2XOZA

C-terminal cysteine rich domain of human chfr bound to amp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
213
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 213
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xozA01
2XP0A 2XOCA 2XOYA 2XOZA
chains in the Genus database with same CATH superfamily
3T9KA 3ZNIA 4B86C 1WESA 4A4CA 4YBMA 2MNZA 5SVXA 3SOUA 2M3HA 4A49A 2LGKA 2MD8C 2OWAA 2ECJA 4GNEA 3M63A 4LKAA 2XOZA 1WEPA 4MVTA 3I2DA 4IC3A 4UP5A 3FL2A 1FP0A 2CRRA 4S3OC 2FUUA 2RR4A 3M62A 2ECNA 2B0OE 5TRBA 2MIQA 3C6WA 4FJCA 1RMDA 4P5OB 2MKEA 2KKXA 3T6RA 2ECWA 2LDRA 5H9MA 1VYXA 1WEEA 3O35A 2LV9A 3U5PA 2RI7A 4YADA 2FUIA 2C2LA 2LXPC 4V3KC 2L75A 5KH7A 4F1PA 5TABA 1WILA 5LCWB 2ECIA 1Z60A 2KWKA 2D8UA 5C11A 3V43A 3NG2A 5TBNA 2RSDA 2QJ0A 2YU4A 2XB1A 2YW8A 3ASLA 3N9MA 5KH3A 2G45A 1HYJA 5FERA 4UP0A 3HCUA 2LRIC 3FANA 1DCQA 1X4IA 1U6GB 2K16A 4R7EA 2PUYA 3HCSA 2XOCA 2XEUA 5AIUA 2FD4A 3RTRB 4WZ3B 1E4UA 4OGEA 4IC2A 3T7LA 4GNFA 3M7KA 4GNDA 2KE1A 4O64A 4W4UA 4C9ZA 1WEVA 2YVRA 3N9NA 4H9DA 1WIMA 2LXHC 2JM3A 3LDYA 3ZVYA 2Y1NA 3FJUB 1WEMA 2UZGA 2D8SA 5FB1A 5G05B 3ZPVE 3ZTGA 2EXUA 3O7AA 4FIPA 3HTKC 2LGVA 4FO9A 2LGLA 4LK9A 3N9LA 4YAXA 3PUQA 4TKPB 4NN2A 1N87A 1MM3A 2CRWA 4AP4A 3Q1DA 3LQJA 4O62A 3L1ZB 2YHOA 2MNYA 3U5OA 2L80A 2KWJA 2ECVA 2KKYA 2EGPA 4YABA 4OGCA 2KGGA 1WENA 4F52B 5B76A 2I50A 4LLBA 4L7XA 3O36A 4X3GA 5SVIB 3E2DA 1XWHA 2DJAA 3LJUX 2DSMA 4Q6FA 2OXQC 1JOCA 2YYRA 3IHPA 2VJFB 2ECGA 3RPGB 2VPGA 4WA6A 2JMDA 4PTBA 2K4DA 2CKLB 2KU3A 2LAUA 3L1XA 4ZQLA 3U5NA 4YATA 2F42A 2H0DB 2YURA 2QIZA 4AYCB 3GV4A 2F6JA 2KYUA 4MSXA 3FM8C 3ZYQA 1WEWA 2FFWA 4LADB 2E6SA 2KR4A 2EA6A 3L11A 2VJEA 2YHNA 4YBSA 5C13A 1JM7B 3SOXA 2VNFA 4GNGA 3U5MA 5K3QA 2Y43A 4Z0RA 2G6QA 1MM2A 4R2YA 5JG6A 4ZDTA 4UI9B 5H1UA 3O37A 3FEHA 3KDEC 2VPBA 2QICA 2YT5A 2M1RA 1V87A 2ECTA 2KREA 1T1HA 2VPEA 4A4BA 2E61A 5B75A 4Z0OA 1WFKA 2M6MA 4R8PK 3SOWA 2NAAA 2JMJA 5AITA 2MD7B 3LVRE 4QQ4A 4N4FA 2M85A 1WEQA 3PLWA 2VP7A 2L0BA 5SVIA 1F62A 3DQVR 4N3WA 2YQMA 2CSVA 5TDRA 3KV6A 5I3LA 4YBTA 5B8DA 3ZVZB 1IYMA 1Z2QA 5D1KB 1FBVA 4YC9A 2CKLA 3EB5A 2H0DA 4A0CD 2CT2A 3SUBA 3QZVA 3KQIA 4LJNA 3SHBA 4PPEA 4I7BA 3PURA 4I7DA 1WGMA 2XOYA 1JM7A 3EB6A 2IDAA 2CSYA 4V3LC 5B78A 1LDJB 3HCTA 4CA1A 3N9PA 5DKAA 3DDTA 1X4JA 2LN0A 3KNVA 4AUQB 2BAYA 2DX8A 5KH9A 1G25A 3O33A 1MBMA 4CCGX 2K1JA 5H1VA 2FSAA 3GL6A 2CONA 3LQHA 4S3OB 2Y1MA 2YSJA 1DVPA 3M99A 2HYED 2EODA 1K2FA 1WEOA 2YSMA 1LDKC 4FK5A 5H1TA 3RPGC 4B7YC 2JRJA 3MHHA 3PHDA 3ZPV1 2MA5A 5B79A 3O70A 5G04B 1CHCA 4WZ2A 5G0FA 2YUCA 4QF2A 5DINA 2IQJA 4GB0A 3FAOA 3N9QA 5D1LB 3DWDA 5B77A 5FEYA 2VPDA 2G43A 1X4UA 2M13A 2KWNA 5FB0A 4AVXA 5LKUA 4BHWA 1WEUA 1BORA 2F6NA 2EGMA 4QF3A 3KV5A 1VFYA 4WZ0A 1HYIA 3MDBC 2KWOA 4BBQA 3C5KA 2KGIA 2C2VS 5LKXA 4L58A 5LKTA 1ZBDB 3N9OA 5EYAF 2AN6A 3O47A 4XI1A 5LKZA 2ZETC 2L7PA 2JMIA 2KIZA 2MA6A 5J3XA 5TDWA 2VJFA 2HDPA 5SVYA 2PNXA 3MHSA 2YREA 2LGGA 2YQLA 3H7HA 1VD4A 5D1MB 2P57A 2VJEB 2LQ6A 2K17A 2MT5A 2E6RA 4AYCA 2MUMA 3LQIA 3O34A 2L43A 2L5UA 2KFTA 4I7CA 4ZUXU 3VK6A 2CSZA 1Z6UA 2JUNA 3DPLR 1WE9A 3LVQE 2XP0A 3JUEA 3LRQA
chains in the Genus database with same CATH topology
3T9KA 2M13A 4OGCA 3M7KA 2YREA 2B0OE 3DDTA 3H7HA 3LVRE 4QQ4A 5SVIB 3FM8C 2P57A 2YVRA 3FEHA 3PLWA 5SVXA 2FFWA 2CRWA 2KKXA 2MKEA 3E2DA 3O47A 4H9DA 3SUBA 4F1PA 2OWAA 3Q1DA 5SVIA 1DCQA 2DJAA 2EGMA 2JM3A 3LJUX 4O62A 3LDYA 2L7PA 2CONA 2XOZA 3FJUB 2XOCA 2D8UA 2CSVA 2IQJA 2FD4A 2XOYA 2JUNA 2KKYA 2E61A 2EXUA 4OGEA 5K3QA 4Z0RA 4Z0OA 3LVQE 3KDEC 3DWDA 2CRRA 3MDBC 2XP0A 5SVYA 2RR4A 3JUEA 2LAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP0 A;  2XOC A;  2XOY A;  2XOZ A; 
#chains in the Genus database with same CATH topology
 3T9K A;  3ZNI A;  4B86 C;  1WES A;  4A4C A;  4YBM A;  2MNZ A;  5SVX A;  3SOU A;  2M3H A;  4A49 A;  2LGK A;  2MD8 C;  2OWA A;  2ECJ A;  4GNE A;  3M63 A;  4LKA A;  2XOZ A;  1WEP A;  4MVT A;  3I2D A;  4IC3 A;  4UP5 A;  3FL2 A;  1FP0 A;  2CRR A;  4S3O C;  2FUU A;  2RR4 A;  3M62 A;  2ECN A;  2B0O E;  5TRB A;  2MIQ A;  3C6W A;  4FJC A;  1RMD A;  4P5O B;  2MKE A;  2KKX A;  3T6R A;  2ECW A;  2LDR A;  5H9M A;  1VYX A;  1WEE A;  3O35 A;  2LV9 A;  3U5P A;  2RI7 A;  4YAD A;  2FUI A;  2C2L A;  2LXP C;  4V3K C;  2L75 A;  5KH7 A;  4F1P A;  5TAB A;  1WIL A;  