3NG2A

Crystal structure of the rnf4 ring domain dimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
RPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RING finger protein 4
publication title RING domain dimerization is essential for RNF4 function
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 10
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3ng2A00
3SOUA 2LRIC 5EYAF 1Z2QA 4A0CD 2VPBA 3C5KA 2KWJA 4YABA 1X4UA 2YHNA 4QF2A 3SOXA 2LXHC 3PURA 3KV5A 4YBSA 1JOCA 1MM3A 4A4BA 4WZ3B 2JMIA 2KE1A 2XEUA 4ZQLA 2ECWA 3C6WA 2L80A 4BBQA 2AN6A 3M62A 2G45A 2L5UA 1WIMA 3M99A 1WE9A 4YBTA 2L75A 5B78A 4FK5A 5H1UA 4MSXA 1FBVA 4YAXA 3NG2A 4FO9A 4V3KC 2VJFA 3HCSA 1WEQA 2KGIA 2MD8C 2H0DB 4WZ2A 1IYMA 2LN0A 5H1TA 4O64A 2M1RA 3O7AA 2CKLA 2KREA 2M85A 4GB0A 2KWNA 2YQMA 4YBMA 3N9NA 5FB1A 2YSMA 5TABA 2ECNA 3IHPA 3U5OA 2MA6A 4AYCB 3L1XA 1U6GB 4TKPB 2CSZA 3LQHA 4LKAA 2PNXA 3MHSA 3QZVA 4R8PK 2DX8A 4I7BA 3U5MA 3KV6A 5TRBA 5B79A 3RPGC 1WILA 1RMDA 4LLBA 4A4CA 1MM2A 3KQIA 2MA5A 2KGGA 4IC2A 2QJ0A 2M3HA 2L0BA 2RI7A 5AITA 5H1VA 4GNFA 2EA6A 2YU4A 5JG6A 2YREA 5LKUA 3DPLR 4NN2A 4B86C 3LQIA 3ZVZB 3U5PA 4X3GA 3GV4A 2RSDA 4R7EA 1WGMA 3SHBA 5G04B 5TBNA 5B76A 2JRJA 2VPDA 1DVPA 3VK6A 1WESA 4S3OB 2C2VS 5TDRA 4R2YA 2K1JA 5H9MA 3EB6A 5AIUA 1WEWA 1VD4A 2FSAA 4CCGX 5C11A 2F42A 2VPEA 3PHDA 2F6JA 3T6RA 2F6NA 2KWOA 3FL2A 2VP7A 4UP0A 4BHWA 3HCUA 2FUIA 2VJEA 1Z6UA 2KWKA 2ECTA 4WA6A 2YURA 3SOWA 4AP4A 2M6MA 3ZVYA 4FJCA 4S3OC 1HYJA 5B77A 2YUCA 3U5NA 2EGPA 4LJNA 2KYUA 3O36A 2VNFA 3ZYQA 2ECVA 2G6QA 1WEVA 2HYED 4B7YC 1T1HA 2LGGA 4UP5A 4FIPA 2G43A 1WEEA 2VJFB 3RPGB 4L58A 2MNZA 3ZNIA 4AUQB 1WEMA 5D1MB 2NAAA 3RTRB 5I3LA 2CKLB 4IC3A 5LKTA 2HDPA 2LGVA 2FUUA 3EB5A 3O35A 2UZGA 2YT5A 3O34A 2KIZA 1WENA 5G05B 3M63A 4UI9B 4YC9A 5TDWA 1WEOA 5FERA 1JM7A 3L11A 2IDAA 5B75A 2QICA 4Q6FA 1G25A 3V43A 1VFYA 2KU3A 1LDJB 1HYIA 2ECGA 3O33A 4P5OB 5DINA 5D1KB 2D8SA 5KH9A 2CT2A 3ASLA 4XI1A 4N3WA 5LCWB 4N4FA 3MHHA 1WFKA 4I7DA 4LK9A 4L7XA 2E6SA 2LXPC 3GL6A 2BAYA 4W4UA 2KFTA 2EODA 1CHCA 4AVXA 2JMDA 2YSJA 2YQLA 3O70A 2I50A 4A49A 3HCTA 2K17A 3O37A 4PTBA 4PPEA 1LDKC 4ZUXU 3ZPV1 4C9ZA 2QIZA 1Z60A 2JMJA 4YADA 2LV9A 2L43A 2PUYA 4V3LC 3HTKC 3N9MA 2Y1NA 4MVTA 1ZBDB 5DKAA 3LRQA 2ECIA 4WZ0A 2ZETC 1V87A 2E6RA 5FB0A 4QF3A 4CA1A 2LDRA 5LKXA 2XB1A 2OXQC 4LADB 2H0DA 4F52B 2MNYA 2MIQA 3ZTGA 2Y1MA 2VJEB 2YHOA 2LGKA 1E4UA 2K4DA 2LQ6A 4I7CA 2C2LA 3T7LA 5D1LB 5G0FA 2YW8A 4ZDTA 1F62A 3N9OA 4AYCA 1VYXA 5J3XA 1WEUA 2LGLA 2ECJA 4YATA 3N9PA 5LKZA 1X4IA 5FEYA 5C13A 1BORA 2CSYA 2Y43A 2VPGA 5KH3A 2KR4A 2MT5A 1N87A 1XWHA 1K2FA 4GNDA 1WEPA 1X4JA 4GNEA 3N9LA 5KH7A 4GNGA 3PUQA 1FP0A 1JM7B 2MUMA 3KNVA 3ZPVE 3LQJA 5B8DA 3L1ZB 2MD7B 3DQVR 2K16A 2YYRA 3N9QA 3I2DA
