5B78A

Crystal structure of moz double phd finger mutant-s210d/n235r in complex with histone h3 crotonylation at k14
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
SLPHEKDKPVAEPIPICDFCLGTKEQNREKKPEELISCADCGRSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b78A00
5C11A 1G25A 3KV6A 1Z6UA 3C6WA 3N9QA 5I3LA 3ZTGA 1JOCA 4R8PK 2CKLB 4FIPA 4UP5A 3SOWA 4AYCA 2E6RA 1HYJA 5LKTA 3GL6A 4NN2A 4F52B 4LLBA 2ECIA 3N9NA 3C5KA 2KFTA 3KNVA 3U5MA 1WIMA 1FP0A 4FO9A 5JG6A 2H0DB 1WE9A 3N9PA 1V87A 2I50A 3O37A 4YBTA 3SOXA 3LQJA 4BHWA 4GNEA 4LK9A 2M85A 3PURA 3ZYQA 5TDRA 2FUUA 5B8DA 4ZQLA 1VYXA 2E6SA 4GNDA 5B75A 2NAAA 2CKLA 2VP7A 3DPLR 3NG2A 4LADB 2VJFB 4N3WA 1MM3A 4WA6A 1VD4A 4R7EA 2L43A 5D1LB 4A4CA 2VJEB 5H9MA 5G0FA 3ZVZB 3M99A 3LQHA 3DQVR 4V3KC 2H0DA 4A0CD 4YBSA 1WFKA 2YURA 1WENA 2LGKA 4X3GA 2LV9A 5TBNA 5G05B 2BAYA 1RMDA 1X4IA 1WEUA 2EA6A 2ECGA 2M1RA 4S3OC 2KR4A 5D1MB 2HDPA 2VJFA 4YATA 3RPGB 4AUQB 2VPDA 3VK6A 4LJNA 4YC9A 2JMDA 3L11A 3LQIA 3ASLA 5G04B 3O70A 2OXQC 3SOUA 2VJEA 1HYIA 2EODA 2IDAA 3LRQA 3RPGC 5LCWB 2YQMA 4WZ2A 1MM2A 4I7DA 1LDJB 1VFYA 4LKAA 3HTKC 5TDWA 4CA1A 5LKXA 4ZUXU 4A4BA 4MSXA 5FEYA 2LGLA 1F62A 3U5PA 3N9MA 1WGMA 4C9ZA 1WEVA 2QJ0A 3ZVYA 1WEEA 2L0BA 2F6NA 2YT5A 2FSAA 3U5NA 4P5OB 3M62A 3FL2A 4GNFA 2MNYA 3KQIA 5B76A 2L75A 2CT2A 2M6MA 2LQ6A 1N87A 2G6QA 3L1ZB 2LN0A 4PTBA 5KH9A 2JMIA 1WEQA 3ZPV1 5B78A 1FBVA 5H1TA 2Y43A 4CCGX 2YREA 2KREA 4Q6FA 4FJCA 3O36A 4IC3A 4FK5A 4PPEA 2XEUA 3IHPA 2MUMA 3O34A 3HCUA 1X4UA 2YSMA 2MNZA 1BORA 5TRBA 2EGPA 4YADA 2VNFA 2RI7A 3HCSA 2YYRA 1CHCA 4WZ0A 4GNGA 5DKAA 2LXHC 2YUCA 2CSZA 2LGGA 1JM7B 2F42A 3T7LA 4N4FA 5D1KB 2G43A 4MVTA 2LRIC 1LDKC 4AVXA 3T6RA 1WEMA 3M63A 2KE1A 2KGGA 5LKZA 2JMJA 2VPBA 2MD7B 4YAXA 2K17A 4I7CA 2LDRA 4A49A 1DVPA 2MD8C 2KWJA 5FERA 1U6GB 5J3XA 4QF3A 2YHNA 3GV4A 1WEWA 5AIUA 5EYAF 5H1UA 2UZGA 3O35A 3PHDA 1IYMA 2QICA 2K4DA 4AP4A 1ZBDB 5KH7A 4TKPB 1JM7A 2XB1A 2C2LA 3PUQA 2MA6A 4GB0A 5H1VA 2M3HA 1WILA 4V3LC 1WESA 2KU3A 2HYED 2ECVA 2VPGA 4R2YA 2K16A 3RTRB 4BBQA 3HCTA 1T1HA 2LXPC 2MA5A 2YHOA 4WZ3B 3V43A 2PUYA 2L5UA 3KV5A 1XWHA 2YU4A 2ECJA 5FB0A 4L7XA 3N9LA 3EB5A 3N9OA 5B79A 1Z2QA 4YBMA 2L80A 2ECNA 2D8SA 3MHHA 1WEPA 1K2FA 2G45A 2CSYA 5DINA 2F6JA 3SHBA 3O33A 2JRJA 2ECTA 2ZETC 4IC2A 1X4JA 2RSDA 2FUIA 5FB1A 4B7YC 2KWOA 4O64A 2MT5A 4UI9B 2C2VS 2VPEA 2ECWA 5AITA 3O7AA 4S3OB 4YABA 2LGVA 2PNXA 2Y1NA 4UP0A 5TABA 4W4UA 2KYUA 2KGIA 2YQLA 4XI1A 4I7BA 2K1JA 2AN6A 2KWNA 1Z60A 2DX8A 4L58A 4AYCB 3L1XA 4ZDTA 2KWKA 3ZPVE 5LKUA 3I2DA 2Y1MA 3QZVA 2YSJA 4B86C 3U5OA 5C13A 3EB6A 3MHSA 2QIZA 1E4UA 1WEOA 2YW8A 5B77A 3ZNIA 2KIZA 5KH3A 2MIQA 4QF2A
