2XOZA

C-terminal cysteine rich domain of human chfr bound to amp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
213
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 65
structure length 213
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xozA01
2XOYA 2XP0A 2XOCA 2XOZA
chains in the Genus database with same CATH superfamily
2VJEA 3ZNIA 4B7YC 5TDRA 2PUYA 1F62A 2RR4A 2YHOA 2JMJA 2ECGA 2D8SA 2KYUA 2K1JA 3LJUX 2EA6A 3V43A 3N9LA 5TBNA 5FERA 3N9PA 4BBQA 3C6WA 3O37A 3ZVZB 2RSDA 2VPEA 3E2DA 2QICA 3L1XA 2ECWA 4YC9A 4LLBA 5JG6A 3KQIA 1LDJB 4V3LC 2H0DB 5H9MA 2LV9A 5B78A 3PURA 1X4JA 4QF2A 2KR4A 1WIMA 3DPLR 4FJCA 3LDYA 3LVQE 2YVRA 4MVTA 1HYIA 4R8PK 3N9OA 1MM2A 3C5KA 2YU4A 5TDWA 3M99A 5C13A 2ECVA 2G6QA 2KKXA 3FANA 2EXUA 2CONA 3VK6A 2DSMA 2LGVA 4QF3A 3SOXA 4I7DA 2ECNA 2B0OE 4P5OB 2VNFA 4O64A 4CCGX 2ZETC 2H0DA 4PPEA 1K2FA 2JMDA 2YT5A 2MNZA 2D8UA 5I3LA 2F6NA 4I7CA 2KKYA 2Y43A 3LQHA 2M6MA 4R7EA 3ZPV1 3JUEA 5LKXA 5LCWB 3N9NA 4LK9A 1WGMA 1WE9A 1WENA 4ZUXU 3MHHA 2M1RA 4R2YA 2KWKA 2DJAA 5FB0A 3SOUA 3O35A 1VYXA 5C11A 3MHSA 3U5NA 1WILA 3U5OA 3O36A 2MT5A 2XOYA 2YQLA 2HYED 4X3GA 4S3OB 5K3QA 4YBTA 2M13A 3LRQA 2L0BA 1JM7A 5TABA 2KGIA 2CSVA 2YQMA 3DWDA 2ECIA 4XI1A 5G0FA 5SVYA 3U5PA 2KGGA 4GNGA 4AUQB 3IHPA 2KIZA 2E61A 4UP5A 2FD4A 5FEYA 2DX8A 5DINA 1WEPA 3FAOA 2BAYA 4MSXA 5B77A 3HCSA 4A49A 2XEUA 3M63A 4ZDTA 2LRIC 2K17A 2CSZA 2E6SA 3KNVA 4L58A 2CKLB 3QZVA 2EODA 2P57A 3PHDA 2CSYA 2KWNA 2L7PA 2QJ0A 5B79A 2YREA 4N3WA 5KH3A 2LXPC 3HTKC 1WEUA 4GB0A 4GNDA 3NG2A 4YBMA 2YHNA 2XP0A 2CT2A 4YABA 3DDTA 1XWHA 3M7KA 2YSJA 3L11A 2EGPA 2G43A 2L43A 4LJNA 5DKAA 2M3HA 3ZPVE 2G45A 3U5MA 3HCTA 4A0CD 3SHBA 3FM8C 4Z0RA 2FUIA 5SVIB 1WFKA 5TRBA 2NAAA 5G05B 3T9KA 4NN2A 5B75A 2CKLA 2HDPA 2VP7A 2F42A 5J3XA 2VPBA 4H9DA 2KWJA 5AIUA 3RPGC 2XOCA 1N87A 4GNEA 5B76A 4QQ4A 2C2LA 2VJFB 4YADA 4YBSA 2MIQA 3RPGB 3SOWA 5D1KB 1Z6UA 4IC3A 4AYCB 1X4IA 1BORA 2KE1A 3T6RA 1IYMA 3ASLA 2QIZA 3L1ZB 2LAUA 1MBMA 3T7LA 4FIPA 2LGLA 1Z60A 1DVPA 3N9QA 2YSMA 4L7XA 2YW8A 3I2DA 3LQJA 3EB5A 1WEOA 1FBVA 2KREA 2CRWA 3GV4A 2LGKA 4LADB 2JMIA 1V87A 2VJFA 3KV5A 4UP0A 2XB1A 2MD8C 4TKPB 2VPDA 