3NG2A

Crystal structure of the rnf4 ring domain dimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
RPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords RING finger protein 4
publication title RING domain dimerization is essential for RNF4 function
pubmed doi rcsb
source organism Rattus norvegicus
total genus 10
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3ng2A00
2VPDA 4PPEA 4B86C 2QIZA 1LDKC 2YSMA 3M62A 4YBTA 2HYED 2M3HA 4PTBA 4FJCA 3QZVA 5KH9A 2DX8A 2YT5A 2LGVA 2EGPA 3KV6A 3V43A 1Z60A 2JMJA 4FK5A 4A49A 1WESA 5TRBA 2L75A 1IYMA 4LLBA 2C2LA 4N4FA 5C13A 3N9QA 2KFTA 3EB5A 1VYXA 4UP0A 2L5UA 3MHSA 3HTKC 2Y1MA 2E6SA 5D1MB 5FEYA 4BHWA 4L58A 2FSAA 2MD8C 5H9MA 4C9ZA 4MVTA 5D1LB 2JRJA 1WE9A 3SOXA 2CT2A 1WEQA 2Y43A 4LJNA 2ECTA 2VNFA 5H1UA 3U5OA 2ECNA 3DQVR 4LK9A 3U5NA 1X4UA 1VD4A 1HYJA 4ZDTA 3EB6A 2YREA 3GV4A 3PUQA 3M99A 3PHDA 1VFYA 5TABA 2ECJA 1F62A 1XWHA 1WEEA 2QICA 3DPLR 2VJEA 2YQMA 1JM7B 4WZ2A 2YQLA 4YC9A 4IC2A 1MM3A 1U6GB 1WGMA 2MNYA 5J3XA 2F42A 4R8PK 1CHCA 2C2VS 2MT5A 2YHNA 2LXPC 3ZYQA 2ECVA 2CKLB 5B77A 4UP5A 4GNDA 1G25A 3U5MA 2YW8A 1RMDA 4ZQLA 3SOUA 2FUIA 2JMIA 1E4UA 2M1RA 2L43A 3N9PA 2VPEA 2D8SA 2YUCA 5B79A 3SOWA 2LDRA 2HDPA 1MM2A 3PURA 2BAYA 2LXHC 4I7BA 3VK6A 3RPGC 2KWOA 3ZVYA 2LRIC 4YBMA 2AN6A 2YHOA 4QF2A 5TBNA 4AVXA 4AYCB 1X4JA 5B75A 2MD7B 3LQIA 1WEVA 3ZNIA 1WFKA 1WEPA 4R7EA 5LCWB 2LQ6A 4S3OC 5LKUA 3T7LA 2YYRA 2XEUA 1FBVA 4NN2A 5H1TA 3NG2A 2LGLA 3KV5A 4MSXA 3LQHA 2I50A 3KNVA 2H0DB 3N9LA 4UI9B 4W4UA 2KGGA 2LGKA 4AP4A 4V3LC 4GB0A 2K16A 4FO9A 3MHHA 2G45A 3U5PA 5C11A 2VJFB 2YSJA 3O36A 1WEWA 3ZTGA 3N9MA 4YAXA 2KIZA 3ZPVE 4LKAA 2K4DA 1FP0A 1WILA 4P5OB 4CCGX 1LDJB 3L1XA 2EODA 3N9NA 3O37A 2KGIA 5AITA 5B78A 2RSDA 3L11A 2MNZA 1Z6UA 5JG6A 4BBQA 3HCSA 2VP7A 3O7AA 3IHPA 3I2DA 2YU4A 3O34A 5TDWA 4B7YC 3C5KA 3LRQA 1WEOA 2VPGA 3RPGB 2G6QA 2F6JA 4YATA 4ZUXU 1X4IA 4A0CD 1ZBDB 2KWKA 2QJ0A 4X3GA 5FB0A 1V87A 2PNXA 2XB1A 2E6RA 4A4CA 3LQJA 2LN0A 4S3OB 1WENA 2M6MA 2M85A 4YBSA 4GNEA 2LV9A 1WIMA 2L0BA 4FIPA 3M63A 4XI1A 2OXQC 5FERA 4I7DA 5G04B 4WZ3B 4L7XA 4I7CA 2ECGA 1BORA 2RI7A 3KQIA 5LKXA 2UZGA 1T1HA 3T6RA 4QF3A 2JMDA 1JM7A 3O33A 2G43A 3HCUA 2MUMA 2VJEB 3C6WA 3HCTA 5G05B 2IDAA 3O70A 3ZPV1 5I3LA 2CKLA 5AIUA 1K2FA 4CA1A 1WEUA 2KWJA 2ZETC 4WZ0A 4TKPB 2ECWA 4YADA 2K17A 3FL2A 4GNGA 5LKTA 2MA5A 2Y1NA 5B8DA 3ASLA 3L1ZB 2KE1A 2KREA 4YABA 5KH3A 5KH7A 4V3KC 1DVPA 5FB1A 2KYUA 4A4BA 2K1JA 2L80A 4R2YA 4N3WA 4Q6FA 2KR4A 4AYCA 2FUUA 5TDRA 2EA6A 5EYAF 5G0FA 2LGGA 5D1KB 2MA6A 2KWNA 1WEMA 2CSYA 2NAAA 4O64A 1Z2QA 3O35A 4F52B 3SHBA 3RTRB 1N87A 2H0DA 5DKAA 2KU3A 4IC3A 2ECIA 5DINA 2PUYA 2YURA 2VJFA 3N9OA 2F6NA 4LADB 4WA6A 5H1VA 4GNFA 2CSZA 2MIQA 2VPBA 1JOCA 5B76A 3GL6A 4AUQB 1HYIA 3ZVZB 5LKZA
