5B78A

Crystal structure of moz double phd finger mutant-s210d/n235r in complex with histone h3 crotonylation at k14
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
SLPHEKDKPVAEPIPICDFCLGTKEQNREKKPEELISCADCGRSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
total genus 29
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b78A00
2MT5A 1LDKC 3T7LA 4XI1A 5H1VA 3L1ZB 5TDRA 3L1XA 2LXPC 2PNXA 2KE1A 4GNFA 2ECNA 2KWJA 4UP5A 2EA6A 1WGMA 2AN6A 5LKTA 5D1MB 2DX8A 2CKLA 4ZDTA 3VK6A 1JOCA 3M62A 2RSDA 1WESA 2MNYA 1BORA 2KYUA 3DQVR 4YBTA 1WE9A 3O36A 4GNEA 2FSAA 2MA5A 3O7AA 2ECIA 2MA6A 5FB1A 2QICA 5AITA 4I7BA 4QF2A 4A0CD 3SOXA 2MD8C 1VYXA 4V3KC 2ECJA 4MVTA 4PTBA 5C13A 3PURA 4GNDA 3LQHA 2BAYA 2LGKA 3KQIA 5B79A 3ASLA 5TBNA 4A4CA 3QZVA 1WEEA 4YATA 4B86C 2M3HA 5TDWA 5LKXA 1T1HA 2LRIC 1LDJB 3GV4A 3KNVA 2YSMA 2MUMA 1JM7A 5TRBA 1FP0A 3HCTA 5G0FA 2VJEB 3U5NA 2CT2A 4CA1A 2FUIA 5H9MA 2JMIA 4S3OB 2E6SA 3ZTGA 2L5UA 2MNZA 2L43A 3LRQA 2YSJA 4L58A 2MD7B 3ZYQA 3HCSA 2M6MA 1WEWA 2F6NA 4IC3A 3U5OA 4WZ3B 2VP7A 2LV9A 5AIUA 1DVPA 2F6JA 4BBQA 5B8DA 2C2VS 1RMDA 2VPDA 5H1TA 5B75A 2ZETC 5LCWB 2VPBA 3KV6A 4MSXA 1X4JA 4L7XA 5J3XA 3M63A 2VPEA 2EGPA 4FO9A 1WEMA 4YAXA 3U5PA 3N9PA 1WENA 3PHDA 2I50A 2EODA 4B7YC 2LGGA 5D1KB 1WFKA 4YC9A 2OXQC 3KV5A 2C2LA 2L80A 4AVXA 2L0BA 4IC2A 2XEUA 1XWHA 4NN2A 4FK5A 4CCGX 4S3OC 3LQIA 2HYED 2VJFB 2YURA 2YU4A 2G43A 5DINA 3EB6A 4QF3A 1HYJA 3GL6A 3U5MA 4WZ2A 3MHSA 5B78A 2Y1NA 3O35A 2HDPA 5DKAA 2VJEA 4F52B 4LJNA 1HYIA 4LADB 5D1LB 3O37A 1WEQA 2KREA 4ZQLA 2ECVA 1FBVA 4BHWA 3N9QA 4N3WA 2YQMA 2Y43A 1MM2A 2YW8A 3LQJA 2VJFA 4A4BA 3N9MA 2VPGA 2KGGA 2YQLA 2KWOA 3SOWA 2VNFA 4YABA 3RPGC 2Y1MA 1G25A 4LK9A 4I7CA 2JMJA 3ZVYA 2YUCA 3ZPVE 4R7EA 2KGIA 4WZ0A 3ZVZB 2YT5A 1U6GB 2KFTA 5I3LA 2QJ0A 3RPGB 1WEUA 4W4UA 2K17A 3PUQA 1N87A 2JMDA 3SHBA 1E4UA 3C5KA 3O33A 4LLBA 4TKPB 3N9NA 2K16A 1VD4A 4PPEA 2KIZA 1WIMA 2M1RA 5G04B 4UP0A 2CSZA 4AP4A 3M99A 2IDAA 1WEOA 3MHHA 4AYCB 2M85A 4UI9B 3RTRB 4FIPA 2XB1A 4YBMA 1Z6UA 2FUUA 5LKZA 5TABA 2G6QA 2MIQA 2RI7A 2NAAA 2ECWA 4X3GA 1WEVA 4FJCA 3FL2A 3HTKC 2LDRA 2CKLB 5H1UA 5KH7A 5KH3A 4AYCA 2YHNA 1F62A 5FEYA 2JRJA 2KR4A 2ECGA 5B76A 3HCUA 4O64A 2LXHC 3IHPA 3O70A 3I2DA 4P5OB 3ZPV1 5B77A 2YHOA 1MM3A 4A49A 1V87A 3T6RA 2G45A 4YADA 2YREA 4C9ZA 2H0DA 1CHCA 4R8PK 3N9OA 2CSYA 5FB0A 1ZBDB 5FERA 2LN0A 3EB5A 2D8SA 1WEPA 5EYAF 4ZUXU 3C6WA 2KU3A 2ECTA 4V3LC 3ZNIA 5LKUA 2PUYA 3N9LA 2K1JA 2K4DA 2LQ6A 3V43A 2E6RA 3NG2A 3SOUA 4GNGA 4N4FA 3DPLR 2LGLA 4AUQB 4YBSA 4R2YA 1VFYA 1K2FA 2UZGA 4GB0A 1X4IA 5KH9A 1Z60A 4WA6A 1JM7B 1X4UA 2H0DB 4Q6FA 2LGVA 4I7DA 1WILA 5JG6A 5C11A 2QIZA 2KWNA 2YYRA 1IYMA 2L75A 1Z2QA 2F42A 5G05B 4LKAA 2KWKA 3O34A 3L11A