chains in the Genus database with same CATH superfamily
3SOUA 2LRIC 2EGMA 5EYAF 1Z2QA 4A0CD 2VPBA 3C5KA 2KWJA 4YABA 1X4UA 2YHNA 4QF2A 3SOXA 2LXHC 3PURA 3KV5A 4YBSA 1JOCA 1MM3A 4A4BA 4WZ3B 2JMIA 2KE1A 2XEUA 4ZQLA 5SVIB 2ECWA 3FEHA 3LJUX 3C6WA 2L80A 4BBQA 2AN6A 3M62A 2CONA 2DJAA 2G45A 2L5UA 1WIMA 3M99A 1WE9A 4YBTA 2L75A 5B78A 4FK5A 5H1UA 4MSXA 1FBVA 4YAXA 3NG2A 4FO9A 4V3KC 2VJFA 3HCSA 2XOZA 1WEQA 2KGIA 2MD8C 2H0DB 3PLWA 4WZ2A 1IYMA 2LN0A 5H1TA 4O64A 2M1RA 3O7AA 2CKLA 2XOYA 2KREA 2M85A 4GB0A 2KWNA 2YQMA 4YBMA 3N9NA 5FB1A 2RR4A 2YSMA 5TABA 2ECNA 4Z0RA 3IHPA 3U5OA 2MA6A 4AYCB 3L1XA 1U6GB 4TKPB 2CSZA 3LQHA 4LKAA 2PNXA 3MHSA 3LVRE 3QZVA 4R8PK 2DX8A 4I7BA 3U5MA 3KV6A 5TRBA 5B79A 2DSMA 3RPGC 1WILA 1RMDA 4LLBA 4OGCA 4A4CA 1MM2A 3KQIA 2MA5A 2CRRA 2KGGA 4IC2A 2QJ0A 2M3HA 2L0BA 2RI7A 2B0OE 5AITA 5H1VA 4GNFA 2EA6A 2YU4A 5JG6A 2OWAA 2FFWA 2YREA 5LKUA 3DPLR 4NN2A 4B86C 3LQIA 3ZVZB 3U5PA 4X3GA 3GV4A 2KKYA 2RSDA 4R7EA 1WGMA 2XOCA 3SHBA 5G04B 5TBNA 5B76A 2D8UA 2JRJA 2VPDA 3FAOA 1DVPA 3VK6A 1WESA 4S3OB 2C2VS 5TDRA 5K3QA 4R2YA 2K1JA 5H9MA 3EB6A 5AIUA 2XP0A 1WEWA 1VD4A 4OGEA 2FSAA 4CCGX 5C11A 2F42A 2VPEA 3PHDA 2F6JA 3T6RA 2F6NA 2KWOA 3FM8C 3FL2A 2VP7A 4UP0A 4BHWA 3HCUA 2FUIA 2VJEA 1Z6UA 2KWKA 2ECTA 4WA6A 2YURA 3SOWA 3JUEA 4AP4A 2IQJA 2M6MA 3ZVYA 4FJCA 4S3OC 3KDEC 1HYJA 5B77A 2YUCA 3U5NA 2EGPA 4LJNA 2KYUA 3O36A 2VNFA 3ZYQA 2ECVA 2G6QA 3E2DA 1WEVA 2HYED 4B7YC 1T1HA 2LGGA 4UP5A 4FIPA 2G43A 1WEEA 4H9DA 2VJFB 3RPGB 4L58A 1MBMA 2MNZA 3ZNIA 4O62A 4AUQB 1WEMA 5D1MB 2NAAA 3RTRB 5I3LA 2CKLB 4IC3A 5LKTA 2HDPA 2LGVA 2FUUA 3O47A 3EB5A 3O35A 2UZGA 2YT5A 3O34A 2E61A 1WENA 2KIZA 5G05B 3M63A 4UI9B 4YC9A 5TDWA 1WEOA 5FERA 1JM7A 3L11A 2IDAA 5B75A 2QICA 4Q6FA 1G25A 3V43A 1VFYA 2KU3A 1LDJB 1HYIA 2ECGA 3O33A 2KKXA 4P5OB 5DINA 5D1KB 2D8SA 5KH9A 4F1PA 2CT2A 3ASLA 4XI1A 2L7PA 4N3WA 5LCWB 4N4FA 3MHHA 4QQ4A 1WFKA 4I7DA 4LK9A 4L7XA 2E6SA 2LXPC 3GL6A 3Q1DA 2BAYA 4W4UA 2KFTA 2EODA 1CHCA 2CRWA 4AVXA 2JMDA 2YSJA 2YQLA 3O70A 2I50A 4A49A 3HCTA 2K17A 3O37A 3FANA 4PTBA 3H7HA 5SVIA 4PPEA 1LDKC 4ZUXU 3ZPV1 4C9ZA 2QIZA 