chains in the Genus database with same CATH superfamily
1DCQA 2VPDA 4PPEA 4B86C 2QIZA 1LDKC 2YSMA 3M62A 4YBTA 2HYED 2M3HA 4PTBA 4FJCA 3QZVA 5KH9A 2DX8A 2YT5A 2LGVA 2EGPA 3KV6A 3V43A 1Z60A 2L7PA 2JMJA 4FK5A 4A49A 1WESA 5TRBA 2L75A 1IYMA 4LLBA 2C2LA 4N4FA 3MDBC 3N9QA 5C13A 2KFTA 3EB5A 1VYXA 4UP0A 2L5UA 3MHSA 5SVIB 3HTKC 2Y1MA 2CSVA 2E6SA 5D1MB 5FEYA 5K3QA 3E2DA 3KDEC 4Z0OA 4BHWA 4L58A 2FSAA 2MD8C 5H9MA 4OGEA 4C9ZA 4MVTA 5D1LB 2JRJA 1WE9A 2RR4A 3SOXA 2CT2A 2CRWA 2JUNA 1WEQA 4LJNA 2Y43A 4QQ4A 2ECTA 2VNFA 5H1UA 2XP0A 3U5OA 2ECNA 3DQVR 4LK9A 3U5NA 1X4UA 1VD4A 1HYJA 4ZDTA 3EB6A 2YREA 3GV4A 3PUQA 3M99A 3PHDA 1VFYA 3Q1DA 5TABA 2ECJA 1F62A 1XWHA 3LVRE 1WEEA 5SVYA 2QICA 3DPLR 2VJEA 2YVRA 2YQMA 1JM7B 4WZ2A 2YQLA 4YC9A 4IC2A 1MM3A 1U6GB 1WGMA 2MNYA 3JUEA 5J3XA 2F42A 4R8PK 1CHCA 1MBMA 2C2VS 2MT5A 2YHNA 2LXPC 3ZYQA 2ECVA 2MKEA 2CKLB 5B77A 4UP5A 4GNDA 1G25A 3U5MA 2YW8A 2B0OE 1RMDA 4ZQLA 2OWAA 3SOUA 2E61A 2FUIA 2JMIA 1E4UA 2M1RA 2L43A 3N9PA 2VPEA 2D8SA 2YUCA 5B79A 3SOWA 3H7HA 2LDRA 2HDPA 1MM2A 2DJAA 3PURA 3LJUX 2BAYA 2LXHC 4I7BA 3VK6A 3RPGC 2KWOA 3ZVYA 2LRIC 4YBMA 2FD4A 2KKXA 2AN6A 2YHOA 4QF2A 5TBNA 4AVXA 4AYCB 1X4JA 5B75A 2MD7B 3LQIA 1WEVA 3ZNIA 1WFKA 1WEPA 4R7EA 5LCWB 2LQ6A 4S3OC 5LKUA 3T7LA 2YYRA 2XEUA 2IQJA 1FBVA 2M13A 4NN2A 5H1TA 3NG2A 2LGLA 3KV5A 4MSXA 3LQHA 2I50A 3KNVA 2H0DB 3N9LA 4UI9B 4W4UA 2KGGA 2LGKA 4AP4A 4V3LC 4GB0A 2K16A 4FO9A 3MHHA 2G45A 3U5PA 3DDTA 5C11A 2VJFB 2YSJA 3O36A 1WEWA 3ZTGA 3N9MA 4YAXA 2KIZA 3ZPVE 4LKAA 2XOYA 2K4DA 1FP0A 2EGMA 1WILA 4P5OB 4CCGX 1LDJB 3L1XA 2EODA 3N9NA 3O37A 2KGIA 5AITA 5B78A 2RSDA 3L11A 2MNZA 2DSMA 1Z6UA 5JG6A 2EXUA 4BBQA 3HCSA 2VP7A 3O7AA 3IHPA 3I2DA 2YU4A 3O34A 3FM8C 5TDWA 4B7YC 3C5KA 3LRQA 1WEOA 2VPGA 3RPGB 2G6QA 2F6JA 4YATA 4ZUXU 1X4IA 5SVIA 4A0CD 1ZBDB 2KWKA 2QJ0A 4X3GA 3T9KA 5FB0A 1V87A 2PNXA 2XB1A 4OGCA 2E6RA 4A4CA 3LQJA 2XOZA 2LN0A 3LVQE 4S3OB 1WENA 3SUBA 2M6MA 2M85A 4YBSA 4GNEA 2LV9A 1WIMA 4F1PA 5SVXA 2L0BA 4FIPA 3M63A 4XI1A 2OXQC 5FERA 4I7DA 5G04B 4WZ3B 4L7XA 4I7CA 4Z0RA 2ECGA 1BORA 2RI7A 3KQIA 5LKXA 2UZGA 1T1HA 3T6RA 