2XOZA

C-terminal cysteine rich domain of human chfr bound to amp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
213
Chain Sequence
b'PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 65
structure length 213
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xozA01
2XOCA 2XOYA 2XP0A 2XOZA
chains in the Genus database with same CATH superfamily
2P57A 4AYCA 4P5OB 2L5UA 2KE1A 2M6MA 4IC2A 2DJAA 4F52B 2H0DA 5LKZA 3U5MA 1WGMA 1MBMA 3M99A 2MUMA 3FANA 2C2LA 2YREA 4YC9A 3C5KA 2OXQC 3O34A 2G6QA 3I2DA 2MT5A 2M1RA 4OGCA 3LVQE 5J3XA 3NG2A 2YYRA 2YURA 2Y1MA 4Q6FA 2K16A 4XI1A 3LJUX 4UP0A 4GNDA 2Y1NA 2F42A 4YAXA 4I7CA 2AN6A 2YSJA 3HTKC 2RI7A 3Q1DA 2MIQA 1WEWA 2KWKA 5SVXA 2VPBA 2CT2A 2KWJA 2XEUA 2CSVA 4R8PK 2YQLA 4LKAA 1JM7B 4F1PA 1U6GB 5K3QA 2JMIA 4GNEA 1WE9A 2YHOA 3ASLA 1DCQA 1T1HA 1FP0A 3PUQA 2EODA 3FAOA 1LDJB 4AP4A 4YABA 3O37A 4Z0RA 4GB0A 4Z0OA 5FEYA 2VPDA 2E6SA 2XOZA 2ECWA 5FB0A 3IHPA 2CRWA 3DPLR 5I3LA 1LDKC 5B77A 2M13A 4LADB 5TRBA 2KIZA 3HCTA 2VJEA 2YHNA 4N3WA 4AYCB 2KREA 3HCSA 5DKAA 2IDAA 2YUCA 4PPEA 4QF3A 5G05B 5AITA 2H0DB 1IYMA 1MM3A 3MDBC 2CKLA 1F62A 2ECGA 1Z60A 4A4BA 2ECJA 2L0BA 3N9LA 3O70A 5B75A 3M63A 2KWOA 3KDEC 4FO9A 4ZUXU 5H9MA 2YSMA 2KGGA 2LGGA 3KV5A 3L1XA 4YATA 3N9PA 3FM8C 2CRRA 2LGLA 4X3GA 4CA1A 3JUEA 4LJNA 2VJFA 4FIPA 2E61A 3M7KA 3V43A 2CONA 2FUIA 2XOYA 2LXHC 2MA5A 4FJCA 3ZYQA 2Y43A 3HCUA 4QF2A 2KKXA 2HDPA 3O36A 1WEVA 3DDTA 3H7HA 3KV6A 2L80A 5B76A 2VPGA 4C9ZA 5H1UA 2EA6A 1XWHA 4YBTA 2MD7B 2JM3A 3LDYA 3SUBA 4QQ4A 4UI9B 5LCWB 1FBVA 2QJ0A 3EB6A 4O64A 5TBNA 5KH3A 2ECNA 2MNYA 2K4DA 5TDWA 2YU4A 3N9OA 1X4UA 2YT5A 2G45A 3PURA 2PNXA 5G04B 1E4UA 4YBMA 3L1ZB 2JUNA 4LLBA 4R7EA 5AIUA 2FFWA 2MA6A 2IQJA 4MSXA 2JMDA 5LKXA 4MVTA 2E6RA 2CSZA 2RSDA 3RPGC 4AVXA 5SVIB 4OGEA 5D1KB 2CKLB 2LV9A 3GL6A 1VYXA 2ECIA 1N87A 1WEOA 3DQVR 3LQJA 5EYAF 5H1VA 3SHBA 1RMDA 3RTRB 1WILA 4IC3A 5LKTA 3ZVZB 3KNVA 2XOCA 3DWDA 2VJFB 3PHDA 4GNGA 3SOWA 2LDRA 1V87A 3O35A 2LGVA 3LVRE 3GV4A 3N9MA 5G0FA 2EXUA 2RR4A 1JM7A 2G43A 3O7AA 1WEUA 2LAUA 3FL2A 3ZPVE 2OWAA 2HYED 2QICA 2BAYA 2VP7A 5KH7A 3LQIA 1WEEA 4BHWA 5TABA 2KR4A 1G25A 3LRQA 5D1MB 2MKEA 