3DDTA 1Z60A 2JMJA 4YADA 3T9KA 2LV9A 5SVYA 2EXUA 2L43A 1DCQA 2PUYA 4V3LC 3HTKC 3N9MA 2Y1NA 4MVTA 1ZBDB 2JUNA 5DKAA 3LRQA 2ECIA 4WZ0A 2ZETC 1V87A 3LDYA 2E6RA 5FB0A 4QF3A 2CSVA 4CA1A 2LDRA 3MDBC 4Z0OA 5LKXA 2XB1A 3M7KA 2OXQC 3DWDA 3LVQE 4LADB 2H0DA 5SVXA 4F52B 2MNYA 2LAUA 2MIQA 3ZTGA 2Y1MA 2VJEB 2YHOA 2LGKA 1E4UA 2K4DA 2FD4A 2JM3A 2YVRA 2LQ6A 4I7CA 2C2LA 3T7LA 5D1LB 5G0FA 2YW8A 4ZDTA 1F62A 3N9OA 4AYCA 1VYXA 5J3XA 1WEUA 2LGLA 2ECJA 4YATA 3N9PA 2M13A 5LKZA 1X4IA 5FEYA 5C13A 1BORA 2CSYA 2Y43A 3FJUB 2VPGA 5KH3A 2KR4A 2MT5A 1N87A 3SUBA 1XWHA 1K2FA 4GNDA 1WEPA 1X4JA 4GNEA 3N9LA 5KH7A 4GNGA 3PUQA 1FP0A 1JM7B 2MUMA 3KNVA 3ZPVE 3LQJA 5B8DA 3L1ZB 2MD7B 3DQVR 2K16A 2P57A 2YYRA 3N9QA 3I2DA 2MKEA
chains in the Genus database with same CATH topology
3SOUA 2LRIC 5EYAF 1Z2QA 4A0CD 2VPBA 3C5KA 2KWJA 4YABA 1X4UA 2YHNA 4QF2A 3SOXA 2LXHC 3PURA 3KV5A 4YBSA 1JOCA 1MM3A 4A4BA 4WZ3B 2JMIA 2KE1A 2XEUA 4ZQLA 2ECWA 3C6WA 2L80A 4BBQA 2AN6A 3M62A 2G45A 2L5UA 1WIMA 3M99A 1WE9A 4YBTA 2L75A 5B78A 4FK5A 5H1UA 4MSXA 1FBVA 4YAXA 3NG2A 4FO9A 4V3KC 2VJFA 3HCSA 1WEQA 2KGIA 2MD8C 2H0DB 4WZ2A 1IYMA 2LN0A 5H1TA 4O64A 2M1RA 3O7AA 2CKLA 2KREA 2M85A 4GB0A 2KWNA 2YQMA 4YBMA 3N9NA 5FB1A 2YSMA 5TABA 2ECNA 3IHPA 3U5OA 2MA6A 4AYCB 3L1XA 1U6GB 4TKPB 2CSZA 3LQHA 4LKAA 2PNXA 3MHSA 3QZVA 4R8PK 2DX8A 4I7BA 3U5MA 3KV6A 5TRBA 5B79A 3RPGC 1WILA 1RMDA 4LLBA 4A4CA 1MM2A 3KQIA 2MA5A 2KGGA 4IC2A 2QJ0A 2M3HA 2L0BA 2RI7A 5AITA 5H1VA 4GNFA 2EA6A 2YU4A 5JG6A 2YREA 5LKUA 3DPLR 4NN2A 4B86C 3LQIA 3ZVZB 3U5PA 4X3GA 3GV4A 2RSDA 4R7EA 1WGMA 3SHBA 5G04B 5TBNA 5B76A 2JRJA 2VPDA 1DVPA 3VK6A 1WESA 4S3OB 2C2VS 5TDRA 4R2YA 2K1JA 5H9MA 3EB6A 5AIUA 1WEWA 1VD4A 2FSAA 4CCGX 5C11A 2F42A 2VPEA 3PHDA 2F6JA 3T6RA 2F6NA 2KWOA 3FL2A 2VP7A 4UP0A 4BHWA 3HCUA 2FUIA 2VJEA 1Z6UA 2KWKA 2ECTA 4WA6A 2YURA 3SOWA 4AP4A 2M6MA 3ZVYA 4FJCA 4S3OC 1HYJA 5B77A 2YUCA 3U5NA 2EGPA 4LJNA 2KYUA 3O36A 2VNFA 3ZYQA 2ECVA 2G6QA 1WEVA 2HYED 4B7YC 1T1HA 2LGGA 4UP5A 4FIPA 2G43A 1WEEA 2VJFB 3RPGB 4L58A 2MNZA 3ZNIA 4AUQB 1WEMA 5D1MB 2NAAA 3RTRB 5I3LA 2CKLB 4IC3A 5LKTA 2HDPA 2LGVA 2FUUA 3EB5A 3O35A 2UZGA 2YT5A 3O34A 2KIZA 1WENA 5G05B 3M63A 4UI9B 4YC9A 5TDWA 1WEOA 5FERA 1JM7A 3L11A 2IDAA 5B75A 2QICA 4Q6FA 1G25A 3V43A 1VFYA 2KU3A 1LDJB 1HYIA 2ECGA 3O33A 4P5OB 5DINA 5D1KB 2D8SA 5KH9A 2CT2A 3ASLA 4XI1A 4N3WA 5LCWB 4N4FA 3MHHA 1WFKA 4I7DA 4LK9A 4L7XA 2E6SA 2LXPC 3GL6A 2BAYA 4W4UA 2KFTA 