4QF3A 2JMDA 3FEHA 1JM7A 3O33A 2G43A 3DWDA 2JM3A 3HCUA 2MUMA 3FJUB 3O47A 2VJEB 3C6WA 3HCTA 5G05B 2IDAA 3O70A 3ZPV1 5I3LA 2CKLA 5AIUA 1K2FA 4CA1A 1WEUA 2KWJA 2ZETC 4WZ0A 4TKPB 2ECWA 2CONA 2KKYA 4YADA 2K17A 3FL2A 4GNGA 5LKTA 2MA5A 2D8UA 2Y1NA 5B8DA 3ASLA 4H9DA 4O62A 3L1ZB 2KE1A 2KREA 4YABA 5KH3A 5KH7A 4V3KC 1DVPA 5FB1A 2KYUA 2FFWA 4A4BA 2K1JA 2L80A 4R2YA 4N3WA 4Q6FA 2KR4A 4AYCA 2P57A 2FUUA 5TDRA 2EA6A 5EYAF 3M7KA 5G0FA 2LGGA 5D1KB 2MA6A 2KWNA 3PLWA 1WEMA 2CSYA 2NAAA 2CRRA 4O64A 1Z2QA 3O35A 4F52B 3SHBA 3RTRB 1N87A 2H0DA 5DKAA 2KU3A 2XOCA 4IC3A 2ECIA 5DINA 3LDYA 3FANA 3FAOA 2PUYA 2YURA 2VJFA 3N9OA 2F6NA 4LADB 4WA6A 5H1VA 4GNFA 2CSZA 2MIQA 2VPBA 1JOCA 5B76A 3GL6A 4AUQB 1HYIA 3ZVZB 2LAUA 5LKZA
chains in the Genus database with same CATH topology
2VPDA 4PPEA 4B86C 2QIZA 1LDKC 2YSMA 3M62A 4YBTA 2HYED 2M3HA 4PTBA 4FJCA 3QZVA 5KH9A 2DX8A 2YT5A 2LGVA 2EGPA 3KV6A 3V43A 1Z60A 2JMJA 4FK5A 4A49A 1WESA 5TRBA 2L75A 1IYMA 4LLBA 2C2LA 4N4FA 5C13A 3N9QA 2KFTA 3EB5A 1VYXA 4UP0A 2L5UA 3MHSA 3HTKC 2Y1MA 2E6SA 5D1MB 5FEYA 4BHWA 4L58A 2FSAA 2MD8C 5H9MA 4C9ZA 4MVTA 5D1LB 2JRJA 1WE9A 3SOXA 2CT2A 1WEQA 2Y43A 4LJNA 2ECTA 2VNFA 5H1UA 3U5OA 2ECNA 3DQVR 4LK9A 3U5NA 1X4UA 1VD4A 1HYJA 4ZDTA 3EB6A 2YREA 3GV4A 3PUQA 3M99A 3PHDA 1VFYA 5TABA 2ECJA 1F62A 1XWHA 1WEEA 2QICA 3DPLR 2VJEA 2YQMA 1JM7B 4WZ2A 2YQLA 4YC9A 4IC2A 1MM3A 1U6GB 1WGMA 2MNYA 5J3XA 2F42A 4R8PK 1CHCA 2C2VS 2MT5A 2YHNA 2LXPC 3ZYQA 2ECVA 2CKLB 5B77A 4UP5A 4GNDA 1G25A 3U5MA 2YW8A 1RMDA 4ZQLA 3SOUA 2FUIA 2JMIA 1E4UA 2M1RA 2L43A 3N9PA 2VPEA 2D8SA 2YUCA 5B79A 3SOWA 2LDRA 2HDPA 1MM2A 3PURA 2BAYA 2LXHC 4I7BA 3VK6A 3RPGC 2KWOA 3ZVYA 2LRIC 4YBMA 2AN6A 2YHOA 4QF2A 5TBNA 4AVXA 4AYCB 1X4JA 5B75A 2MD7B 3LQIA 1WEVA 3ZNIA 1WFKA 1WEPA 4R7EA 5LCWB 2LQ6A 4S3OC 5LKUA 3T7LA 2YYRA 2XEUA 1FBVA 4NN2A 5H1TA 3NG2A 2LGLA 3KV5A 4MSXA 3LQHA 2I50A 3KNVA 2H0DB 3N9LA 4UI9B 4W4UA 2KGGA 2LGKA 4AP4A 4V3LC 4GB0A 2K16A 4FO9A 3MHHA 2G45A 3U5PA 5C11A 2VJFB 2YSJA 3O36A 1WEWA 3ZTGA 3N9MA 4YAXA 2KIZA 3ZPVE 4LKAA 2K4DA 1FP0A 1WILA 4P5OB 4CCGX 1LDJB 3L1XA 2EODA 3N9NA 3O37A 2KGIA 5AITA 5B78A 2RSDA 3L11A 2MNZA 1Z6UA 5JG6A 4BBQA 3HCSA 2VP7A 3O7AA 3IHPA 3I2DA 2YU4A 3O34A 5TDWA 4B7YC 3C5KA 3LRQA 1WEOA 2VPGA 3RPGB 2G6QA 2F6JA 4YATA 4ZUXU 1X4IA 4A0CD 1ZBDB 2KWKA 2QJ0A 4X3GA 5FB0A 1V87A 2PNXA 2XB1A 2E6RA 4A4CA 3LQJA 2LN0A 4S3OB 1WENA 2M6MA 2M85A 4YBSA 4GNEA 2LV9A 1WIMA 2L0BA 4FIPA 