chains in the Genus database with same CATH superfamily
2MT5A 1LDKC 3T7LA 4XI1A 5H1VA 3L1ZB 5TDRA 3L1XA 2LXPC 2PNXA 2KE1A 4GNFA 2ECNA 3FJUB 2KWJA 3Q1DA 4UP5A 2EA6A 1WGMA 2AN6A 2E61A 5LKTA 5D1MB 2FFWA 2DX8A 2CKLA 2KKXA 2IQJA 4ZDTA 3VK6A 1JOCA 3M62A 2RSDA 1WESA 2MNYA 1BORA 3PLWA 2KYUA 3DQVR 4YBTA 1WE9A 3O36A 4OGEA 2EXUA 4GNEA 2FSAA 2MA5A 3O7AA 2ECIA 2MA6A 5FB1A 2QICA 5AITA 4I7BA 4QF2A 4A0CD 3SOXA 3JUEA 2MD8C 1VYXA 4V3KC 2ECJA 4MVTA 4PTBA 5C13A 3PURA 4GNDA 3LQHA 2BAYA 2LGKA 2XOCA 3KQIA 3MDBC 5B79A 3ASLA 5TBNA 4A4CA 3QZVA 1WEEA 4YATA 4B86C 2M3HA 5TDWA 5LKXA 1T1HA 2LRIC 1LDJB 3GV4A 2P57A 3KNVA 2YSMA 3DDTA 2MUMA 1JM7A 2D8UA 5TRBA 1FP0A 3HCTA 5G0FA 2VJEB 3U5NA 2XP0A 2CT2A 4CA1A 2FUIA 5H9MA 2JMIA 3LVRE 4S3OB 2E6SA 2RR4A 3ZTGA 2L5UA 2L7PA 2MNZA 2L43A 3LRQA 2YSJA 3FANA 4L58A 2MD7B 3ZYQA 3HCSA 2M6MA 3T9KA 1WEWA 2F6NA 4IC3A 3U5OA 4WZ3B 2VP7A 2LV9A 3H7HA 2JUNA 5AIUA 1DVPA 2F6JA 4H9DA 4BBQA 5B8DA 2C2VS 1RMDA 2VPDA 5H1TA 5B75A 3KDEC 2ZETC 5LCWB 2VPBA 4F1PA 2LAUA 3KV6A 4MSXA 1X4JA 4L7XA 5J3XA 3M63A 2VPEA 4Z0OA 2EGPA 4FO9A 1WEMA 4YAXA 3SUBA 3U5PA 3N9PA 1WENA 3PHDA 2I50A 2EODA 3O47A 4B7YC 5D1KB 2LGGA 1WFKA 4YC9A 5SVIB 2OXQC 3KV5A 2C2LA 2L80A 4AVXA 3LJUX 2L0BA 2B0OE 4IC2A 2XEUA 1XWHA 4NN2A 4FK5A 4CCGX 4S3OC 3LQIA 2HYED 2VJFB 2YURA 2YU4A 2G43A 5DINA 3EB6A 4QF3A 2CSVA 1HYJA 3FM8C 3E2DA 3GL6A 3U5MA 4WZ2A 3MHSA 5B78A 2Y1NA 3O35A 2CRRA 2HDPA 5DKAA 2VJEA 3FAOA 4F52B 4LJNA 1HYIA 4LADB 5D1LB 3O37A 1WEQA 2KREA 4ZQLA 1DCQA 2ECVA 1FBVA 2CRWA 4BHWA 3N9QA 4N3WA 2YQMA 2Y43A 1MM2A 2YW8A 3LQJA 5SVXA 2VJFA 3FEHA 3N9MA 4A4BA 2VPGA 2KGGA 2YQLA 2KWOA 3SOWA 2VNFA 4YABA 3RPGC 2Y1MA 1G25A 4LK9A 4I7CA 2JMJA 3ZVYA 2YUCA 3ZPVE 4R7EA 2KGIA 4WZ0A 3ZVZB 2YT5A 3LDYA 1U6GB 2KFTA 5I3LA 2QJ0A 3LVQE 3RPGB 1WEUA 4W4UA 2K17A 3PUQA 1N87A 2JMDA 4OGCA 3SHBA 1E4UA 3C5KA 3O33A 4LLBA 4TKPB 3N9NA 2K16A 1VD4A 4PPEA 2KIZA 1WIMA 1MBMA 2M1RA 5G04B 2KKYA 4UP0A 2CSZA 4AP4A 3M99A 2IDAA 1WEOA 2FD4A 3MHHA 4AYCB 2M85A 4UI9B 3RTRB 4FIPA 2XB1A 4YBMA 1Z6UA 2XOYA 2DJAA 5SVIA 4O62A 2FUUA 5LKZA 5TABA 2G6QA 2MIQA 2M13A 2RI7A 2NAAA 2ECWA 3DWDA 4X3GA 5SVYA 1WEVA 