2EODA 1CHCA 4AVXA 2JMDA 2YSJA 2YQLA 3O70A 2I50A 4A49A 3HCTA 2K17A 3O37A 4PTBA 4PPEA 1LDKC 4ZUXU 3ZPV1 4C9ZA 2QIZA 1Z60A 2JMJA 4YADA 2LV9A 2L43A 2PUYA 4V3LC 3HTKC 3N9MA 2Y1NA 4MVTA 1ZBDB 5DKAA 3LRQA 2ECIA 4WZ0A 2ZETC 1V87A 2E6RA 5FB0A 4QF3A 4CA1A 2LDRA 5LKXA 2XB1A 2OXQC 4LADB 2H0DA 4F52B 2MNYA 2MIQA 3ZTGA 2Y1MA 2VJEB 2YHOA 2LGKA 1E4UA 2K4DA 2LQ6A 4I7CA 2C2LA 3T7LA 5D1LB 5G0FA 2YW8A 4ZDTA 1F62A 3N9OA 4AYCA 1VYXA 5J3XA 1WEUA 2LGLA 2ECJA 4YATA 3N9PA 5LKZA 1X4IA 5FEYA 5C13A 1BORA 2CSYA 2Y43A 2VPGA 5KH3A 2KR4A 2MT5A 1N87A 1XWHA 1K2FA 4GNDA 1WEPA 1X4JA 4GNEA 3N9LA 5KH7A 4GNGA 3PUQA 1FP0A 1JM7B 2MUMA 3KNVA 3ZPVE 3LQJA 5B8DA 3L1ZB 2MD7B 3DQVR 2K16A 2YYRA 3N9QA 3I2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOU A;  2LRI C;  5EYA F;  1Z2Q A;  4A0C D;  2VPB A;  3C5K A;  2KWJ A;  4YAB A;  1X4U A;  2YHN A;  4QF2 A;  3SOX A;  2LXH C;  3PUR A;  3KV5 A;  4YBS A;  1JOC A;  1MM3 A;  4A4B A;  4WZ3 B;  2JMI A;  2KE1 A;  2XEU A;  4ZQL A;  2ECW A;  3C6W A;  2L80 A;  4BBQ A;  2AN6 A;  3M62 A;  2G45 A;  2L5U A;  1WIM A;  3M99 A;  1WE9 A;  4YBT A;  2L75 A;  5B78 A;  4FK5 A;  5H1U A;  4MSX A;  1FBV A;  4YAX A;  3NG2 A;  4FO9 A;  4V3K C;  2VJF A;  3HCS A;  1WEQ A;  2KGI A;  2MD8 C;  2H0D B;  4WZ2 A;  1IYM A;  2LN0 A;  5H1T A;  4O64 A;  2M1R A;  3O7A A;  2CKL A;  2KRE A;  2M85 A;  4GB0 A;  2KWN A;  2YQM A;  4YBM A;  3N9N A;  5FB1 A;  2YSM A;  5TAB A;  2ECN A;  3IHP A;  3U5O A;  2MA6 A;  4AYC B;  3L1X A;  1U6G B;  4TKP B;  2CSZ A;  3LQH A;  4LKA A;  2PNX A;  3MHS A;  3QZV A;  4R8P K;  2DX8 A;  4I7B A;  3U5M A;  3KV6 A;  5TRB A;  5B79 A;  3RPG C;  1WIL A;  1RMD A;  4LLB A;  4A4C A;  1MM2 A;  3KQI A;  2MA5 A;  2KGG A;  4IC2 A;  2QJ0 A;  2M3H A;  2L0B A;  2RI7 A;  5AIT A;  5H1V A;  4GNF A;  2EA6 A;  2YU4 A;  5JG6 A;  2YRE A;  5LKU A;  3DPL R;  4NN2 A;  4B86 C;  3LQI A;  3ZVZ B;  3U5P A;  4X3G A;  3GV4 A;  2RSD A;  4R7E A;  1WGM A;  3SHB A;  5G04 B;  5TBN A;  5B76 A;  2JRJ A;  2VPD A;  1DVP A;  3VK6 A;  1WES A;  4S3O B;  2C2V S;  5TDR A;  4R2Y A;  2K1J A;  5H9M A;  3EB6 A;  5AIU A;  1WEW A;  1VD4 A;  2FSA A;  4CCG X;  5C11 A;  2F42 A;  2VPE A;  3PHD A;  2F6J A;  3T6R A;  2F6N A;  2KWO A;  3FL2 A;  2VP7 A;  4UP0 A;  4BHW A;  3HCU A;  2FUI A;  2VJE A;  1Z6U A;  2KWK A;  2ECT A;  4WA6 A;  2YUR A;  3SOW A;  4AP4 A;  2M6M A;  3ZVY A;  4FJC A;  4S3O C;  1HYJ A;  5B77 A;  2YUC A;  3U5N A;  