3M63A 4XI1A 2OXQC 5FERA 4I7DA 5G04B 4WZ3B 4L7XA 4I7CA 2ECGA 1BORA 2RI7A 3KQIA 5LKXA 2UZGA 1T1HA 3T6RA 4QF3A 2JMDA 1JM7A 3O33A 2G43A 3HCUA 2MUMA 2VJEB 3C6WA 3HCTA 5G05B 2IDAA 3O70A 3ZPV1 5I3LA 2CKLA 5AIUA 1K2FA 4CA1A 1WEUA 2KWJA 2ZETC 4WZ0A 4TKPB 2ECWA 4YADA 2K17A 3FL2A 4GNGA 5LKTA 2MA5A 2Y1NA 5B8DA 3ASLA 3L1ZB 2KE1A 2KREA 4YABA 5KH3A 5KH7A 4V3KC 1DVPA 5FB1A 2KYUA 4A4BA 2K1JA 2L80A 4R2YA 4N3WA 4Q6FA 2KR4A 4AYCA 2FUUA 5TDRA 2EA6A 5EYAF 5G0FA 2LGGA 5D1KB 2MA6A 2KWNA 1WEMA 2CSYA 2NAAA 4O64A 1Z2QA 3O35A 4F52B 3SHBA 3RTRB 1N87A 2H0DA 5DKAA 2KU3A 4IC3A 2ECIA 5DINA 2PUYA 2YURA 2VJFA 3N9OA 2F6NA 4LADB 4WA6A 5H1VA 4GNFA 2CSZA 2MIQA 2VPBA 1JOCA 5B76A 3GL6A 4AUQB 1HYIA 3ZVZB 5LKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPD A;  4PPE A;  4B86 C;  2QIZ A;  1LDK C;  2YSM A;  3M62 A;  4YBT A;  2HYE D;  2M3H A;  4PTB A;  4FJC A;  3QZV A;  5KH9 A;  2DX8 A;  2YT5 A;  2LGV A;  2EGP A;  3KV6 A;  3V43 A;  1Z60 A;  2JMJ A;  4FK5 A;  4A49 A;  1WES A;  5TRB A;  2L75 A;  1IYM A;  4LLB A;  2C2L A;  4N4F A;  5C13 A;  3N9Q A;  2KFT A;  3EB5 A;  1VYX A;  4UP0 A;  2L5U A;  3MHS A;  3HTK C;  2Y1M A;  2E6S A;  5D1M B;  5FEY A;  4BHW A;  4L58 A;  2FSA A;  2MD8 C;  5H9M A;  4C9Z A;  4MVT A;  5D1L B;  2JRJ A;  1WE9 A;  3SOX A;  2CT2 A;  1WEQ A;  2Y43 A;  4LJN A;  2ECT A;  2VNF A;  5H1U A;  3U5O A;  2ECN A;  3DQV R;  4LK9 A;  3U5N A;  1X4U A;  1VD4 A;  1HYJ A;  4ZDT A;  3EB6 A;  2YRE A;  3GV4 A;  3PUQ A;  3M99 A;  3PHD A;  1VFY A;  5TAB A;  2ECJ A;  1F62 A;  1XWH A;  1WEE A;  2QIC A;  3DPL R;  2VJE A;  2YQM A;  1JM7 B;  4WZ2 A;  2YQL A;  4YC9 A;  4IC2 A;  1MM3 A;  1U6G B;  1WGM A;  2MNY A;  5J3X A;  2F42 A;  4R8P K;  1CHC A;  2C2V S;  2MT5 A;  2YHN A;  2LXP C;  3ZYQ A;  2ECV A;  2CKL B;  5B77 A;  4UP5 A;  4GND A;  1G25 A;  3U5M A;  2YW8 A;  1RMD A;  4ZQL A;  3SOU A;  2FUI A;  2JMI A;  1E4U A;  2M1R A;  2L43 A;  3N9P A;  2VPE A;  2D8S A;  2YUC A;  5B79 A;  3SOW A;  2LDR A;  2HDP A;  1MM2 A;  3PUR A;  2BAY A;  2LXH C;  4I7B A;  3VK6 A;  3RPG C;  2KWO A;  3ZVY A;  2LRI C;  4YBM A;  2AN6 A;  2YHO A;  4QF2 A;  5TBN A;  4AVX A;  4AYC B;  1X4J A;  5B75 A;  2MD7 B;  3LQI A;  1WEV A;  3ZNI A;  1WFK A;  1WEP A;  4R7E A;  5LCW B;  2LQ6 A;  4S3O C;  5LKU A;  3T7L A;  2YYR A;  2XEU A;  1FBV A;  4NN2 A;  5H1T A;  3NG2 A;  2LGL A;  3KV5 A;  4MSX A;  3LQH A;  2I50 A;  3KNV A;  2H0D B;  3N9L A;  4UI9 B;  