4FJCA 3FL2A 3HTKC 2LDRA 2XOZA 2CKLB 5H1UA 5KH7A 5KH3A 4AYCA 2YHNA 2MKEA 1F62A 5FEYA 2JRJA 2KR4A 2ECGA 2YVRA 5B76A 3HCUA 4O64A 2LXHC 3IHPA 3O70A 3I2DA 4P5OB 3ZPV1 5B77A 2YHOA 1MM3A 4A49A 4Z0RA 1V87A 3T6RA 2G45A 4YADA 2YREA 4C9ZA 2H0DA 1CHCA 4R8PK 2CONA 3N9OA 2JM3A 2CSYA 5FB0A 1ZBDB 5FERA 2LN0A 3EB5A 2D8SA 1WEPA 5EYAF 4ZUXU 3C6WA 2KU3A 2ECTA 4V3LC 5K3QA 3ZNIA 5LKUA 2OWAA 2PUYA 3N9LA 2K1JA 2K4DA 2LQ6A 3V43A 3M7KA 2E6RA 3NG2A 3SOUA 4GNGA 4N4FA 3DPLR 2LGLA 4AUQB 4YBSA 4QQ4A 4R2YA 2DSMA 1VFYA 1K2FA 2UZGA 4GB0A 1X4IA 5KH9A 1Z60A 4WA6A 1JM7B 1X4UA 2H0DB 4Q6FA 2LGVA 4I7DA 1WILA 5JG6A 5C11A 2QIZA 2KWNA 2YYRA 1IYMA 2L75A 1Z2QA 2F42A 5G05B 2EGMA 4LKAA 2KWKA 3O34A 3L11A
chains in the Genus database with same CATH topology
2MT5A 1LDKC 3T7LA 4XI1A 5H1VA 3L1ZB 5TDRA 3L1XA 2LXPC 2PNXA 2KE1A 4GNFA 2ECNA 2KWJA 4UP5A 2EA6A 1WGMA 2AN6A 5LKTA 5D1MB 2DX8A 2CKLA 4ZDTA 3VK6A 1JOCA 3M62A 2RSDA 1WESA 2MNYA 1BORA 2KYUA 3DQVR 4YBTA 1WE9A 3O36A 4GNEA 2FSAA 2MA5A 3O7AA 2ECIA 2MA6A 5FB1A 2QICA 5AITA 4I7BA 4QF2A 4A0CD 3SOXA 2MD8C 1VYXA 4V3KC 2ECJA 4MVTA 4PTBA 5C13A 3PURA 4GNDA 3LQHA 2BAYA 2LGKA 3KQIA 5B79A 3ASLA 5TBNA 4A4CA 3QZVA 1WEEA 4YATA 4B86C 2M3HA 5TDWA 5LKXA 1T1HA 2LRIC 1LDJB 3GV4A 3KNVA 2YSMA 2MUMA 1JM7A 5TRBA 1FP0A 3HCTA 5G0FA 2VJEB 3U5NA 2CT2A 4CA1A 2FUIA 5H9MA 2JMIA 4S3OB 2E6SA 3ZTGA 2L5UA 2MNZA 2L43A 3LRQA 2YSJA 4L58A 2MD7B 3ZYQA 3HCSA 2M6MA 1WEWA 2F6NA 4IC3A 3U5OA 4WZ3B 2VP7A 2LV9A 5AIUA 1DVPA 2F6JA 4BBQA 5B8DA 2C2VS 1RMDA 2VPDA 5H1TA 5B75A 2ZETC 5LCWB 2VPBA 3KV6A 4MSXA 1X4JA 4L7XA 5J3XA 3M63A 2VPEA 2EGPA 4FO9A 1WEMA 4YAXA 3U5PA 3N9PA 1WENA 3PHDA 2I50A 2EODA 4B7YC 2LGGA 5D1KB 1WFKA 4YC9A 2OXQC 3KV5A 2C2LA 2L80A 4AVXA 2L0BA 4IC2A 2XEUA 1XWHA 4NN2A 4FK5A 4CCGX 4S3OC 3LQIA 2HYED 2VJFB 2YURA 2YU4A 2G43A 5DINA 3EB6A 4QF3A 1HYJA 3GL6A 3U5MA 4WZ2A 3MHSA 5B78A 2Y1NA 3O35A 2HDPA 5DKAA 2VJEA 4F52B 4LJNA 1HYIA 4LADB 5D1LB 3O37A 1WEQA 2KREA 4ZQLA 2ECVA 1FBVA 4BHWA 3N9QA 4N3WA 2YQMA 2Y43A 1MM2A 2YW8A 3LQJA 2VJFA 4A4BA 3N9MA 2VPGA 2KGGA 2YQLA 2KWOA 3SOWA 2VNFA 4YABA 3RPGC 2Y1MA 1G25A 4LK9A 4I7CA 2JMJA 3ZVYA 2YUCA 3ZPVE 4R7EA 2KGIA 4WZ0A 3ZVZB 2YT5A 1U6GB 2KFTA 5I3LA 2QJ0A 3RPGB 1WEUA 4W4UA 2K17A 3PUQA 1N87A 2JMDA 3SHBA 1E4UA 3C5KA 3O33A 4LLBA 4TKPB 3N9NA 2K16A 1VD4A 4PPEA 2KIZA 1WIMA 2M1RA 5G04B 4UP0A 2CSZA 4AP4A 3M99A 2IDAA 1WEOA 3MHHA 4AYCB 2M85A 4UI9B 3RTRB 4FIPA 2XB1A 4YBMA 1Z6UA 2FUUA 