2EGP A;  4LJN A;  2KYU A;  3O36 A;  2VNF A;  3ZYQ A;  2ECV A;  2G6Q A;  1WEV A;  2HYE D;  4B7Y C;  1T1H A;  2LGG A;  4UP5 A;  4FIP A;  2G43 A;  1WEE A;  2VJF B;  3RPG B;  4L58 A;  2MNZ A;  3ZNI A;  4AUQ B;  1WEM A;  5D1M B;  2NAA A;  3RTR B;  5I3L A;  2CKL B;  4IC3 A;  5LKT A;  2HDP A;  2LGV A;  2FUU A;  3EB5 A;  3O35 A;  2UZG A;  2YT5 A;  3O34 A;  2KIZ A;  1WEN A;  5G05 B;  3M63 A;  4UI9 B;  4YC9 A;  5TDW A;  1WEO A;  5FER A;  1JM7 A;  3L11 A;  2IDA A;  5B75 A;  2QIC A;  4Q6F A;  1G25 A;  3V43 A;  1VFY A;  2KU3 A;  1LDJ B;  1HYI A;  2ECG A;  3O33 A;  4P5O B;  5DIN A;  5D1K B;  2D8S A;  5KH9 A;  2CT2 A;  3ASL A;  4XI1 A;  4N3W A;  5LCW B;  4N4F A;  3MHH A;  1WFK A;  4I7D A;  4LK9 A;  4L7X A;  2E6S A;  2LXP C;  3GL6 A;  2BAY A;  4W4U A;  2KFT A;  2EOD A;  1CHC A;  4AVX A;  2JMD A;  2YSJ A;  2YQL A;  3O70 A;  2I50 A;  4A49 A;  3HCT A;  2K17 A;  3O37 A;  4PTB A;  4PPE A;  1LDK C;  4ZUX U;  3ZPV 1;  4C9Z A;  2QIZ A;  1Z60 A;  2JMJ A;  4YAD A;  2LV9 A;  2L43 A;  2PUY A;  4V3L C;  3HTK C;  3N9M A;  2Y1N A;  4MVT A;  1ZBD B;  5DKA A;  3LRQ A;  2ECI A;  4WZ0 A;  2ZET C;  1V87 A;  2E6R A;  5FB0 A;  4QF3 A;  4CA1 A;  2LDR A;  5LKX A;  2XB1 A;  2OXQ C;  4LAD B;  2H0D A;  4F52 B;  2MNY A;  2MIQ A;  3ZTG A;  2Y1M A;  2VJE B;  2YHO A;  2LGK A;  1E4U A;  2K4D A;  2LQ6 A;  4I7C A;  2C2L A;  3T7L A;  5D1L B;  5G0F A;  2YW8 A;  4ZDT A;  1F62 A;  3N9O A;  4AYC A;  1VYX A;  5J3X A;  1WEU A;  2LGL A;  2ECJ A;  4YAT A;  3N9P A;  5LKZ A;  1X4I A;  5FEY A;  5C13 A;  1BOR A;  2CSY A;  2Y43 A;  2VPG A;  5KH3 A;  2KR4 A;  2MT5 A;  1N87 A;  1XWH A;  1K2F A;  4GND A;  1WEP A;  1X4J A;  4GNE A;  3N9L A;  5KH7 A;  4GNG A;  3PUQ A;  1FP0 A;  1JM7 B;  2MUM A;  3KNV A;  3ZPV E;  3LQJ A;  5B8D A;  3L1Z B;  2MD7 B;  3DQV R;  2K16 A;  2YYR A;  3N9Q A;  3I2D A; 
#chains in the Genus database with same CATH topology
 3SOU A;  2LRI C;  2EGM A;  5EYA F;  1Z2Q A;  4A0C D;  2VPB A;  3C5K A;  2KWJ A;  4YAB A;  1X4U A;  2YHN A;  4QF2 A;  3SOX A;  2LXH C;  3PUR A;  3KV5 A;  4YBS A;  1JOC A;  1MM3 A;  4A4B A;  4WZ3 B;  2JMI A;  2KE1 A;  2XEU A;  4ZQL A;  5SVI B;  2ECW A;  3FEH A;  3LJU X;  3C6W A;  2L80 A;  4BBQ A;  2AN6 A;  3M62 A;  2CON A;  2DJA A;  2G45 A;  2L5U A;  1WIM A;  3M99 A;  1WE9 A;  4YBT A;  2L75 A;  5B78 A;  4FK5 A;  5H1U A;  4MSX A;  1FBV A;  4YAX A;  3NG2 A;  4FO9 A;  4V3K C;  2VJF A;  3HCS