2XOZA

C-terminal cysteine rich domain of human chfr bound to amp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
213
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
total genus 65
structure length 213
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xozA01
2XOYA 2XOZA 2XP0A 2XOCA
chains in the Genus database with same CATH superfamily
2EODA 2VPEA 2M85A 2LGKA 2KWNA 2VPGA 3ZPVE 3O37A 4A4CA 3T7LA 1WEVA 2EA6A 5D1MB 2XB1A 3T6RA 4YAXA 1DVPA 1K2FA 2NAAA 2YURA 2MUMA 2CRRA 3RTRB 3LQHA 1X4JA 4LJNA 1FP0A 1T1HA 2M6MA 1MM2A 3O70A 4QF3A 2LGVA 3M99A 4QF2A 5KH9A 5C11A 3ASLA 2MA6A 2VPDA 1WENA 5TDRA 3SHBA 2K4DA 1XWHA 3HCTA 5B8DA 3LVRE 3U5NA 2IDAA 5TABA 2FUIA 2YUCA 2LN0A 3E2DA 3N9MA 4ZDTA 2Y43A 2LGGA 5AITA 3HTKC 2EGMA 2YQMA 2K1JA 3M63A 3U5MA 3L1XA 4AVXA 2FFWA 4Z0RA 2K16A 2CT2A 1Z60A 2Y1MA 4LLBA 2MD8C 3I2DA 2QJ0A 5KH3A 4C9ZA 1MBMA 2YSJA 4A0CD 5EYAF 2RR4A 4ZUXU 4WA6A 4WZ0A 1LDKC 2FSAA 5B78A 2JMDA 3NG2A 2AN6A 2M3HA 4MVTA 3ZPV1 2KU3A 2BAYA 4XI1A 2JMIA 2ECWA 1JM7B 3RPGB 5H9MA 2DX8A 3FM8C 3N9QA 1N87A 2EXUA 2G43A 2MT5A 2QIZA 1E4UA 3ZTGA 1VYXA 3MHHA 2LAUA 5SVIA 4UI9B 3LJUX 4UP0A 4PPEA 2VJFA 2JM3A 3N9PA 2CSVA 5D1LB 3KV6A 2H0DB 4N4FA 2ECTA 3Q1DA 1CHCA 1WEOA 2I50A 2VP7A 5B75A 3KNVA 3LVQE 3GL6A 5G05B 1X4UA 5TRBA 2DJAA 5LKZA 2OWAA 3GV4A 5FB0A 4W4UA 4LKAA 2YW8A 1WILA 3FAOA 2MNYA 3SOUA 1WESA 5LCWB 3O34A 4V3LC 2XEUA 2E6SA 4I7CA 1WEEA 3U5PA 2CKLB 4BHWA 2KIZA 5TDWA 2ZETC 4LK9A 2MIQA 3N9OA 3EB5A 2CKLA 3MDBC 3VK6A 4I7BA 2F42A 1WIMA 4A49A 1F62A 1LDJB 2F6JA 4O64A 3ZVYA 3DDTA 2L43A 4AYCA 3LQJA 2KKYA 4P5OB 1Z6UA 3L11A 3N9LA 5LKUA 4WZ3B 4GNDA 2XOZA 4R8PK 2VJEB 2QICA 2L7PA 4MSXA 3KQIA 4YC9A 1WEMA 3O35A 2RSDA 3ZNIA 4QQ4A 3QZVA 2YYRA 4Z0OA 1IYMA 3L1ZB 4YBSA 1JOCA 3C5KA 2CSYA 3O7AA 2E6RA 4YBTA 5DINA 1MM3A 2C2LA 2Y1NA 3DPLR 1WEWA 2JUNA 2LXPC 2D8UA 3PUQA 2YHNA 1HYIA 2KGIA 3FEHA 2MD7B 3FL2A 1WEQA 3ZVZB 2C2VS 2KWOA 4PTBA 2JRJA 5FB1A 4YATA 5KH7A 4TKPB 1BORA 2YSMA 2IQJA 2HYED 1JM7A 2PNXA 2ECGA 3V43A 2VPBA 5SVXA 1HYJA 2OXQC 2KREA 4IC2A 2B0OE 2KFTA 2L0BA 3IHPA 2L80A 2L75A 4R2YA 5C13A 5D1KB 2G45A 4L7XA 1VD4A 3M7KA 2YQLA 2LGLA 2YREA 3MHSA 4FJCA 5B79A 