5LKZA 5TABA 2G6QA 2MIQA 2RI7A 2NAAA 2ECWA 4X3GA 1WEVA 4FJCA 3FL2A 3HTKC 2LDRA 2CKLB 5H1UA 5KH7A 5KH3A 4AYCA 2YHNA 1F62A 5FEYA 2JRJA 2KR4A 2ECGA 5B76A 3HCUA 4O64A 2LXHC 3IHPA 3O70A 3I2DA 4P5OB 3ZPV1 5B77A 2YHOA 1MM3A 4A49A 1V87A 3T6RA 2G45A 4YADA 2YREA 4C9ZA 2H0DA 1CHCA 4R8PK 3N9OA 2CSYA 5FB0A 1ZBDB 5FERA 2LN0A 3EB5A 2D8SA 1WEPA 5EYAF 4ZUXU 3C6WA 2KU3A 2ECTA 4V3LC 3ZNIA 5LKUA 2PUYA 3N9LA 2K1JA 2K4DA 2LQ6A 3V43A 2E6RA 3NG2A 3SOUA 4GNGA 4N4FA 3DPLR 2LGLA 4AUQB 4YBSA 4R2YA 1VFYA 1K2FA 2UZGA 4GB0A 1X4IA 5KH9A 1Z60A 4WA6A 1JM7B 1X4UA 2H0DB 4Q6FA 2LGVA 4I7DA 1WILA 5JG6A 5C11A 2QIZA 2KWNA 2YYRA 1IYMA 2L75A 1Z2QA 2F42A 5G05B 4LKAA 2KWKA 3O34A 3L11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MT5 A;  1LDK C;  3T7L A;  4XI1 A;  5H1V A;  3L1Z B;  5TDR A;  3L1X A;  2LXP C;  2PNX A;  2KE1 A;  4GNF A;  2ECN A;  2KWJ A;  4UP5 A;  2EA6 A;  1WGM A;  2AN6 A;  5LKT A;  5D1M B;  2DX8 A;  2CKL A;  4ZDT A;  3VK6 A;  1JOC A;  3M62 A;  2RSD A;  1WES A;  2MNY A;  1BOR A;  2KYU A;  3DQV R;  4YBT A;  1WE9 A;  3O36 A;  4GNE A;  2FSA A;  2MA5 A;  3O7A A;  2ECI A;  2MA6 A;  5FB1 A;  2QIC A;  5AIT A;  4I7B A;  4QF2 A;  4A0C D;  3SOX A;  2MD8 C;  1VYX A;  4V3K C;  2ECJ A;  4MVT A;  4PTB A;  5C13 A;  3PUR A;  4GND A;  3LQH A;  2BAY A;  2LGK A;  3KQI A;  5B79 A;  3ASL A;  5TBN A;  4A4C A;  3QZV A;  1WEE A;  4YAT A;  4B86 C;  2M3H A;  5TDW A;  5LKX A;  1T1H A;  2LRI C;  1LDJ B;  3GV4 A;  3KNV A;  2YSM A;  2MUM A;  1JM7 A;  5TRB A;  1FP0 A;  3HCT A;  5G0F A;  2VJE B;  3U5N A;  2CT2 A;  4CA1 A;  2FUI A;  5H9M A;  2JMI A;  4S3O B;  2E6S A;  3ZTG A;  2L5U A;  2MNZ A;  2L43 A;  3LRQ A;  2YSJ A;  4L58 A;  2MD7 B;  3ZYQ A;  3HCS A;  2M6M A;  1WEW A;  2F6N A;  4IC3 A;  3U5O A;  4WZ3 B;  2VP7 A;  2LV9 A;  5AIU A;  1DVP A;  2F6J A;  4BBQ A;  5B8D A;  2C2V S;  1RMD A;  2VPD A;  5H1T A;  5B75 A;  2ZET C;  5LCW B;  2VPB A;  3KV6 A;  4MSX A;  1X4J A;  4L7X A;  5J3X A;  3M63 A;  2VPE A;  2EGP A;  4FO9 A;  1WEM A;  4YAX A;  3U5P A;  3N9P A;  1WEN A;  3PHD A;  2I50 A;  2EOD A;  4B7Y C;  2LGG A;  5D1K B;  1WFK A;  4YC9 A;  2OXQ C;  3KV5 A;  2C2L A;  2L80 A;  4AVX A;  2L0B A;  4IC2 A;  2XEU A;  1XWH A;  4NN2 A;  4FK5 A;  4CCG X;  4S3O C;  3LQI A;  2HYE D;  2VJF B;  2YUR A;  2YU4 A;  2G43 A;  5DIN A;  3EB6 A;  4QF3 A;  1HYJ A;  3GL6 A;  3U5M A;  4WZ2 A;  3MHS A;  5B78 A;  2Y1N A;  3O35 A;  2HDP A;  5DKA