2I50A 2K16A 2FSAA 4AYCA 4WZ3B 1WEQA 4WA6A 4YAXA 3RTRB 4O62A 5G04B 2F6JA 2L5UA 2EGMA 2LN0A 4WZ0A 1WEMA 3Q1DA 1U6GB 1VFYA 1LDKC 2FUUA 3O70A 5H1TA 2MKEA 2MNYA 1X4UA 3ZTGA 1FP0A 5KH9A 3N9MA 5SVXA 2Y1MA 5H1UA 4FK5A 2JRJA 2YUCA 4UI9B 3LQIA 1Z2QA 2XOZA 3EB6A 4CA1A 2OXQC 3KV6A 2ECJA 4YATA 2KU3A 4OGEA 2OWAA 3KDEC 4WZ2A 4AP4A 4F52B 4BHWA 3O34A 1E4UA 1VD4A 2K4DA 2CRRA 3FEHA 4GNFA 5AITA 2JM3A 4FO9A 2ECTA 5LKUA 1CHCA 2LGGA 3H7HA 2L75A 5EYAF 3FL2A 4F1PA 3O7AA 4I7BA 4N4FA 2VPGA 4A4CA 4V3KC 5D1MB 5D1LB 1MM3A 1WEEA 2KWOA 3SUBA 2IQJA 3ZYQA 2Y1NA 1RMDA 4W4UA 4IC2A 2LQ6A 2PNXA 2L80A 3DQVR 4Z0OA 1WEWA 2VJEB 2YURA 4Q6FA 1JM7B 2MD7B 4AVXA 3HCUA 2FFWA 3PLWA 2KFTA 2MA5A 2JUNA 5SVIA 3GL6A 2C2VS 1DCQA 4C9ZA 2E6RA 2AN6A 5KH7A 5B8DA 3M62A 1G25A 2IDAA 2M85A 4LKAA 4PTBA 3FJUB 4ZQLA 1T1HA 3LVRE 4B86C 1JOCA 5FB1A 3PUQA 2LXHC 5H1VA 2YYRA 5LKTA 1HYJA 5LKZA 3MDBC 4A4BA 4S3OC 3O33A 2MUMA 2RI7A 3ZVYA 3O47A 4OGCA 1ZBDB 1WEVA 2MA6A 2UZGA 1WESA 2LDRA
chains in the Genus database with same CATH topology
3E2DA 2CRRA 2YREA 2D8UA 3FEHA 2EGMA 3SUBA 3FJUB 2CSVA 2DJAA 2JM3A 2RR4A 3LVRE 3T9KA 2IQJA 2KKYA 2XOZA 3Q1DA 3DWDA 2XP0A 2CRWA 2KKXA 5SVYA 3DDTA 3LJUX 2EXUA 3MDBC 4Z0OA 2CONA 3H7HA 3M7KA 2LAUA 2MKEA 4H9DA 2FFWA 3PLWA 5SVIB 2JUNA 4OGEA 5SVIA 2OWAA 3LDYA 3LVQE 3O47A 2XOCA 3JUEA 2YVRA 2E61A 4OGCA 4F1PA 3KDEC 2FD4A 2B0OE 4QQ4A 2XOYA 1DCQA 2P57A 3FM8C 5K3QA 5SVXA 4Z0RA 2M13A 2L7PA 4O62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOY A;  2XP0 A;  2XOC A;  2XOZ A; 
#chains in the Genus database with same CATH topology
 2VJE A;  3ZNI A;  4B7Y C;  5TDR A;  2PUY A;  1F62 A;  2RR4 A;  2YHO A;  2JMJ A;  2ECG A;  2D8S A;  2KYU A;  2K1J A;  3LJU X;  2EA6 A;  3V43 A;  3N9L A;  5TBN A;  5FER A;  3N9P A;  4BBQ A;  3C6W A;  3O37 A;  3ZVZ B;  2RSD A;  2VPE A;  3E2D A;  2QIC A;  3L1X A;  2ECW A;  4YC9 A;  4LLB A;  5JG6 A;  3KQI A;  1LDJ B;  4V3L C;  2H0D B;  5H9M A;  2LV9 A;  5B78 A;  3PUR A;  1X4J A;  4QF2 A;  2KR4 A;  1WIM A;  3DPL R;  4FJC A;  3LDY A;  3LVQ E;  2YVR A;  4MVT A;  1HYI A;  4R8P K;  3N9O A;  1MM2 A;  3C5K A;  2YU4 A;  5TDW A;  3M99 A;  5C13 A;  