4W4U A;  2KGG A;  2LGK A;  4AP4 A;  4V3L C;  4GB0 A;  2K16 A;  4FO9 A;  3MHH A;  2G45 A;  3U5P A;  5C11 A;  2VJF B;  2YSJ A;  3O36 A;  1WEW A;  3ZTG A;  3N9M A;  4YAX A;  2KIZ A;  3ZPV E;  4LKA A;  2K4D A;  1FP0 A;  1WIL A;  4P5O B;  4CCG X;  1LDJ B;  3L1X A;  2EOD A;  3N9N A;  3O37 A;  2KGI A;  5AIT A;  5B78 A;  2RSD A;  3L11 A;  2MNZ A;  1Z6U A;  5JG6 A;  4BBQ A;  3HCS A;  2VP7 A;  3O7A A;  3IHP A;  3I2D A;  2YU4 A;  3O34 A;  5TDW A;  4B7Y C;  3C5K A;  3LRQ A;  1WEO A;  2VPG A;  3RPG B;  2G6Q A;  2F6J A;  4YAT A;  4ZUX U;  1X4I A;  4A0C D;  1ZBD B;  2KWK A;  2QJ0 A;  4X3G A;  5FB0 A;  1V87 A;  2PNX A;  2XB1 A;  2E6R A;  4A4C A;  3LQJ A;  2LN0 A;  4S3O B;  1WEN A;  2M6M A;  2M85 A;  4YBS A;  4GNE A;  2LV9 A;  1WIM A;  2L0B A;  4FIP A;  3M63 A;  4XI1 A;  2OXQ C;  5FER A;  4I7D A;  5G04 B;  4WZ3 B;  4L7X A;  4I7C A;  2ECG A;  1BOR A;  2RI7 A;  3KQI A;  5LKX A;  2UZG A;  1T1H A;  3T6R A;  4QF3 A;  2JMD A;  1JM7 A;  3O33 A;  2G43 A;  3HCU A;  2MUM A;  2VJE B;  3C6W A;  3HCT A;  5G05 B;  2IDA A;  3O70 A;  3ZPV 1;  5I3L A;  2CKL A;  5AIU A;  1K2F A;  4CA1 A;  1WEU A;  2KWJ A;  2ZET C;  4WZ0 A;  4TKP B;  2ECW A;  4YAD A;  2K17 A;  3FL2 A;  4GNG A;  5LKT A;  2MA5 A;  2Y1N A;  5B8D A;  3ASL A;  3L1Z B;  2KE1 A;  2KRE A;  4YAB A;  5KH3 A;  5KH7 A;  4V3K C;  1DVP A;  5FB1 A;  2KYU A;  4A4B A;  2K1J A;  2L80 A;  4R2Y A;  4N3W A;  4Q6F A;  2KR4 A;  4AYC A;  2FUU A;  5TDR A;  2EA6 A;  5EYA F;  5G0F A;  2LGG A;  5D1K B;  2MA6 A;  2KWN A;  1WEM A;  2CSY A;  2NAA A;  4O64 A;  1Z2Q A;  3O35 A;  4F52 B;  3SHB A;  3RTR B;  1N87 A;  2H0D A;  5DKA A;  2KU3 A;  4IC3 A;  2ECI A;  5DIN A;  2PUY A;  2YUR A;  2VJF A;  3N9O A;  2F6N A;  4LAD B;  4WA6 A;  5H1V A;  4GNF A;  2CSZ A;  2MIQ A;  2VPB A;  1JOC A;  5B76 A;  3GL6 A;  4AUQ B;  1HYI A;  3ZVZ B;  5LKZ A; 
#chains in the Genus database with same CATH topology
 1DCQ A;  2VPD A;  4PPE A;  4B86 C;  2QIZ A;  1LDK C;  2YSM A;  3M62 A;  4YBT A;  2HYE D;  2M3H A;  4PTB A;  4FJC A;  3QZV A;  5KH9 A;  2DX8 A;  2YT5 A;  2LGV A;  2EGP A;  3KV6 A;  3V43 A;  1Z60 A;  2L7P A;  2JMJ A;  4FK5 A;  4A49 A;  1WES A;  5TRB A;  2L75 A;  1IYM A;  4LLB A;  2C2L A;  4N4F A;  3MDB C;  3N9Q A;  5C13 A;  2KFT A;  3EB5 A;  1VYX A;  4UP0 A;  2L5U A;  3MHS A;  5SVI B;  3HTK C;  2Y1M A;  2CSV A;  2E6S A;  5D1M B;  5FEY A;  5K3Q A;  3E2D A;  3KDE C;  4Z0O A;  4BHW A;  