A;  2XOZ A;  1WEQ A;  2KGI A;  2MD8 C;  2H0D B;  3PLW A;  4WZ2 A;  1IYM A;  2LN0 A;  5H1T A;  4O64 A;  2M1R A;  3O7A A;  2CKL A;  2XOY A;  2KRE A;  2M85 A;  4GB0 A;  2KWN A;  2YQM A;  4YBM A;  3N9N A;  5FB1 A;  2RR4 A;  2YSM A;  5TAB A;  2ECN A;  4Z0R A;  3IHP A;  3U5O A;  2MA6 A;  4AYC B;  3L1X A;  1U6G B;  4TKP B;  2CSZ A;  3LQH A;  4LKA A;  2PNX A;  3MHS A;  3LVR E;  3QZV A;  4R8P K;  2DX8 A;  4I7B A;  3U5M A;  3KV6 A;  5TRB A;  5B79 A;  2DSM A;  3RPG C;  1WIL A;  1RMD A;  4LLB A;  4OGC A;  4A4C A;  1MM2 A;  3KQI A;  2MA5 A;  2CRR A;  2KGG A;  4IC2 A;  2QJ0 A;  2M3H A;  2L0B A;  2RI7 A;  2B0O E;  5AIT A;  5H1V A;  4GNF A;  2EA6 A;  2YU4 A;  5JG6 A;  2OWA A;  2FFW A;  2YRE A;  5LKU A;  3DPL R;  4NN2 A;  4B86 C;  3LQI A;  3ZVZ B;  3U5P A;  4X3G A;  3GV4 A;  2KKY A;  2RSD A;  4R7E A;  1WGM A;  2XOC A;  3SHB A;  5G04 B;  5TBN A;  5B76 A;  2D8U A;  2JRJ A;  2VPD A;  3FAO A;  1DVP A;  3VK6 A;  1WES A;  4S3O B;  2C2V S;  5TDR A;  5K3Q A;  4R2Y A;  2K1J A;  5H9M A;  3EB6 A;  5AIU A;  2XP0 A;  1WEW A;  1VD4 A;  4OGE A;  2FSA A;  4CCG X;  5C11 A;  2F42 A;  2VPE A;  3PHD A;  2F6J A;  3T6R A;  2F6N A;  2KWO A;  3FM8 C;  3FL2 A;  2VP7 A;  4UP0 A;  4BHW A;  3HCU A;  2FUI A;  2VJE A;  1Z6U A;  2KWK A;  2ECT A;  4WA6 A;  2YUR A;  3SOW A;  3JUE A;  4AP4 A;  2IQJ A;  2M6M A;  3ZVY A;  4FJC A;  4S3O C;  3KDE C;  1HYJ A;  5B77 A;  2YUC A;  3U5N A;  2EGP A;  4LJN A;  2KYU A;  3O36 A;  2VNF A;  3ZYQ A;  2ECV A;  2G6Q A;  3E2D A;  1WEV A;  2HYE D;  4B7Y C;  1T1H A;  2LGG A;  4UP5 A;  4FIP A;  2G43 A;  1WEE A;  4H9D A;  2VJF B;  3RPG B;  4L58 A;  1MBM A;  2MNZ A;  3ZNI A;  4O62 A;  4AUQ B;  1WEM A;  5D1M B;  2NAA A;  3RTR B;  5I3L A;  2CKL B;  4IC3 A;  5LKT A;  2HDP A;  2LGV A;  2FUU A;  3O47 A;  3EB5 A;  3O35 A;  2UZG A;  2YT5 A;  3O34 A;  2E61 A;  1WEN A;  2KIZ A;  5G05 B;  3M63 A;  4UI9 B;  4YC9 A;  5TDW A;  1WEO A;  5FER A;  1JM7 A;  3L11 A;  2IDA A;  5B75 A;  2QIC A;  4Q6F A;  1G25 A;  3V43 A;  1VFY A;  2KU3 A;  1LDJ B;  1HYI A;  2ECG A;  3O33 A;  2KKX A;  4P5O B;  5DIN A;  5D1K B;  2D8S A;  5KH9 A;  4F1P A;  2CT2 A;  3ASL A;  4XI1 A;  2L7P A;  4N3W A;  5LCW B;  4N4F A;  3MHH A;  4QQ4 A;  1WFK A;  4I7D A;  4LK9 A;  4L7X A;  2E6S A;  2LXP C;  3GL6 A;  3Q1D A;  2BAY A;  4W4U A;  2KFT A;  2EOD A;  1CHC A;  2CRW A;  4AVX A;  2JMD A;  2YSJ A;  2YQL A;  3O70 A;  2I50 A;  4A49 