1VFYA 2FD4A 4H9DA 3H7HA 1DCQA 2P57A 1WEUA 2YVRA 4B7YC 3O47A 3KV5A 1RMDA 4CA1A 5H1TA 2YHOA 2LQ6A 2MKEA 4N3WA 3DWDA 3O33A 2ECVA 4R7EA 2H0DA 1WGMA 4F52B 2KYUA 3SOXA 3FJUB 3FANA 5FERA 2UZGA 2MA5A 2LV9A 2KE1A 4AUQB 2ECNA 4NN2A 5SVYA 2KWKA 2KR4A 1V87A 4IC3A 4GNGA 2G6QA 1WE9A 2LRIC 2KKXA 4OGCA 4I7DA 5AIUA 2M13A 5FEYA 5B77A 4A4BA 5I3LA 3N9NA 3M62A 4O62A 1U6GB 5K3QA 2FUUA 3T9KA 4B86C 4UP5A 4BBQA 5B76A 2XP0A 3O36A 2HDPA 3HCUA 3PURA 4Q6FA 2L5UA 2YU4A 5G0FA 2ECIA 3RPGC 2MNZA 1WFKA 2RI7A 2VJEA 3SOWA 4GNFA 4WZ2A 2LXHC 2JMJA 5DKAA 1FBVA 1ZBDB 4YABA 3ZYQA 2D8SA 2CONA 2E61A 1WEPA 1X4IA 4OGEA 2KWJA 4FK5A 3PLWA 4CCGX 2DSMA 3KDEC 2CRWA 4S3OC 5H1VA 3SUBA 2ECJA 2K17A 4FO9A 4FIPA 4ZQLA 3JUEA 5JG6A 5G04B 2YT5A 3U5OA 3LRQA 3HCSA 4F1PA 2PUYA 1Z2QA 2XOCA 4YADA 4AYCB 3DQVR 2M1RA 3PHDA 5J3XA 2VJFB 1G25A 3LQIA 4YBMA 5SVIB 2VNFA 2KGGA 4V3KC 4LADB 2F6NA 4L58A 2CSZA 4S3OB 5H1UA 3C6WA 2LDRA 2XOYA 4GNEA 3EB6A 2EGPA 5LKXA 4X3GA 4AP4A 5LKTA 4GB0A 5TBNA 3LDYA
chains in the Genus database with same CATH topology
3Q1DA 5SVIB 3O47A 3JUEA 3FM8C 3FJUB 4QQ4A 4O62A 4Z0OA 3LVQE 5K3QA 2CONA 2EXUA 3T9KA 2E61A 2IQJA 3LVRE 4F1PA 2DJAA 2RR4A 4OGEA 2MKEA 2OWAA 2XOYA 2LAUA 3PLWA 5SVIA 2XP0A 2XOCA 3DDTA 3M7KA 3KDEC 3E2DA 5SVYA 5SVXA 2YREA 3DWDA 3LJUX 2CRWA 2CRRA 2KKYA 2FD4A 2JUNA 2EGMA 3H7HA 4H9DA 2JM3A 3SUBA 2D8UA 2KKXA 2B0OE 4OGCA 2CSVA 2FFWA 1DCQA 2M13A 2P57A 2XOZA 3FEHA 2L7PA 2YVRA 3MDBC 4Z0RA 3LDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOY A;  2XOZ A;  2XP0 A;  2XOC A; 
#chains in the Genus database with same CATH topology
 2EOD A;  2VPE A;  2M85 A;  2LGK A;  2KWN A;  2VPG A;  3ZPV E;  3O37 A;  4A4C A;  3T7L A;  1WEV A;  2EA6 A;  5D1M B;  2XB1 A;  3T6R A;  4YAX A;  1DVP A;  1K2F A;  2NAA A;  2YUR A;  2MUM A;  2CRR A;  3RTR B;  3LQH A;  1X4J A;  4LJN A;  1FP0 A;  1T1H A;  2M6M A;  1MM2 A;  3O70 A;  4QF3 A;  2LGV A;  3M99 A;  4QF2 A;  5KH9 A;  5C11 A;  3ASL A;  2MA6 A;  2VPD A;  1WEN A;  5TDR A;  3SHB A;  2K4D A;  1XWH A;  3HCT A;  5B8D A;  3LVR E;  3U5N A;  2IDA A;  5TAB A;  2FUI A;  2YUC A;  2LN0 A;  3E2D A;  3N9M A;  4ZDT A;  2Y43 A;  2LGG A;  