4L58 A;  2FSA A;  2MD8 C;  5H9M A;  4OGE A;  4C9Z A;  4MVT A;  5D1L B;  2JRJ A;  1WE9 A;  2RR4 A;  3SOX A;  2CT2 A;  2CRW A;  2JUN A;  1WEQ A;  4LJN A;  2Y43 A;  4QQ4 A;  2ECT A;  2VNF A;  5H1U A;  2XP0 A;  3U5O A;  2ECN A;  3DQV R;  4LK9 A;  3U5N A;  1X4U A;  1VD4 A;  1HYJ A;  4ZDT A;  3EB6 A;  2YRE A;  3GV4 A;  3PUQ A;  3M99 A;  3PHD A;  1VFY A;  3Q1D A;  5TAB A;  2ECJ A;  1F62 A;  1XWH A;  3LVR E;  1WEE A;  5SVY A;  2QIC A;  3DPL R;  2VJE A;  2YVR A;  2YQM A;  1JM7 B;  4WZ2 A;  2YQL A;  4YC9 A;  4IC2 A;  1MM3 A;  1U6G B;  1WGM A;  2MNY A;  3JUE A;  5J3X A;  2F42 A;  4R8P K;  1CHC A;  1MBM A;  2C2V S;  2MT5 A;  2YHN A;  2LXP C;  3ZYQ A;  2ECV A;  2MKE A;  2CKL B;  5B77 A;  4UP5 A;  4GND A;  1G25 A;  3U5M A;  2YW8 A;  2B0O E;  1RMD A;  4ZQL A;  2OWA A;  3SOU A;  2E61 A;  2FUI A;  2JMI A;  1E4U A;  2M1R A;  2L43 A;  3N9P A;  2VPE A;  2D8S A;  2YUC A;  5B79 A;  3SOW A;  3H7H A;  2LDR A;  2HDP A;  1MM2 A;  2DJA A;  3PUR A;  3LJU X;  2BAY A;  2LXH C;  4I7B A;  3VK6 A;  3RPG C;  2KWO A;  3ZVY A;  2LRI C;  4YBM A;  2FD4 A;  2KKX A;  2AN6 A;  2YHO A;  4QF2 A;  5TBN A;  4AVX A;  4AYC B;  1X4J A;  5B75 A;  2MD7 B;  3LQI A;  1WEV A;  3ZNI A;  1WFK A;  1WEP A;  4R7E A;  5LCW B;  2LQ6 A;  4S3O C;  5LKU A;  3T7L A;  2YYR A;  2XEU A;  2IQJ A;  1FBV A;  2M13 A;  4NN2 A;  5H1T A;  3NG2 A;  2LGL A;  3KV5 A;  4MSX A;  3LQH A;  2I50 A;  3KNV A;  2H0D B;  3N9L A;  4UI9 B;  4W4U A;  2KGG A;  2LGK A;  4AP4 A;  4V3L C;  4GB0 A;  2K16 A;  4FO9 A;  3MHH A;  2G45 A;  3U5P A;  3DDT A;  5C11 A;  2VJF B;  2YSJ A;  3O36 A;  1WEW A;  3ZTG A;  3N9M A;  4YAX A;  2KIZ A;  3ZPV E;  4LKA A;  2XOY A;  2K4D A;  1FP0 A;  2EGM A;  1WIL A;  4P5O B;  4CCG X;  1LDJ B;  3L1X A;  2EOD A;  3N9N A;  3O37 A;  2KGI A;  5AIT A;  5B78 A;  2RSD A;  3L11 A;  2MNZ A;  2DSM A;  1Z6U A;  5JG6 A;  2EXU A;  4BBQ A;  3HCS A;  2VP7 A;  3O7A A;  3IHP A;  3I2D A;  2YU4 A;  3O34 A;  3FM8 C;  5TDW A;  4B7Y C;  3C5K A;  3LRQ A;  1WEO A;  2VPG A;  3RPG B;  2G6Q A;  2F6J A;  4YAT A;  4ZUX U;  1X4I A;  5SVI A;  4A0C D;  1ZBD B;  2KWK A;  2QJ0 A;  4X3G A;  3T9K A;  5FB0 A;  1V87 A;  2PNX A;  2XB1 A;  4OGC A;  2E6R A;  4A4C A;  3LQJ A;  2XOZ A;  2LN0 A;  3LVQ E;  4S3O B;  1WEN A;  3SUB A;  2M6M A;  2M85 A;  4YBS A;  4GNE A;  2LV9 A;  1WIM A;  4F1P A;  5SVX A;  2L0B A;  4FIP A;  3M63 A;  4XI1 A;  2OXQ C;  5FER A;  4I7D A;  5G04 