2ECV A;  2G6Q A;  2KKX A;  3FAN A;  2EXU A;  2CON A;  3VK6 A;  2DSM A;  2LGV A;  4QF3 A;  3SOX A;  4I7D A;  2ECN A;  2B0O E;  4P5O B;  2VNF A;  4O64 A;  4CCG X;  2ZET C;  2H0D A;  4PPE A;  1K2F A;  2JMD A;  2YT5 A;  2MNZ A;  2D8U A;  5I3L A;  2F6N A;  4I7C A;  2KKY A;  2Y43 A;  3LQH A;  2M6M A;  4R7E A;  3ZPV 1;  3JUE A;  5LKX A;  5LCW B;  3N9N A;  4LK9 A;  1WGM A;  1WE9 A;  1WEN A;  4ZUX U;  3MHH A;  2M1R A;  4R2Y A;  2KWK A;  2DJA A;  5FB0 A;  3SOU A;  3O35 A;  1VYX A;  5C11 A;  3MHS A;  3U5N A;  1WIL A;  3U5O A;  3O36 A;  2MT5 A;  2XOY A;  2YQL A;  2HYE D;  4X3G A;  4S3O B;  5K3Q A;  4YBT A;  2M13 A;  3LRQ A;  2L0B A;  1JM7 A;  5TAB A;  2KGI A;  2CSV A;  2YQM A;  3DWD A;  2ECI A;  4XI1 A;  5G0F A;  5SVY A;  3U5P A;  2KGG A;  4GNG A;  4AUQ B;  3IHP A;  2KIZ A;  2E61 A;  4UP5 A;  2FD4 A;  5FEY A;  2DX8 A;  5DIN A;  1WEP A;  3FAO A;  2BAY A;  4MSX A;  5B77 A;  3HCS A;  4A49 A;  2XEU A;  3M63 A;  4ZDT A;  2LRI C;  2K17 A;  2CSZ A;  2E6S A;  3KNV A;  4L58 A;  2CKL B;  3QZV A;  2EOD A;  2P57 A;  3PHD A;  2CSY A;  2KWN A;  2L7P A;  2QJ0 A;  5B79 A;  2YRE A;  4N3W A;  5KH3 A;  2LXP C;  3HTK C;  1WEU A;  4GB0 A;  4GND A;  3NG2 A;  4YBM A;  2YHN A;  2XP0 A;  2CT2 A;  4YAB A;  3DDT A;  1XWH A;  3M7K A;  2YSJ A;  3L11 A;  2EGP A;  2G43 A;  2L43 A;  4LJN A;  5DKA A;  2M3H A;  3ZPV E;  2G45 A;  3U5M A;  3HCT A;  4A0C D;  3SHB A;  3FM8 C;  4Z0R A;  2FUI A;  5SVI B;  1WFK A;  5TRB A;  2NAA A;  5G05 B;  3T9K A;  4NN2 A;  5B75 A;  2CKL A;  2HDP A;  2VP7 A;  2F42 A;  5J3X A;  2VPB A;  4H9D A;  2KWJ A;  5AIU A;  3RPG C;  2XOC A;  1N87 A;  4GNE A;  5B76 A;  4QQ4 A;  2C2L A;  2VJF B;  4YAD A;  4YBS A;  2MIQ A;  3RPG B;  3SOW A;  5D1K B;  1Z6U A;  4IC3 A;  4AYC B;  1X4I A;  1BOR A;  2KE1 A;  3T6R A;  1IYM A;  3ASL A;  2QIZ A;  3L1Z B;  2LAU A;  1MBM A;  3T7L A;  4FIP A;  2LGL A;  1Z60 A;  1DVP A;  3N9Q A;  2YSM A;  4L7X A;  2YW8 A;  3I2D A;  3LQJ A;  3EB5 A;  1WEO A;  1FBV A;  2KRE A;  2CRW A;  3GV4 A;  2LGK A;  4LAD B;  2JMI A;  1V87 A;  2VJF A;  3KV5 A;  4UP0 A;  2XB1 A;  2MD8 C;  4TKP B;  2VPD A;  2I50 A;  2K16 A;  2FSA A;  