5AIT A;  3HTK C;  2EGM A;  2YQM A;  2K1J A;  3M63 A;  3U5M A;  3L1X A;  4AVX A;  2FFW A;  4Z0R A;  2K16 A;  2CT2 A;  1Z60 A;  2Y1M A;  4LLB A;  2MD8 C;  3I2D A;  2QJ0 A;  5KH3 A;  4C9Z A;  1MBM A;  2YSJ A;  4A0C D;  5EYA F;  2RR4 A;  4ZUX U;  4WA6 A;  4WZ0 A;  1LDK C;  2FSA A;  5B78 A;  2JMD A;  3NG2 A;  2AN6 A;  2M3H A;  4MVT A;  3ZPV 1;  2KU3 A;  2BAY A;  4XI1 A;  2JMI A;  2ECW A;  1JM7 B;  3RPG B;  5H9M A;  2DX8 A;  3FM8 C;  3N9Q A;  1N87 A;  2EXU A;  2G43 A;  2MT5 A;  2QIZ A;  1E4U A;  3ZTG A;  1VYX A;  3MHH A;  2LAU A;  5SVI A;  4UI9 B;  3LJU X;  4UP0 A;  4PPE A;  2VJF A;  2JM3 A;  3N9P A;  2CSV A;  5D1L B;  3KV6 A;  2H0D B;  4N4F A;  2ECT A;  3Q1D A;  1CHC A;  1WEO A;  2I50 A;  2VP7 A;  5B75 A;  3KNV A;  3LVQ E;  3GL6 A;  5G05 B;  1X4U A;  5TRB A;  2DJA A;  5LKZ A;  2OWA A;  3GV4 A;  5FB0 A;  4W4U A;  4LKA A;  2YW8 A;  1WIL A;  3FAO A;  2MNY A;  3SOU A;  1WES A;  5LCW B;  3O34 A;  4V3L C;  2XEU A;  2E6S A;  4I7C A;  1WEE A;  3U5P A;  2CKL B;  4BHW A;  2KIZ A;  5TDW A;  2ZET C;  4LK9 A;  2MIQ A;  3N9O A;  3EB5 A;  2CKL A;  3MDB C;  3VK6 A;  4I7B A;  2F42 A;  1WIM A;  4A49 A;  1F62 A;  1LDJ B;  2F6J A;  4O64 A;  3ZVY A;  3DDT A;  2L43 A;  4AYC A;  3LQJ A;  2KKY A;  4P5O B;  1Z6U A;  3L11 A;  3N9L A;  5LKU A;  4WZ3 B;  4GND A;  2XOZ A;  4R8P K;  2VJE B;  2QIC A;  2L7P A;  4MSX A;  3KQI A;  4YC9 A;  1WEM A;  3O35 A;  2RSD A;  3ZNI A;  4QQ4 A;  3QZV A;  2YYR A;  4Z0O A;  1IYM A;  3L1Z B;  4YBS A;  1JOC A;  3C5K A;  2CSY A;  3O7A A;  2E6R A;  4YBT A;  5DIN A;  1MM3 A;  2C2L A;  2Y1N A;  3DPL R;  1WEW A;  2JUN A;  2LXP C;  2D8U A;  3PUQ A;  2YHN A;  1HYI A;  2KGI A;  3FEH A;  2MD7 B;  3FL2 A;  1WEQ A;  3ZVZ B;  2C2V S;  2KWO A;  4PTB A;  2JRJ A;  5FB1 A;  4YAT A;  5KH7 A;  4TKP B;  1BOR A;  2YSM A;  2IQJ A;  2HYE D;  1JM7 A;  2PNX A;  2ECG A;  3V43 A;  2VPB A;  5SVX A;  1HYJ A;  2OXQ C;  2KRE A;  4IC2 A;  2B0O E;  2KFT A;  2L0B A;  3IHP A;  2L80 A;  2L75 A;  4R2Y A;  5C13 A;  5D1K B;  2G45 A;  4L7X A;  1VD4 A;  3M7K A;  2YQL A;  2LGL A;  2YRE A;  3MHS A;  4FJC A;  5B79 A;  1VFY A;  2FD4 A;  4H9D A;  3H7H A;  1DCQ A;  2P57 A;  1WEU A;  2YVR A;  4B7Y C;  3O47 A;  3KV5 A;  1RMD A;  4CA1 A;  5H1T A;  2YHO A;  2LQ6 A;  2MKE A;  4N3W A;  3DWD A;  3O33 A;  2ECV A;  4R7E A;  2H0D A;  1WGM A;  4F52 B;  2KYU A;  3SOX A;  3FJU B;  3FAN A;  5FER A;  2UZG A;  2MA5 A;  2LV9 A;  2KE1 A;  4AUQ B;  2ECN A;  4NN2 A;  5SVY A;  2KWK A;  2KR4 A;  1V87 A;  4IC3 A;  4GNG A;  2G6Q A;  1WE9 A;  2LRI C;  2KKX A;  4OGC A;  4I7D A;  5AIU A;  2M13 A;  5FEY A;  5B77 A;  4A4B A;  5I3L A;  3N9N A;  3M62 A;  4O62 A;  1U6G B;  5K3Q A;  2FUU A;  3T9K A;  4B86 C;  4UP5 A;  4BBQ A;  5B76 A;  2XP0 A;  3O36 A;  2HDP A;  3HCU A;  3PUR A;  4Q6F A;  2L5U A;  2YU4 A;  5G0F A;  2ECI A;  3RPG C;  2MNZ A;  1WFK A;  2RI7 A;  2VJE A;  3SOW A;  4GNF A;  4WZ2 A;  2LXH C;  2JMJ A;  5DKA A;  1FBV A;  1ZBD B;  4YAB A;  3ZYQ A;  2D8S A;  2CON A;  2E61 A;  1WEP A;  1X4I A;  4OGE A;  2KWJ A;  4FK5 A;  3PLW A;  4CCG X;  2DSM A;  3KDE C;  2CRW A;  4S3O C;  5H1V A;  3SUB A;  2ECJ A;  2K17 A;  4FO9 A;  4FIP A;  4ZQL A;  3JUE A;  5JG6 A;  5G04 B;  2YT5 A;  3U5O A;  3LRQ A;  3HCS A;  4F1P A;  2PUY A;  1Z2Q A;  2XOC A;  4YAD A;  4AYC B;  3DQV R;  2M1R A;  3PHD A;  5J3X A;  2VJF B;  1G25 A;  3LQI A;  4YBM A;  5SVI B;  2VNF A;  2KGG A;  4V3K C;  4LAD B;  2F6N A;  4L58 A;  2CSZ A;  4S3O B;  5H1U A;  3C6W A;  2LDR A;  2XOY A;  4GNE A;  3EB6 A;  2EGP A;  5LKX A;  4X3G A;  4AP4 A;  5LKT A;  4GB0 A;  5TBN A;  3LDY A; 
#chains in the Genus database with same CATH homology
 3Q1D A;  5SVI B;  3O47 A;  3JUE A;  3FM8 C;  3FJU B;  4QQ4 A;  4O62 A;  4Z0O A;  3LVQ E;  5K3Q A;  2CON A;  2EXU A;  3T9K A;  2E61 A;  2IQJ A;  3LVR E;  4F1P A;  2DJA A;  2RR4 A;  4OGE A;  2MKE A;  2OWA A;  2XOY A;  2LAU A;  3PLW A;  5SVI A;  2XP0 A;  2XOC A;  3DDT A;  3M7K A;  3KDE C;  3E2D A;  5SVY A;  5SVX A;  2YRE A;  3DWD A;  3LJU X;  2CRW A;  2CRR A;  2KKY A;  2FD4 A;  2JUN A;  2EGM A;  3H7H A;  4H9D A;  2JM3 A;  3SUB A;  2D8U A;  2KKX A;  2B0O E;  4OGC A;  2CSV A;  2FFW A;  1DCQ A;  2M13 A;  2P57 A;  2XOZ A;  3FEH A;  2L7P A;  2YVR A;  3MDB C;  4Z0R A;  3LDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...