B;  4WZ3 B;  4L7X A;  4I7C A;  4Z0R A;  2ECG A;  1BOR A;  2RI7 A;  3KQI A;  5LKX A;  2UZG A;  1T1H A;  3T6R A;  4QF3 A;  2JMD A;  3FEH A;  1JM7 A;  3O33 A;  2G43 A;  3DWD A;  2JM3 A;  3HCU A;  2MUM A;  3FJU B;  3O47 A;  2VJE B;  3C6W A;  3HCT A;  5G05 B;  2IDA A;  3O70 A;  3ZPV 1;  5I3L A;  2CKL A;  5AIU A;  1K2F A;  4CA1 A;  1WEU A;  2KWJ A;  2ZET C;  4WZ0 A;  4TKP B;  2ECW A;  2CON A;  2KKY A;  4YAD A;  2K17 A;  3FL2 A;  4GNG A;  5LKT A;  2MA5 A;  2D8U A;  2Y1N A;  5B8D A;  3ASL A;  4H9D A;  4O62 A;  3L1Z B;  2KE1 A;  2KRE A;  4YAB A;  5KH3 A;  5KH7 A;  4V3K C;  1DVP A;  5FB1 A;  2KYU A;  2FFW A;  4A4B A;  2K1J A;  2L80 A;  4R2Y A;  4N3W A;  4Q6F A;  2KR4 A;  4AYC A;  2P57 A;  2FUU A;  5TDR A;  2EA6 A;  5EYA F;  3M7K A;  5G0F A;  2LGG A;  5D1K B;  2MA6 A;  2KWN A;  3PLW A;  1WEM A;  2CSY A;  2NAA A;  2CRR A;  4O64 A;  1Z2Q A;  3O35 A;  4F52 B;  3SHB A;  3RTR B;  1N87 A;  2H0D A;  5DKA A;  2KU3 A;  2XOC A;  4IC3 A;  2ECI A;  5DIN A;  3LDY A;  3FAN A;  3FAO A;  2PUY A;  2YUR A;  2VJF A;  3N9O A;  2F6N A;  4LAD B;  4WA6 A;  5H1V A;  4GNF A;  2CSZ A;  2MIQ A;  2VPB A;  1JOC A;  5B76 A;  3GL6 A;  4AUQ B;  1HYI A;  3ZVZ B;  2LAU A;  5LKZ A; 
#chains in the Genus database with same CATH homology
 2VPD A;  4PPE A;  4B86 C;  2QIZ A;  1LDK C;  2YSM A;  3M62 A;  4YBT A;  2HYE D;  2M3H A;  4PTB A;  4FJC A;  3QZV A;  5KH9 A;  2DX8 A;  2YT5 A;  2LGV A;  2EGP A;  3KV6 A;  3V43 A;  1Z60 A;  2JMJ A;  4FK5 A;  4A49 A;  1WES A;  5TRB A;  2L75 A;  1IYM A;  4LLB A;  2C2L A;  4N4F A;  5C13 A;  3N9Q A;  2KFT A;  3EB5 A;  1VYX A;  4UP0 A;  2L5U A;  3MHS A;  3HTK C;  2Y1M A;  2E6S A;  5D1M B;  5FEY A;  4BHW A;  4L58 A;  2FSA A;  2MD8 C;  5H9M A;  4C9Z A;  4MVT A;  5D1L B;  2JRJ A;  1WE9 A;  3SOX A;  2CT2 A;  1WEQ A;  2Y43 A;  4LJN A;  2ECT A;  2VNF A;  5H1U A;  3U5O A;  2ECN A;  3DQV R;  4LK9 A;  3U5N A;  1X4U A;  1VD4 A;  1HYJ A;  4ZDT A;  3EB6 A;  2YRE A;  3GV4 A;  3PUQ A;  3M99 A;  3PHD A;  1VFY A;  5TAB A;  2ECJ A;  1F62 A;  1XWH A;  1WEE A;  2QIC A;  3DPL R;  2VJE A;  2YQM A;  1JM7 B;  4WZ2 A;  2YQL A;  4YC9 A;  4IC2 A;  1MM3 A;  1U6G B;  1WGM A;  2MNY A;  5J3X A;  2F42 A;  4R8P K;  1CHC A;  2C2V S;  2MT5 A;  2YHN A;  2LXP C;  3ZYQ A;  2ECV A;  2CKL B;  5B77 A;  4UP5 A;  4GND A;  1G25 A;  3U5M A;  2YW8 A;  1RMD A;  4ZQL A;  3SOU A;  2FUI A;  2JMI A;  1E4U A;  2M1R A;  2L43 A;  