A;  2VJE A;  4F52 B;  4LJN A;  1HYI A;  4LAD B;  5D1L B;  3O37 A;  1WEQ A;  2KRE A;  4ZQL A;  2ECV A;  1FBV A;  4BHW A;  3N9Q A;  4N3W A;  2YQM A;  2Y43 A;  1MM2 A;  2YW8 A;  3LQJ A;  2VJF A;  4A4B A;  3N9M A;  2VPG A;  2KGG A;  2YQL A;  2KWO A;  3SOW A;  2VNF A;  4YAB A;  3RPG C;  2Y1M A;  1G25 A;  4LK9 A;  4I7C A;  2JMJ A;  3ZVY A;  2YUC A;  3ZPV E;  4R7E A;  2KGI A;  4WZ0 A;  3ZVZ B;  2YT5 A;  1U6G B;  2KFT A;  5I3L A;  2QJ0 A;  3RPG B;  1WEU A;  4W4U A;  2K17 A;  3PUQ A;  1N87 A;  2JMD A;  3SHB A;  1E4U A;  3C5K A;  3O33 A;  4LLB A;  4TKP B;  3N9N A;  2K16 A;  1VD4 A;  4PPE A;  2KIZ A;  1WIM A;  2M1R A;  5G04 B;  4UP0 A;  2CSZ A;  4AP4 A;  3M99 A;  2IDA A;  1WEO A;  3MHH A;  4AYC B;  2M85 A;  4UI9 B;  3RTR B;  4FIP A;  2XB1 A;  4YBM A;  1Z6U A;  2FUU A;  5LKZ A;  5TAB A;  2G6Q A;  2MIQ A;  2RI7 A;  2NAA A;  2ECW A;  4X3G A;  1WEV A;  4FJC A;  3FL2 A;  3HTK C;  2LDR A;  2CKL B;  5H1U A;  5KH7 A;  5KH3 A;  4AYC A;  2YHN A;  1F62 A;  5FEY A;  2JRJ A;  2KR4 A;  2ECG A;  5B76 A;  3HCU A;  4O64 A;  2LXH C;  3IHP A;  3O70 A;  3I2D A;  4P5O B;  3ZPV 1;  5B77 A;  2YHO A;  1MM3 A;  4A49 A;  1V87 A;  3T6R A;  2G45 A;  4YAD A;  2YRE A;  4C9Z A;  2H0D A;  1CHC A;  4R8P K;  3N9O A;  2CSY A;  5FB0 A;  1ZBD B;  5FER A;  2LN0 A;  3EB5 A;  2D8S A;  1WEP A;  5EYA F;  4ZUX U;  3C6W A;  2KU3 A;  2ECT A;  4V3L C;  3ZNI A;  5LKU A;  2PUY A;  3N9L A;  2K1J A;  2K4D A;  2LQ6 A;  3V43 A;  2E6R A;  3NG2 A;  3SOU A;  4GNG A;  4N4F A;  3DPL R;  2LGL A;  4AUQ B;  4YBS A;  4R2Y A;  1VFY A;  1K2F A;  2UZG A;  4GB0 A;  1X4I A;  5KH9 A;  1Z60 A;  4WA6 A;  1JM7 B;  1X4U A;  2H0D B;  4Q6F A;  2LGV A;  4I7D A;  1WIL A;  5JG6 A;  5C11 A;  2QIZ A;  2KWN A;  2YYR A;  1IYM A;  2L75 A;  1Z2Q A;  2F42 A;  5G05 B;  4LKA A;  2KWK A;  3O34 A;  3L11 A; 
#chains in the Genus database with same CATH topology
 2MT5 A;  1LDK C;  3T7L A;  4XI1 A;  5H1V A;  3L1Z B;  5TDR A;  3L1X A;  2LXP C;  2PNX A;  2KE1 A;  4GNF A;  2ECN A;  3FJU B;  2KWJ A;  3Q1D A;  4UP5 A;  2EA6 A;  1WGM A;  2AN6 A;  2E61 A;  5LKT A;  5D1M B;  2FFW A;  2DX8 A;  2CKL A;  2KKX A;  2IQJ A;  4ZDT A;  3VK6 A;  1JOC A;  3M62 A;  2RSD A;  1WES A;  2MNY A;  1BOR A;  3PLW A;  2KYU A;  3DQV R;  4YBT A;  1WE9 A;  3O36 A;  4OGE A;  2EXU A;  4GNE A;  2FSA A;  2MA5 A;  3O7A A;  2ECI A;  2MA6 A;  5FB1 A;  2QIC A;  5AIT A;  4I7B A;  4QF2 A;  4A0C