5LCW B;  2ECI A;  1Z60 A;  2KWK A;  2D8U A;  5C11 A;  3V43 A;  3NG2 A;  5TBN A;  2RSD A;  2QJ0 A;  2YU4 A;  2XB1 A;  2YW8 A;  3ASL A;  3N9M A;  5KH3 A;  2G45 A;  1HYJ A;  5FER A;  4UP0 A;  3HCU A;  2LRI C;  3FAN A;  1DCQ A;  1X4I A;  1U6G B;  2K16 A;  4R7E A;  2PUY A;  3HCS A;  2XOC A;  2XEU A;  5AIU A;  2FD4 A;  3RTR B;  4WZ3 B;  1E4U A;  4OGE A;  4IC2 A;  3T7L A;  4GNF A;  3M7K A;  4GND A;  2KE1 A;  4O64 A;  4W4U A;  4C9Z A;  1WEV A;  2YVR A;  3N9N A;  4H9D A;  1WIM A;  2LXH C;  2JM3 A;  3LDY A;  3ZVY A;  2Y1N A;  3FJU B;  1WEM A;  2UZG A;  2D8S A;  5FB1 A;  5G05 B;  3ZPV E;  3ZTG A;  2EXU A;  3O7A A;  4FIP A;  3HTK C;  2LGV A;  4FO9 A;  2LGL A;  4LK9 A;  3N9L A;  4YAX A;  3PUQ A;  4TKP B;  4NN2 A;  1N87 A;  1MM3 A;  2CRW A;  4AP4 A;  3Q1D A;  3LQJ A;  4O62 A;  3L1Z B;  2YHO A;  2MNY A;  3U5O A;  2L80 A;  2KWJ A;  2ECV A;  2KKY A;  2EGP A;  4YAB A;  4OGC A;  2KGG A;  1WEN A;  4F52 B;  5B76 A;  2I50 A;  4LLB A;  4L7X A;  3O36 A;  4X3G A;  5SVI B;  3E2D A;  1XWH A;  2DJA A;  3LJU X;  2DSM A;  4Q6F A;  2OXQ C;  1JOC A;  2YYR A;  3IHP A;  2VJF B;  2ECG A;  3RPG B;  2VPG A;  4WA6 A;  2JMD A;  4PTB A;  2K4D A;  2CKL B;  2KU3 A;  2LAU A;  3L1X A;  4ZQL A;  3U5N A;  4YAT A;  2F42 A;  2H0D B;  2YUR A;  2QIZ A;  4AYC B;  3GV4 A;  2F6J A;  2KYU A;  4MSX A;  3FM8 C;  3ZYQ A;  1WEW A;  2FFW A;  4LAD B;  2E6S A;  2KR4 A;  2EA6 A;  3L11 A;  2VJE A;  2YHN A;  4YBS A;  5C13 A;  1JM7 B;  3SOX A;  2VNF A;  4GNG A;  3U5M A;  5K3Q A;  2Y43 A;  4Z0R A;  2G6Q A;  1MM2 A;  4R2Y A;  5JG6 A;  4ZDT A;  4UI9 B;  5H1U A;  3O37 A;  3FEH A;  3KDE C;  2VPB A;  2QIC A;  2YT5 A;  2M1R A;  1V87 A;  2ECT A;  2KRE A;  1T1H A;  2VPE A;  4A4B A;  2E61 A;  5B75 A;  4Z0O A;  1WFK A;  2M6M A;  4R8P K;  3SOW A;  2NAA A;  2JMJ A;  5AIT A;  2MD7 B;  3LVR E;  4QQ4 A;  4N4F A;  2M85 A;  1WEQ A;  3PLW A;  2VP7 A;  2L0B A;  5SVI A;  1F62 A;  3DQV R;  4N3W A;  2YQM A;  2CSV A;  5TDR A;  3KV6 A;  5I3L A;  4YBT A;  5B8D A;  3ZVZ B;  1IYM A;  1Z2Q A;  5D1K B;  1FBV A;  4YC9 A;  2CKL A;  3EB5 A;  2H0D A;  4A0C D;  2CT2 A;  3SUB A;  3QZV A;  3KQI A;  4LJN