3SOXA 2F6NA 2DSMA 1WEPA 4CCGX 2PUYA 4B86C 2XB1A 3RPGB 5KH9A 3EB5A 2ZETC 3MHSA 4BBQA 2FD4A 3T7LA 4A4CA 1Z6UA 2LN0A 4YBSA 1BORA 4A0CD 4H9DA 3ZNIA 1VFYA 3QZVA 3U5OA 1WFKA 4WZ3B 5B79A 4O62A 2KGIA 1ZBDB 5B78A 5H1TA 3SOUA 4TKPB 1WIMA 1VD4A 3ZPV1 2M85A 2KKYA 4S3OC 2LQ6A 3N9QA 2JMJA 3VK6A 2ECTA 5DINA 2D8UA 2MD8C 2M3HA 2KWNA 2VJEB 1X4JA 2FUUA 1WESA 4NN2A 5FB1A 2L7PA 2YVRA 2KFTA 2CSYA 5JG6A 5C11A 3O47A 2DX8A 2KU3A 4UP5A 4WZ2A 1WENA 4PTBA 4AUQB 4B7YC 2C2VS 3T6RA 4W4UA 3PLWA 3FEHA 4ZDTA 2QIZA 3T9KA 4FK5A 5TDRA 4R2YA 1CHCA 1Z2QA 5C13A 2D8SA 2YQMA 2L75A 1MM2A 2LXPC 4V3KC 1HYIA 1JOCA 2FSAA 5B8DA 5LKUA 1DVPA 4A49A 3L11A 2B0OE 2F6JA 4L7XA 1X4IA 5FERA 4WZ0A 3FJUB 4I7BA 2K17A 3MHHA 2K1JA 4WA6A 1WEMA 1WEQA 3N9NA 2MNZA 3KQIA 3U5PA 3LQHA 3ZTGA 2LGKA 5SVIA 3M62A 3U5NA 2VPEA 4L58A 4N4FA 4YADA 4ZQLA 4S3OB 2KYUA 2EGMA 2YW8A 2EGPA 5SVYA 2XP0A 3C6WA 5D1LB 3O33A 1K2FA 1HYJA 2I50A 4GNFA 4I7DA 2ECVA 2VNFA 3E2DA 2L43A 2JRJA 2NAAA 2UZGA 4V3LC 3ZVYA 4LK9A 2LRIC
chains in the Genus database with same CATH topology
3FEHA 2JUNA 2P57A 2CSVA 3JUEA 3MDBC 3LVQE 4OGCA 3T9KA 4H9DA 3LDYA 2JM3A 2E61A 2B0OE 4F1PA 2FFWA 3SUBA 3M7KA 5K3QA 2EGMA 2CONA 2DJAA 2XOYA 3LVRE 4QQ4A 2XOZA 2IQJA 2EXUA 2RR4A 3FJUB 2XP0A 5SVYA 2D8UA 3KDEC 3LJUX 2CRWA 2MKEA 4O62A 1DCQA 2LAUA 2M13A 2L7PA 2YVRA 2KKXA 5SVIB 3O47A 2YREA 2OWAA 3Q1DA 4OGEA 3E2DA 2XOCA 3DDTA 3DWDA 3H7HA 4Z0RA 5SVIA 2FD4A 5SVXA 4Z0OA 3PLWA 3FM8C 2CRRA 2KKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOC A;  2XOY A;  2XP0 A;  2XOZ A; 
#chains in the Genus database with same CATH topology
 2P57 A;  4AYC A;  4P5O B;  2L5U A;  2KE1 A;  2M6M A;  4IC2 A;  2DJA A;  4F52 B;  2H0D A;  5LKZ A;  3U5M A;  1WGM A;  1MBM A;  3M99 A;  2MUM A;  3FAN A;  2C2L A;  2YRE A;  4YC9 A;  3C5K A;  2OXQ C;  3O34 A;  2G6Q A;  3I2D A;  2MT5 A;  2M1R A;  4OGC A;  3LVQ E;  5J3X A;  3NG2 A;  2YYR A;  2YUR A;  2Y1M A;  4Q6F A;  2K16 A;  4XI1 A;  3LJU X;  4UP0 A;  4GND A;  2Y1N A;  2F42 A;  4YAX A;  4I7C A;  2AN6 A;  2YSJ A;  3HTK C;  2RI7 A;  3Q1D A;  2MIQ A;  1WEW A;  2KWK A;  5SVX A;  2VPB A;  2CT2 A;  2KWJ A;  2XEU A;  2CSV A;  4R8P K;  