D;  3SOX A;  3JUE A;  2MD8 C;  1VYX A;  4V3K C;  2ECJ A;  4MVT A;  4PTB A;  5C13 A;  3PUR A;  4GND A;  3LQH A;  2BAY A;  2LGK A;  2XOC A;  3KQI A;  3MDB C;  5B79 A;  3ASL A;  5TBN A;  4A4C A;  3QZV A;  1WEE A;  4YAT A;  4B86 C;  2M3H A;  5TDW A;  5LKX A;  1T1H A;  2LRI C;  1LDJ B;  3GV4 A;  2P57 A;  3KNV A;  2YSM A;  3DDT A;  2MUM A;  1JM7 A;  2D8U A;  5TRB A;  1FP0 A;  3HCT A;  5G0F A;  2VJE B;  3U5N A;  2XP0 A;  2CT2 A;  4CA1 A;  2FUI A;  5H9M A;  2JMI A;  3LVR E;  4S3O B;  2E6S A;  2RR4 A;  3ZTG A;  2L5U A;  2L7P A;  2MNZ A;  2L43 A;  3LRQ A;  2YSJ A;  3FAN A;  4L58 A;  2MD7 B;  3ZYQ A;  3HCS A;  2M6M A;  3T9K A;  1WEW A;  2F6N A;  4IC3 A;  3U5O A;  4WZ3 B;  2VP7 A;  2LV9 A;  3H7H A;  2JUN A;  5AIU A;  1DVP A;  2F6J A;  4H9D A;  4BBQ A;  5B8D A;  2C2V S;  1RMD A;  2VPD A;  5H1T A;  5B75 A;  3KDE C;  2ZET C;  5LCW B;  2VPB A;  4F1P A;  2LAU A;  3KV6 A;  4MSX A;  1X4J A;  4L7X A;  5J3X A;  3M63 A;  2VPE A;  4Z0O A;  2EGP A;  4FO9 A;  1WEM A;  4YAX A;  3SUB A;  3U5P A;  3N9P A;  1WEN A;  3PHD A;  2I50 A;  2EOD A;  3O47 A;  4B7Y C;  5D1K B;  2LGG A;  1WFK A;  4YC9 A;  5SVI B;  2OXQ C;  3KV5 A;  2C2L A;  2L80 A;  4AVX A;  3LJU X;  2L0B A;  2B0O E;  4IC2 A;  2XEU A;  1XWH A;  4NN2 A;  4FK5 A;  4CCG X;  4S3O C;  3LQI A;  2HYE D;  2VJF B;  2YUR A;  2YU4 A;  2G43 A;  5DIN A;  3EB6 A;  4QF3 A;  2CSV A;  1HYJ A;  3FM8 C;  3E2D A;  3GL6 A;  3U5M A;  4WZ2 A;  3MHS A;  5B78 A;  2Y1N A;  3O35 A;  2CRR A;  2HDP A;  5DKA A;  2VJE A;  3FAO A;  4F52 B;  4LJN A;  1HYI A;  4LAD B;  5D1L B;  3O37 A;  1WEQ A;  2KRE A;  4ZQL A;  1DCQ A;  2ECV A;  1FBV A;  2CRW A;  4BHW A;  3N9Q A;  4N3W A;  2YQM A;  2Y43 A;  1MM2 A;  2YW8 A;  3LQJ A;  5SVX A;  2VJF A;  3FEH A;  3N9M A;  4A4B A;  2VPG A;  2KGG A;  2YQL A;  2KWO A;  3SOW A;  2VNF A;  4YAB A;  3RPG C;  2Y1M A;  1G25 A;  4LK9 A;  4I7C A;  2JMJ A;  3ZVY A;  2YUC A;  3ZPV E;  4R7E A;  2KGI A;  4WZ0 A;  3ZVZ B;  2YT5 A;  3LDY A;  1U6G B;  2KFT A;  5I3L A;  2QJ0 A;  3LVQ E;  3RPG B;  1WEU A;  4W4U A;  2K17 A;  3PUQ A;  1N87 A;  2JMD A;  4OGC A;  3SHB A;  1E4U A;  3C5K A;  3O33 A;  4LLB A;  4TKP B;  3N9N A;  2K16 A;  1VD4 A;  4PPE A;  2KIZ A;  1WIM A;  1MBM A;  2M1R A;  5G04 B;  2KKY A;  4UP0 A;  2CSZ A;  4AP4 A;  3M99 A;  2IDA A;  1WEO A;  2FD4 A;  3MHH A;  4AYC B;  2M85 A;  4UI9 B;  3RTR B;  4FIP A;  2XB1 A;  4YBM A;  1Z6U A;  2XOY