4AYC A;  4WZ3 B;  1WEQ A;  4WA6 A;  4YAX A;  3RTR B;  4O62 A;  5G04 B;  2F6J A;  2L5U A;  2EGM A;  2LN0 A;  4WZ0 A;  1WEM A;  3Q1D A;  1U6G B;  1VFY A;  1LDK C;  2FUU A;  3O70 A;  5H1T A;  2MKE A;  2MNY A;  1X4U A;  3ZTG A;  1FP0 A;  5KH9 A;  3N9M A;  5SVX A;  2Y1M A;  5H1U A;  4FK5 A;  2JRJ A;  2YUC A;  4UI9 B;  3LQI A;  1Z2Q A;  2XOZ A;  3EB6 A;  4CA1 A;  2OXQ C;  3KV6 A;  2ECJ A;  4YAT A;  2KU3 A;  4OGE A;  2OWA A;  3KDE C;  4WZ2 A;  4AP4 A;  4F52 B;  4BHW A;  3O34 A;  1E4U A;  1VD4 A;  2K4D A;  2CRR A;  3FEH A;  4GNF A;  5AIT A;  2JM3 A;  4FO9 A;  2ECT A;  5LKU A;  1CHC A;  2LGG A;  3H7H A;  2L75 A;  5EYA F;  3FL2 A;  4F1P A;  3O7A A;  4I7B A;  4N4F A;  2VPG A;  4A4C A;  4V3K C;  5D1M B;  5D1L B;  1MM3 A;  1WEE A;  2KWO A;  3SUB A;  2IQJ A;  3ZYQ A;  2Y1N A;  1RMD A;  4W4U A;  4IC2 A;  2LQ6 A;  2PNX A;  2L80 A;  3DQV R;  4Z0O A;  1WEW A;  2VJE B;  2YUR A;  4Q6F A;  1JM7 B;  2MD7 B;  4AVX A;  3HCU A;  2FFW A;  3PLW A;  2KFT A;  2MA5 A;  2JUN A;  5SVI A;  3GL6 A;  2C2V S;  1DCQ A;  4C9Z A;  2E6R A;  2AN6 A;  5KH7 A;  5B8D A;  3M62 A;  1G25 A;  2IDA A;  2M85 A;  4LKA A;  4PTB A;  3FJU B;  4ZQL A;  1T1H A;  3LVR E;  4B86 C;  1JOC A;  5FB1 A;  3PUQ A;  2LXH C;  5H1V A;  2YYR A;  5LKT A;  1HYJ A;  5LKZ A;  3MDB C;  4A4B A;  4S3O C;  3O33 A;  2MUM A;  2RI7 A;  3ZVY A;  3O47 A;  4OGC A;  1ZBD B;  1WEV A;  2MA6 A;  2UZG A;  1WES A;  2LDR A; 
#chains in the Genus database with same CATH homology
 3E2D A;  2CRR A;  2YRE A;  2D8U A;  3FEH A;  2EGM A;  3SUB A;  3FJU B;  2CSV A;  2DJA A;  2JM3 A;  2RR4 A;  3LVR E;  3T9K A;  2IQJ A;  2KKY A;  2XOZ A;  3Q1D A;  3DWD A;  2XP0 A;  2CRW A;  2KKX A;  5SVY A;  3DDT A;  3LJU X;  2EXU A;  3MDB C;  4Z0O A;  2CON A;  3H7H A;  3M7K A;  2LAU A;  2MKE A;  4H9D A;  2FFW A;  3PLW A;  5SVI B;  2JUN A;  4OGE A;  5SVI A;  2OWA A;  3LDY A;  3LVQ E;  3O47 A;  2XOC A;  3JUE A;  2YVR A;  2E61 A;  4OGC A;  4F1P A;  3KDE C;  2FD4 A;  2B0O E;  4QQ4 A;  2XOY A;  1DCQ A;  2P57 A;  3FM8 C;  5K3Q A;  5SVX A;  4Z0R A;  2M13 A;  2L7P A;  4O62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...