2YQL A;  4LKA A;  1JM7 B;  4F1P A;  1U6G B;  5K3Q A;  2JMI A;  4GNE A;  1WE9 A;  2YHO A;  3ASL A;  1DCQ A;  1T1H A;  1FP0 A;  3PUQ A;  2EOD A;  3FAO A;  1LDJ B;  4AP4 A;  4YAB A;  3O37 A;  4Z0R A;  4GB0 A;  4Z0O A;  5FEY A;  2VPD A;  2E6S A;  2XOZ A;  2ECW A;  5FB0 A;  3IHP A;  2CRW A;  3DPL R;  5I3L A;  1LDK C;  5B77 A;  2M13 A;  4LAD B;  5TRB A;  2KIZ A;  3HCT A;  2VJE A;  2YHN A;  4N3W A;  4AYC B;  2KRE A;  3HCS A;  5DKA A;  2IDA A;  2YUC A;  4PPE A;  4QF3 A;  5G05 B;  5AIT A;  2H0D B;  1IYM A;  1MM3 A;  3MDB C;  2CKL A;  1F62 A;  2ECG A;  1Z60 A;  4A4B A;  2ECJ A;  2L0B A;  3N9L A;  3O70 A;  5B75 A;  3M63 A;  2KWO A;  3KDE C;  4FO9 A;  4ZUX U;  5H9M A;  2YSM A;  2KGG A;  2LGG A;  3KV5 A;  3L1X A;  4YAT A;  3N9P A;  3FM8 C;  2CRR A;  2LGL A;  4X3G A;  4CA1 A;  3JUE A;  4LJN A;  2VJF A;  4FIP A;  2E61 A;  3M7K A;  3V43 A;  2CON A;  2FUI A;  2XOY A;  2LXH C;  2MA5 A;  4FJC A;  3ZYQ A;  2Y43 A;  3HCU A;  4QF2 A;  2KKX A;  2HDP A;  3O36 A;  1WEV A;  3DDT A;  3H7H A;  3KV6 A;  2L80 A;  5B76 A;  2VPG A;  4C9Z A;  5H1U A;  2EA6 A;  1XWH A;  4YBT A;  2MD7 B;  2JM3 A;  3LDY A;  3SUB A;  4QQ4 A;  4UI9 B;  5LCW B;  1FBV A;  2QJ0 A;  3EB6 A;  4O64 A;  5TBN A;  5KH3 A;  2ECN A;  2MNY A;  2K4D A;  5TDW A;  2YU4 A;  3N9O A;  1X4U A;  2YT5 A;  2G45 A;  3PUR A;  2PNX A;  5G04 B;  1E4U A;  4YBM A;  3L1Z B;  2JUN A;  4LLB A;  4R7E A;  5AIU A;  2FFW A;  2MA6 A;  2IQJ A;  4MSX A;  2JMD A;  5LKX A;  4MVT A;  2E6R A;  2CSZ A;  2RSD A;  3RPG C;  4AVX A;  5SVI B;  4OGE A;  5D1K B;  2CKL B;  2LV9 A;  3GL6 A;  1VYX A;  2ECI A;  1N87 A;  1WEO A;  3DQV R;  3LQJ A;  5EYA F;  5H1V A;  3SHB A;  1RMD A;  3RTR B;  1WIL A;  4IC3 A;  5LKT A;  3ZVZ B;  3KNV A;  2XOC A;  3DWD A;  2VJF B;  3PHD A;  4GNG A;  3SOW A;  2LDR A;  1V87 A;  3O35 A;  2LGV A;  3LVR E;  3GV4 A;  3N9M A;  5G0F A;  2EXU A;  2RR4 A;  1JM7 A;  2G43 A;  3O7A A;  1WEU A;  2LAU A;  3FL2 A;  3ZPV E;  2OWA A;  2HYE D;  2QIC A;  2BAY A;  2VP7 A;  5KH7 A;  3LQI A;  1WEE A;  4BHW A;  5TAB A;  2KR4 A;  1G25 A;  3LRQ A;  5D1M B;  2MKE A;  3SOX A;  2F6N A;  2DSM A;  1WEP A;  4CCG X;  