A;  3HCT A;  2K17 A;  3O37 A;  3FAN A;  4PTB A;  3H7H A;  5SVI A;  4PPE A;  1LDK C;  4ZUX U;  3ZPV 1;  4C9Z A;  2QIZ A;  3DDT A;  1Z60 A;  2JMJ A;  4YAD A;  3T9K A;  2LV9 A;  5SVY A;  2EXU A;  2L43 A;  1DCQ A;  2PUY A;  4V3L C;  3HTK C;  3N9M A;  2Y1N A;  4MVT A;  1ZBD B;  2JUN A;  5DKA A;  3LRQ A;  2ECI A;  4WZ0 A;  2ZET C;  1V87 A;  3LDY A;  2E6R A;  5FB0 A;  4QF3 A;  2CSV A;  4CA1 A;  2LDR A;  3MDB C;  4Z0O A;  5LKX A;  2XB1 A;  3M7K A;  2OXQ C;  3DWD A;  3LVQ E;  4LAD B;  2H0D A;  5SVX A;  4F52 B;  2MNY A;  2LAU A;  2MIQ A;  3ZTG A;  2Y1M A;  2VJE B;  2YHO A;  2LGK A;  1E4U A;  2K4D A;  2FD4 A;  2JM3 A;  2YVR A;  2LQ6 A;  4I7C A;  2C2L A;  3T7L A;  5D1L B;  5G0F A;  2YW8 A;  4ZDT A;  1F62 A;  3N9O A;  4AYC A;  1VYX A;  5J3X A;  1WEU A;  2LGL A;  2ECJ A;  4YAT A;  3N9P A;  2M13 A;  5LKZ A;  1X4I A;  5FEY A;  5C13 A;  1BOR A;  2CSY A;  2Y43 A;  3FJU B;  2VPG A;  5KH3 A;  2KR4 A;  2MT5 A;  1N87 A;  3SUB A;  1XWH A;  1K2F A;  4GND A;  1WEP A;  1X4J A;  4GNE A;  3N9L A;  5KH7 A;  4GNG A;  3PUQ A;  1FP0 A;  1JM7 B;  2MUM A;  3KNV A;  3ZPV E;  3LQJ A;  5B8D A;  3L1Z B;  2MD7 B;  3DQV R;  2K16 A;  2P57 A;  2YYR A;  3N9Q A;  3I2D A;  2MKE A; 
#chains in the Genus database with same CATH homology
 3SOU A;  2LRI C;  5EYA F;  1Z2Q A;  4A0C D;  2VPB A;  3C5K A;  2KWJ A;  4YAB A;  1X4U A;  2YHN A;  4QF2 A;  3SOX A;  2LXH C;  3PUR A;  3KV5 A;  4YBS A;  1JOC A;  1MM3 A;  4A4B A;  4WZ3 B;  2JMI A;  2KE1 A;  2XEU A;  4ZQL A;  2ECW A;  3C6W A;  2L80 A;  4BBQ A;  2AN6 A;  3M62 A;  2G45 A;  2L5U A;  1WIM A;  3M99 A;  1WE9 A;  4YBT A;  2L75 A;  5B78 A;  4FK5 A;  5H1U A;  4MSX A;  1FBV A;  4YAX A;  3NG2 A;  4FO9 A;  4V3K C;  2VJF A;  3HCS A;  1WEQ A;  2KGI A;  2MD8 C;  2H0D B;  4WZ2 A;  1IYM A;  2LN0 A;  5H1T A;  4O64 A;  2M1R A;  3O7A A;  2CKL A;  2KRE A;  2M85 A;  4GB0 A;  2KWN A;  2YQM A;  4YBM A;  3N9N A;  5FB1 A;  2YSM A;  5TAB A;  2ECN A;  3IHP A;  3U5O A;  2MA6 A;  4AYC B;  3L1X A;  1U6G B;  4TKP B;  2CSZ A;  3LQH A;  4LKA A;  2PNX A;  3MHS A;  3QZV A;  4R8P K;  2DX8 A;  4I7B A;  3U5M A;  3KV6 A;  5TRB A;  5B79 A;  3RPG C;  1WIL A;  1RMD A;  4LLB A;  4A4C A;  1MM2 A;  3KQI A;  2MA5 A;  2KGG A;  4IC2 A;  2QJ0 A;  2M3H A;  2L0B A;  2RI7 A;  5AIT A;  5H1V A;  4GNF A;  2EA6 A;  2YU4 A;  5JG6 A;  2YRE A;  5LKU A;  3DPL R;  4NN2 A;  4B86 C;  3LQI A;  3ZVZ B;  3U5P A;  4X3G A;  