3N9P A;  2VPE A;  2D8S A;  2YUC A;  5B79 A;  3SOW A;  2LDR A;  2HDP A;  1MM2 A;  3PUR A;  2BAY A;  2LXH C;  4I7B A;  3VK6 A;  3RPG C;  2KWO A;  3ZVY A;  2LRI C;  4YBM A;  2AN6 A;  2YHO A;  4QF2 A;  5TBN A;  4AVX A;  4AYC B;  1X4J A;  5B75 A;  2MD7 B;  3LQI A;  1WEV A;  3ZNI A;  1WFK A;  1WEP A;  4R7E A;  5LCW B;  2LQ6 A;  4S3O C;  5LKU A;  3T7L A;  2YYR A;  2XEU A;  1FBV A;  4NN2 A;  5H1T A;  3NG2 A;  2LGL A;  3KV5 A;  4MSX A;  3LQH A;  2I50 A;  3KNV A;  2H0D B;  3N9L A;  4UI9 B;  4W4U A;  2KGG A;  2LGK A;  4AP4 A;  4V3L C;  4GB0 A;  2K16 A;  4FO9 A;  3MHH A;  2G45 A;  3U5P A;  5C11 A;  2VJF B;  2YSJ A;  3O36 A;  1WEW A;  3ZTG A;  3N9M A;  4YAX A;  2KIZ A;  3ZPV E;  4LKA A;  2K4D A;  1FP0 A;  1WIL A;  4P5O B;  4CCG X;  1LDJ B;  3L1X A;  2EOD A;  3N9N A;  3O37 A;  2KGI A;  5AIT A;  5B78 A;  2RSD A;  3L11 A;  2MNZ A;  1Z6U A;  5JG6 A;  4BBQ A;  3HCS A;  2VP7 A;  3O7A A;  3IHP A;  3I2D A;  2YU4 A;  3O34 A;  5TDW A;  4B7Y C;  3C5K A;  3LRQ A;  1WEO A;  2VPG A;  3RPG B;  2G6Q A;  2F6J A;  4YAT A;  4ZUX U;  1X4I A;  4A0C D;  1ZBD B;  2KWK A;  2QJ0 A;  4X3G A;  5FB0 A;  1V87 A;  2PNX A;  2XB1 A;  2E6R A;  4A4C A;  3LQJ A;  2LN0 A;  4S3O B;  1WEN A;  2M6M A;  2M85 A;  4YBS A;  4GNE A;  2LV9 A;  1WIM A;  2L0B A;  4FIP A;  3M63 A;  4XI1 A;  2OXQ C;  5FER A;  4I7D A;  5G04 B;  4WZ3 B;  4L7X A;  4I7C A;  2ECG A;  1BOR A;  2RI7 A;  3KQI A;  5LKX A;  2UZG A;  1T1H A;  3T6R A;  4QF3 A;  2JMD A;  1JM7 A;  3O33 A;  2G43 A;  3HCU A;  2MUM A;  2VJE B;  3C6W A;  3HCT A;  5G05 B;  2IDA A;  3O70 A;  3ZPV 1;  5I3L A;  2CKL A;  5AIU A;  1K2F A;  4CA1 A;  1WEU A;  2KWJ A;  2ZET C;  4WZ0 A;  4TKP B;  2ECW A;  4YAD A;  2K17 A;  3FL2 A;  4GNG A;  5LKT A;  2MA5 A;  2Y1N A;  5B8D A;  3ASL A;  3L1Z B;  2KE1 A;  2KRE A;  4YAB A;  5KH3 A;  5KH7 A;  4V3K C;  1DVP A;  5FB1 A;  2KYU A;  4A4B A;  2K1J A;  2L80 A;  4R2Y A;  4N3W A;  4Q6F A;  2KR4 A;  4AYC A;  2FUU A;  5TDR A;  2EA6 A;  5EYA F;  5G0F A;  2LGG A;  5D1K B;  2MA6 A;  2KWN A;  1WEM A;  2CSY A;  2NAA A;  4O64 A;  1Z2Q A;  3O35 A;  4F52 B;  3SHB A;  3RTR B;  1N87 A;  2H0D A;  5DKA A;  2KU3 A;  4IC3 A;  2ECI A;  5DIN A;  2PUY A;  2YUR A;  2VJF A;  3N9O A;  2F6N A;  4LAD B;  4WA6 A;  5H1V A;  4GNF A;  2CSZ A;  2MIQ A;  2VPB A;  1JOC A;  5B76 A;  3GL6 A;  4AUQ B;  1HYI A;  3ZVZ B;  5LKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...