2PUY A;  4B86 C;  2XB1 A;  3RPG B;  5KH9 A;  3EB5 A;  2ZET C;  3MHS A;  4BBQ A;  2FD4 A;  3T7L A;  4A4C A;  1Z6U A;  2LN0 A;  4YBS A;  1BOR A;  4A0C D;  4H9D A;  3ZNI A;  1VFY A;  3QZV A;  3U5O A;  1WFK A;  4WZ3 B;  5B79 A;  4O62 A;  2KGI A;  1ZBD B;  5B78 A;  5H1T A;  3SOU A;  4TKP B;  1WIM A;  1VD4 A;  3ZPV 1;  2M85 A;  2KKY A;  4S3O C;  2LQ6 A;  3N9Q A;  2JMJ A;  3VK6 A;  2ECT A;  5DIN A;  2D8U A;  2MD8 C;  2M3H A;  2KWN A;  2VJE B;  1X4J A;  2FUU A;  1WES A;  4NN2 A;  5FB1 A;  2L7P A;  2YVR A;  2KFT A;  2CSY A;  5JG6 A;  5C11 A;  3O47 A;  2DX8 A;  2KU3 A;  4UP5 A;  4WZ2 A;  1WEN A;  4PTB A;  4AUQ B;  4B7Y C;  2C2V S;  3T6R A;  4W4U A;  3PLW A;  3FEH A;  4ZDT A;  2QIZ A;  3T9K A;  4FK5 A;  5TDR A;  4R2Y A;  1CHC A;  1Z2Q A;  5C13 A;  2D8S A;  2YQM A;  2L75 A;  1MM2 A;  2LXP C;  4V3K C;  1HYI A;  1JOC A;  2FSA A;  5B8D A;  5LKU A;  1DVP A;  4A49 A;  3L11 A;  2B0O E;  2F6J A;  4L7X A;  1X4I A;  5FER A;  4WZ0 A;  3FJU B;  4I7B A;  2K17 A;  3MHH A;  2K1J A;  4WA6 A;  1WEM A;  1WEQ A;  3N9N A;  2MNZ A;  3KQI A;  3U5P A;  3LQH A;  3ZTG A;  2LGK A;  5SVI A;  3M62 A;  3U5N A;  2VPE A;  4L58 A;  4N4F A;  4YAD A;  4ZQL A;  4S3O B;  2KYU A;  2EGM A;  2YW8 A;  2EGP A;  5SVY A;  2XP0 A;  3C6W A;  5D1L B;  3O33 A;  1K2F A;  1HYJ A;  2I50 A;  4GNF A;  4I7D A;  2ECV A;  2VNF A;  3E2D A;  2L43 A;  2JRJ A;  2NAA A;  2UZG A;  4V3L C;  3ZVY A;  4LK9 A;  2LRI C; 
#chains in the Genus database with same CATH homology
 3FEH A;  2JUN A;  2P57 A;  2CSV A;  3JUE A;  3MDB C;  3LVQ E;  4OGC A;  3T9K A;  4H9D A;  3LDY A;  2JM3 A;  2E61 A;  2B0O E;  4F1P A;  2FFW A;  3SUB A;  3M7K A;  5K3Q A;  2EGM A;  2CON A;  2DJA A;  2XOY A;  3LVR E;  4QQ4 A;  2XOZ A;  2IQJ A;  2EXU A;  2RR4 A;  3FJU B;  2XP0 A;  5SVY A;  2D8U A;  3KDE C;  3LJU X;  2CRW A;  2MKE A;  4O62 A;  1DCQ A;  2LAU A;  2M13 A;  2L7P A;  2YVR A;  2KKX A;  5SVI B;  3O47 A;  2YRE A;  2OWA A;  3Q1D A;  4OGE A;  3E2D A;  2XOC A;  3DDT A;  3DWD A;  3H7H A;  4Z0R A;  5SVI A;  2FD4 A;  5SVX A;  4Z0O A;  3PLW A;  3FM8 C;  2CRR A;  2KKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...