U5O A;  2MNZ A;  2KWJ A;  2D8S A;  2LXP C;  2K17 A;  2PNX A;  5AIU A;  4R2Y A;  3V43 A;  1E4U A;  3HTK C;  4NN2 A;  5D1K B;  2FUU A;  1U6G B;  3ZNI A;  1X4I A;  5C11 A;  3L11 A;  1WEN A;  4GNF A;  2CKL B;  3DQV R;  3HCU A;  5KH9 A;  1WE9 A;  2YSJ A;  5AIT A;  4YBM A;  5H1V A;  2AN6 A;  5B79 A;  1JOC A;  2YYR A;  4LAD B;  5H1U A;  2MA6 A;  4ZDT A;  2ECN A;  2EA6 A;  4B86 C;  3RPG C;  1BOR A;  2I50 A;  1FBV A;  3ZTG A;  4FK5 A;  4YAT A;  1X4J A;  1HYI A;  5B75 A;  4AYC A;  4AVX A;  2EGP A;  3I2D A;  2L0B A;  2KYU A;  1XWH A;  4GNE A;  2KGI A;  3MHH A;  3O33 A;  1IYM A;  4C9Z A;  1WIM A;  1X4U A;  5G0F A;  2H0D A;  3C6W A;  5FER A;  1ZBD B;  3N9P A;  2K1J A;  3KQI A;  4I7C A;  5TDW A;  2JRJ A;  2MIQ A;  1FP0 A;  2JMD A;  3IHP A;  3PHD A;  4O64 A;  4YAX A;  2VJF A;  2LGG A;  2ECG A;  2L5U A;  2L75 A;  1VFY A;  4L58 A;  2XEU A;  2CSZ A;  1WEP A;  4ZUX U;  2YUR A;  2KRE A;  2VPD A;  4Q6F A;  2MA5 A;  2OXQ C;  3NG2 A;  3L1Z B;  5B76 A;  2LRI C;  1WEQ A;  2VPB A;  1WEV A;  2ZET C;  4AYC B;  3DPL R;  5TRB A;  2M85 A;  4P5O B;  5B78 A;  2MD8 C;  4UI9 B;  5H9M A;  2QIZ A;  2H0D B;  3VK6 A;  5G05 B;  3QZV A;  1LDK C;  5FEY A;  4PTB A;  4IC3 A;  5LKU A;  2G45 A;  2L43 A;  2MT5 A;  2VJF B;  1CHC A;  5FB0 A;  2LGL A;  2VJE B;  2C2L A;  4R7E A;  5TAB A;  4B7Y C;  3U5P A;  2ECI A;  1MM2 A;  1Z2Q A;  5D1M B;  2L80 A;  3SOU A;  3N9N A;  2ECT A;  3M99 A;  4CCG X;  4YBS A;  5TBN A;  4A4C A;  3N9L A;  5B8D A;  4YC9 A;  3EB5 A;  2F6N A;  4BHW A;  3SOX A;  2M1R A;  3ZVY A;  2ECW A;  2M6M A;  3ZPV E;  3C5K A;  4X3G A;  2MD7 B;  2KIZ A;  3PUR A;  3LQJ A;  2ECV A;  2C2V S;  3N9M A;  3O36 A;  1DVP A;  2Y1M A;  4MVT A;  4N4F A;  2KWK A;  5EYA F;  4AP4 A;  3LRQ A;  4UP5 A;  3T7L A;  3HCT A;  1WEU A;  2LGK A;  4R8P K;  2RSD A;  5J3X A;  4LK9 A;  4S3O C;  1WFK A;  1LDJ B;  2JMI A;  1V87 A;  5H1T A;  1VD4 A;  2FSA A;  2DX8 A;  3N9Q A;  2UZG A;  2G6Q A;  4WZ2 A;  5JG6 A;  2CKL A;  4XI1 A;  5B77 A;  2IDA A;  4LLB A;  3SHB A;  2ECJ A;  4A4B A;  4YAB A;  4TKP B;  1WEO A;  3RPG B;  1HYJ A;  5KH7 A;  4BBQ A;  2LDR A;  4IC2 A;  2YT5 A;  3M62 A;  2KE1 A;  1WEW A;  4FO9 A;  3HCS A;  3FL2 A;  5LKX A;  3EB6 A;  4I7D A;  3RTR B;  3N9O A;  1N87 A;  5FB1 A;  3GL6 A;  3PUQ A;  2LQ6 A;  2KWO A;  3KV5 A;  4PPE A;  3M63 A;  4FIP A;  2VPG A;  2VP7 A;  5LKT A;  1Z6U A;  2KU3 A;  4GND A;  2EOD A;  3ZVZ B;  5I3L A;  3GV4 A;  4QF2 A;  4S3O B;  2KWN A;  2HYE D;  4GB0 A;  3KNV A;  2Y1N A;  4LJN A;  2YRE A;  3SOW A;  4MSX A;  2MUM A;  5D1L B;  2KR4 A;  4W4U A;  2LXH C;  4FJC A;  1F62 A;  2E6S A;  2QJ0 A;  3O34 A;  4L7X A;  2G43 A;  4V3K C;  2YHN A;  4YBT A;  1Z60 A;  4WZ0 A;  4QF3 A;  4ZQL A;  2MNY A;  3O7A A;  2JMJ A;  3O70 A;  1JM7 A;  4N3W A;  2YQL A;  3LQI A;  2FUI A;  1WGM A;  2F6J A;  3LQH A;  5C13 A;  4F52 B;  5LKZ A;  1MM3 A;  1WES A;  4A0C D;  4GNG A;  1WEM A;  5G04 B;  2YW8 A;  3ZPV 1;  3ZYQ A;  2YSM A;  5KH3 A;  3U5N A;  2YUC A;  1RMD A;  3O35 A;  5TDR A;  3ASL A;  4I7B A;  3L1X A;  2M3H A;  4CA1 A;  4A49 A;  2YHO A;  4V3L C;  2K16 A;  2YU4 A;  2XB1 A;  2RI7 A;  4WA6 A;  5DKA A;  2KFT A;  2LV9 A;  1JM7 B;  4LKA A;  4WZ3 B;  3U5M A;  3MHS A;  1T1H A;  2K4D A;  1WIL A;  2VJE A;  4AUQ B;  2LN0 A;  2CSY A;  4UP0 A;  2E6R A;  1K2F A;  2LGV A;  3KV6 A;  2VPE A;  2CT2 A;  1G25 A;  2Y43 A;  1VYX A;  2BAY A;  2HDP A;  2QIC A;  2YQM A;  5DIN A;  5LCW B;  2PUY A;  1WEE A;  2KGG A;  4YAD A;  3T6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...