A;  2DJA A;  5SVI A;  4O62 A;  2FUU A;  5LKZ A;  5TAB A;  2G6Q A;  2MIQ A;  2M13 A;  2RI7 A;  2NAA A;  2ECW A;  3DWD A;  4X3G A;  5SVY A;  1WEV A;  4FJC A;  3FL2 A;  3HTK C;  2LDR A;  2XOZ A;  2CKL B;  5H1U A;  5KH7 A;  5KH3 A;  4AYC A;  2YHN A;  2MKE A;  1F62 A;  5FEY A;  2JRJ A;  2KR4 A;  2ECG A;  2YVR A;  5B76 A;  3HCU A;  4O64 A;  2LXH C;  3IHP A;  3O70 A;  3I2D A;  4P5O B;  3ZPV 1;  5B77 A;  2YHO A;  1MM3 A;  4A49 A;  4Z0R A;  1V87 A;  3T6R A;  2G45 A;  4YAD A;  2YRE A;  4C9Z A;  2H0D A;  1CHC A;  4R8P K;  2CON A;  3N9O A;  2JM3 A;  2CSY A;  5FB0 A;  1ZBD B;  5FER A;  2LN0 A;  3EB5 A;  2D8S A;  1WEP A;  5EYA F;  4ZUX U;  3C6W A;  2KU3 A;  2ECT A;  4V3L C;  5K3Q A;  3ZNI A;  5LKU A;  2OWA A;  2PUY A;  3N9L A;  2K1J A;  2K4D A;  2LQ6 A;  3V43 A;  3M7K A;  2E6R A;  3NG2 A;  3SOU A;  4GNG A;  4N4F A;  3DPL R;  2LGL A;  4AUQ B;  4YBS A;  4QQ4 A;  4R2Y A;  2DSM A;  1VFY A;  1K2F A;  2UZG A;  4GB0 A;  1X4I A;  5KH9 A;  1Z60 A;  4WA6 A;  1JM7 B;  1X4U A;  2H0D B;  4Q6F A;  2LGV A;  4I7D A;  1WIL A;  5JG6 A;  5C11 A;  2QIZ A;  2KWN A;  2YYR A;  1IYM A;  2L75 A;  1Z2Q A;  2F42 A;  5G05 B;  2EGM A;  4LKA A;  2KWK A;  3O34 A;  3L11 A; 
#chains in the Genus database with same CATH homology
 2MT5 A;  1LDK C;  3T7L A;  4XI1 A;  5H1V A;  3L1Z B;  5TDR A;  3L1X A;  2LXP C;  2PNX A;  2KE1 A;  4GNF A;  2ECN A;  2KWJ A;  4UP5 A;  2EA6 A;  1WGM A;  2AN6 A;  5LKT A;  5D1M B;  2DX8 A;  2CKL A;  4ZDT A;  3VK6 A;  1JOC A;  3M62 A;  2RSD A;  1WES A;  2MNY A;  1BOR A;  2KYU A;  3DQV R;  4YBT A;  1WE9 A;  3O36 A;  4GNE A;  2FSA A;  2MA5 A;  3O7A A;  2ECI A;  2MA6 A;  5FB1 A;  2QIC A;  5AIT A;  4I7B A;  4QF2 A;  4A0C D;  3SOX A;  2MD8 C;  1VYX A;  4V3K C;  2ECJ A;  4MVT A;  4PTB A;  5C13 A;  3PUR A;  4GND A;  3LQH A;  2BAY A;  2LGK A;  3KQI A;  5B79 A;  3ASL A;  5TBN A;  4A4C A;  3QZV A;  1WEE A;  4YAT A;  4B86 C;  2M3H A;  5TDW A;  5LKX A;  1T1H A;  2LRI C;  1LDJ B;  3GV4 A;  3KNV A;  2YSM A;  2MUM A;  1JM7 A;  5TRB A;  1FP0 A;  3HCT A;  5G0F A;  2VJE B;  3U5N A;  2CT2 A;  4CA1 A;  2FUI A;  5H9M A;  2JMI A;  4S3O B;  2E6S A;  3ZTG A;  2L5U A;  2MNZ A;  2L43 A;  3LRQ A;  2YSJ A;  4L58 A;  2MD7 B;  3ZYQ A;  3HCS A;  2M6M A;  1WEW A;  2F6N A;  4IC3 A;  3U5O A;  4WZ3 B;  2VP7 A;  2LV9 A;  5AIU A;  1DVP A;  2F6J A;  4BBQ A;  5B8D A;  2C2V S;  1RMD A;  2VPD A;  5H1T A;  5B75 A;  2ZET