3GV4 A;  2RSD A;  4R7E A;  1WGM A;  3SHB A;  5G04 B;  5TBN A;  5B76 A;  2JRJ A;  2VPD A;  1DVP A;  3VK6 A;  1WES A;  4S3O B;  2C2V S;  5TDR A;  4R2Y A;  2K1J A;  5H9M A;  3EB6 A;  5AIU A;  1WEW A;  1VD4 A;  2FSA A;  4CCG X;  5C11 A;  2F42 A;  2VPE A;  3PHD A;  2F6J A;  3T6R A;  2F6N A;  2KWO A;  3FL2 A;  2VP7 A;  4UP0 A;  4BHW A;  3HCU A;  2FUI A;  2VJE A;  1Z6U A;  2KWK A;  2ECT A;  4WA6 A;  2YUR A;  3SOW A;  4AP4 A;  2M6M A;  3ZVY A;  4FJC A;  4S3O C;  1HYJ A;  5B77 A;  2YUC A;  3U5N A;  2EGP A;  4LJN A;  2KYU A;  3O36 A;  2VNF A;  3ZYQ A;  2ECV A;  2G6Q A;  1WEV A;  2HYE D;  4B7Y C;  1T1H A;  2LGG A;  4UP5 A;  4FIP A;  2G43 A;  1WEE A;  2VJF B;  3RPG B;  4L58 A;  2MNZ A;  3ZNI A;  4AUQ B;  1WEM A;  5D1M B;  2NAA A;  3RTR B;  5I3L A;  2CKL B;  4IC3 A;  5LKT A;  2HDP A;  2LGV A;  2FUU A;  3EB5 A;  3O35 A;  2UZG A;  2YT5 A;  3O34 A;  2KIZ A;  1WEN A;  5G05 B;  3M63 A;  4UI9 B;  4YC9 A;  5TDW A;  1WEO A;  5FER A;  1JM7 A;  3L11 A;  2IDA A;  5B75 A;  2QIC A;  4Q6F A;  1G25 A;  3V43 A;  1VFY A;  2KU3 A;  1LDJ B;  1HYI A;  2ECG A;  3O33 A;  4P5O B;  5DIN A;  5D1K B;  2D8S A;  5KH9 A;  2CT2 A;  3ASL A;  4XI1 A;  4N3W A;  5LCW B;  4N4F A;  3MHH A;  1WFK A;  4I7D A;  4LK9 A;  4L7X A;  2E6S A;  2LXP C;  3GL6 A;  2BAY A;  4W4U A;  2KFT A;  2EOD A;  1CHC A;  4AVX A;  2JMD A;  2YSJ A;  2YQL A;  3O70 A;  2I50 A;  4A49 A;  3HCT A;  2K17 A;  3O37 A;  4PTB A;  4PPE A;  1LDK C;  4ZUX U;  3ZPV 1;  4C9Z A;  2QIZ A;  1Z60 A;  2JMJ A;  4YAD A;  2LV9 A;  2L43 A;  2PUY A;  4V3L C;  3HTK C;  3N9M A;  2Y1N A;  4MVT A;  1ZBD B;  5DKA A;  3LRQ A;  2ECI A;  4WZ0 A;  2ZET C;  1V87 A;  2E6R A;  5FB0 A;  4QF3 A;  4CA1 A;  2LDR A;  5LKX A;  2XB1 A;  2OXQ C;  4LAD B;  2H0D A;  4F52 B;  2MNY A;  2MIQ A;  3ZTG A;  2Y1M A;  2VJE B;  2YHO A;  2LGK A;  1E4U A;  2K4D A;  2LQ6 A;  4I7C A;  2C2L A;  3T7L A;  5D1L B;  5G0F A;  2YW8 A;  4ZDT A;  1F62 A;  3N9O A;  4AYC A;  1VYX A;  5J3X A;  1WEU A;  2LGL A;  2ECJ A;  4YAT A;  3N9P A;  5LKZ A;  1X4I A;  5FEY A;  5C13 A;  1BOR A;  2CSY A;  2Y43 A;  2VPG A;  5KH3 A;  2KR4 A;  2MT5 A;  1N87 A;  1XWH A;  1K2F A;  4GND A;  1WEP A;  1X4J A;  4GNE A;  3N9L A;  5KH7 A;  4GNG A;  3PUQ A;  1FP0 A;  1JM7 B;  2MUM A;  3KNV A;  3ZPV E;  3LQJ A;  5B8D A;  3L1Z B;  2MD7 B;  3DQV R;  2K16 A;  2YYR A;  3N9Q A;  3I2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...