A;  3SHB A;  4PPE A;  4I7B A;  3PUR A;  4I7D A;  1WGM A;  2XOY A;  1JM7 A;  3EB6 A;  2IDA A;  2CSY A;  4V3L C;  5B78 A;  1LDJ B;  3HCT A;  4CA1 A;  3N9P A;  5DKA A;  3DDT A;  1X4J A;  2LN0 A;  3KNV A;  4AUQ B;  2BAY A;  2DX8 A;  5KH9 A;  1G25 A;  3O33 A;  1MBM A;  4CCG X;  2K1J A;  5H1V A;  2FSA A;  3GL6 A;  2CON A;  3LQH A;  4S3O B;  2Y1M A;  2YSJ A;  1DVP A;  3M99 A;  2HYE D;  2EOD A;  1K2F A;  1WEO A;  2YSM A;  1LDK C;  4FK5 A;  5H1T A;  3RPG C;  4B7Y C;  2JRJ A;  3MHH A;  3PHD A;  3ZPV 1;  2MA5 A;  5B79 A;  3O70 A;  5G04 B;  1CHC A;  4WZ2 A;  5G0F A;  2YUC A;  4QF2 A;  5DIN A;  2IQJ A;  4GB0 A;  3FAO A;  3N9Q A;  5D1L B;  3DWD A;  5B77 A;  5FEY A;  2VPD A;  2G43 A;  1X4U A;  2M13 A;  2KWN A;  5FB0 A;  4AVX A;  5LKU A;  4BHW A;  1WEU A;  1BOR A;  2F6N A;  2EGM A;  4QF3 A;  3KV5 A;  1VFY A;  4WZ0 A;  1HYI A;  3MDB C;  2KWO A;  4BBQ A;  3C5K A;  2KGI A;  2C2V S;  5LKX A;  4L58 A;  5LKT A;  1ZBD B;  3N9O A;  5EYA F;  2AN6 A;  3O47 A;  4XI1 A;  5LKZ A;  2ZET C;  2L7P A;  2JMI A;  2KIZ A;  2MA6 A;  5J3X A;  5TDW A;  2VJF A;  2HDP A;  5SVY A;  2PNX A;  3MHS A;  2YRE A;  2LGG A;  2YQL A;  3H7H A;  1VD4 A;  5D1M B;  2P57 A;  2VJE B;  2LQ6 A;  2K17 A;  2MT5 A;  2E6R A;  4AYC A;  2MUM A;  3LQI A;  3O34 A;  2L43 A;  2L5U A;  2KFT A;  4I7C A;  4ZUX U;  3VK6 A;  2CSZ A;  1Z6U A;  2JUN A;  3DPL R;  1WE9 A;  3LVQ E;  2XP0 A;  3JUE A;  3LRQ A; 
#chains in the Genus database with same CATH homology
 3T9K A;  2M13 A;  4OGC A;  3M7K A;  2YRE A;  2B0O E;  3DDT A;  3H7H A;  3LVR E;  4QQ4 A;  5SVI B;  3FM8 C;  2P57 A;  2YVR A;  3FEH A;  3PLW A;  5SVX A;  2FFW A;  2CRW A;  2KKX A;  2MKE A;  3E2D A;  3O47 A;  4H9D A;  3SUB A;  4F1P A;  2OWA A;  3Q1D A;  5SVI A;  1DCQ A;  2DJA A;  2EGM A;  2JM3 A;  3LJU X;  4O62 A;  3LDY A;  2L7P A;  2CON A;  2XOZ A;  3FJU B;  2XOC A;  2D8U A;  2CSV A;  2IQJ A;  2FD4 A;  2XOY A;  2JUN A;  2KKY A;  2E61 A;  2EXU A;  4OGE A;  5K3Q A;  4Z0R A;  4Z0O A;  3LVQ E;  3KDE C;  3DWD A;  2CRR A;  3MDB C;  2XP0 A;  5SVY A;  2RR4 A;  3JUE A;  2LAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...