C;  5LCW B;  2VPB A;  3KV6 A;  4MSX A;  1X4J A;  4L7X A;  5J3X A;  3M63 A;  2VPE A;  2EGP A;  4FO9 A;  1WEM A;  4YAX A;  3U5P A;  3N9P A;  1WEN A;  3PHD A;  2I50 A;  2EOD A;  4B7Y C;  2LGG A;  5D1K B;  1WFK A;  4YC9 A;  2OXQ C;  3KV5 A;  2C2L A;  2L80 A;  4AVX A;  2L0B A;  4IC2 A;  2XEU A;  1XWH A;  4NN2 A;  4FK5 A;  4CCG X;  4S3O C;  3LQI A;  2HYE D;  2VJF B;  2YUR A;  2YU4 A;  2G43 A;  5DIN A;  3EB6 A;  4QF3 A;  1HYJ A;  3GL6 A;  3U5M A;  4WZ2 A;  3MHS A;  5B78 A;  2Y1N A;  3O35 A;  2HDP A;  5DKA A;  2VJE A;  4F52 B;  4LJN A;  1HYI A;  4LAD B;  5D1L B;  3O37 A;  1WEQ A;  2KRE A;  4ZQL A;  2ECV A;  1FBV A;  4BHW A;  3N9Q A;  4N3W A;  2YQM A;  2Y43 A;  1MM2 A;  2YW8 A;  3LQJ A;  2VJF A;  4A4B A;  3N9M A;  2VPG A;  2KGG A;  2YQL A;  2KWO A;  3SOW A;  2VNF A;  4YAB A;  3RPG C;  2Y1M A;  1G25 A;  4LK9 A;  4I7C A;  2JMJ A;  3ZVY A;  2YUC A;  3ZPV E;  4R7E A;  2KGI A;  4WZ0 A;  3ZVZ B;  2YT5 A;  1U6G B;  2KFT A;  5I3L A;  2QJ0 A;  3RPG B;  1WEU A;  4W4U A;  2K17 A;  3PUQ A;  1N87 A;  2JMD A;  3SHB A;  1E4U A;  3C5K A;  3O33 A;  4LLB A;  4TKP B;  3N9N A;  2K16 A;  1VD4 A;  4PPE A;  2KIZ A;  1WIM A;  2M1R A;  5G04 B;  4UP0 A;  2CSZ A;  4AP4 A;  3M99 A;  2IDA A;  1WEO A;  3MHH A;  4AYC B;  2M85 A;  4UI9 B;  3RTR B;  4FIP A;  2XB1 A;  4YBM A;  1Z6U A;  2FUU A;  5LKZ A;  5TAB A;  2G6Q A;  2MIQ A;  2RI7 A;  2NAA A;  2ECW A;  4X3G A;  1WEV A;  4FJC A;  3FL2 A;  3HTK C;  2LDR A;  2CKL B;  5H1U A;  5KH7 A;  5KH3 A;  4AYC A;  2YHN A;  1F62 A;  5FEY A;  2JRJ A;  2KR4 A;  2ECG A;  5B76 A;  3HCU A;  4O64 A;  2LXH C;  3IHP A;  3O70 A;  3I2D A;  4P5O B;  3ZPV 1;  5B77 A;  2YHO A;  1MM3 A;  4A49 A;  1V87 A;  3T6R A;  2G45 A;  4YAD A;  2YRE A;  4C9Z A;  2H0D A;  1CHC A;  4R8P K;  3N9O A;  2CSY A;  5FB0 A;  1ZBD B;  5FER A;  2LN0 A;  3EB5 A;  2D8S A;  1WEP A;  5EYA F;  4ZUX U;  3C6W A;  2KU3 A;  2ECT A;  4V3L C;  3ZNI A;  5LKU A;  2PUY A;  3N9L A;  2K1J A;  2K4D A;  2LQ6 A;  3V43 A;  2E6R A;  3NG2 A;  3SOU A;  4GNG A;  4N4F A;  3DPL R;  2LGL A;  4AUQ B;  4YBS A;  4R2Y A;  1VFY A;  1K2F A;  2UZG A;  4GB0 A;  1X4I A;  5KH9 A;  1Z60 A;  4WA6 A;  1JM7 B;  1X4U A;  2H0D B;  4Q6F A;  2LGV A;  4I7D A;  1WIL A;  5JG6 A;  5C11 A;  2QIZ A;  2KWN A;  2YYR A;  1IYM A;  2L75 A;  1Z2Q A;  2F42 A;  5G05 B;  4LKA A;  2KWK A;  3O34 A;  3L11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...