chains in the Genus database with same CATH superfamily
5C11A 1G25A 3KV6A 1Z6UA 3C6WA 3N9QA 3FAOA 5I3LA 3ZTGA 1JOCA 4R8PK 2CKLB 4FIPA 4UP5A 3SOWA 4AYCA 2E6RA 2JM3A 5LKTA 1HYJA 3GL6A 4NN2A 4F52B 4LLBA 2ECIA 2XOYA 3E2DA 3N9NA 3C5KA 2KFTA 3KNVA 3H7HA 3U5MA 1WIMA 1FP0A 4FO9A 5JG6A 1WE9A 2H0DB 3N9PA 1V87A 2I50A 3O37A 4YBTA 3SOXA 2XOZA 3LQJA 4BHWA 4GNEA 4LK9A 2M85A 3PURA 3ZYQA 5TDRA 3FM8C 2FUUA 5B8DA 4ZQLA 1VYXA 2E6SA 4GNDA 5B75A 4QQ4A 2NAAA 2CKLA 2VP7A 3DPLR 3NG2A 4LADB 2VJFB 4N3WA 1MM3A 4WA6A 1DCQA 1VD4A 4R7EA 2L43A 5D1LB 4A4CA 2CRWA 2VJEB 5H9MA 3T9KA 5G0FA 3ZVZB 3M99A 3LQHA 3DQVR 4V3KC 2H0DA 4A0CD 4YBSA 1WFKA 2YURA 1WENA 2LGKA 4X3GA 2LV9A 5TBNA 5G05B 2BAYA 1RMDA 1X4IA 1WEUA 2EA6A 4OGCA 2ECGA 2M1RA 4S3OC 2KR4A 5D1MB 2HDPA 2OWAA 2VJFA 4YATA 3RPGB 4AUQB 2VPDA 3VK6A 4LJNA 4Z0RA 4YC9A 2JMDA 3L11A 3LQIA 3ASLA 5G04B 3O70A 2OXQC 3SOUA 2VJEA 3SUBA 1HYIA 2EODA 2IDAA 3LRQA 2XP0A 3DDTA 3RPGC 5LCWB 2YQMA 4WZ2A 1MM2A 4I7DA 1LDJB 1VFYA 3M7KA 4LKAA 3HTKC 5TDWA 2CSVA 2FFWA 5SVYA 4CA1A 5LKXA 4ZUXU 4A4BA 4MSXA 3FANA 5FEYA 2LGLA 1F62A 4OGEA 3N9MA 2RR4A 3U5PA 1WGMA 2IQJA 4C9ZA 1WEVA 2QJ0A 2XOCA 3Q1DA 3ZVYA 1WEEA 2L0BA 2F6NA 2YT5A 2FSAA 3U5NA 4P5OB 3M62A 3FL2A 4GNFA 2MNYA 3KQIA 4F1PA 2MKEA 5B76A 2L75A 2CT2A 2M6MA 2LQ6A 1N87A 2G6QA 3L1ZB 2LN0A 4PTBA 5KH9A 2JMIA 1WEQA 3ZPV1 5B78A 1FBVA 5H1TA 2Y43A 4CCGX 2YREA 2KREA 3KDEC 4Q6FA 4FJCA 3LVQE 3O36A 2KKYA 4IC3A 4FK5A 4PPEA 2XEUA 3IHPA 2M13A 2MUMA 3O34A 3HCUA 1X4UA 5K3QA 2YSMA 2MNZA 1BORA 5TRBA 2EGPA 2EXUA 4YADA 2LAUA 2VNFA 2RI7A 3MDBC 3HCSA 2YYRA 1CHCA 4WZ0A 4GNGA 5DKAA 2LXHC 2YUCA 2CSZA 2LGGA 1JM7B 2F42A 3T7LA 4N4FA 5D1KB 2G43A 4MVTA 2LRIC 1LDKC 4AVXA 3T6RA 1WEMA 3M63A 2KE1A 2B0OE 2CONA 2KGGA 5LKZA 2JMJA 2VPBA 2MD7B 2L7PA 4YAXA 2K17A 4I7CA 4Z0OA 5SVIB 2LDRA 3DWDA 4A49A 1DVPA 2MD8C 2KWJA 3LDYA 5FERA 1U6GB 5J3XA 4QF3A 4H9DA 2YHNA 2E61A 3GV4A 1WEWA 5AIUA 5EYAF 5H1UA 2UZGA 3O35A 3PHDA 1IYMA 2QICA 2K4DA 4AP4A 1ZBDB 5KH7A 4TKPB 1JM7A 2XB1A 2C2LA 3PUQA 2MA6A 4GB0A 5H1VA 2M3HA 1WILA 4V3LC 1WESA 2KU3A 2YVRA 2HYED 2ECVA 2VPGA 4R2YA 3O47A 2EGMA 2K16A 3RTRB 5SVIA 4BBQA 3HCTA 1T1HA 2LXPC 2MA5A 2YHOA 4WZ3B 3V43A 2PUYA 2L5UA 3KV5A 1XWHA 2YU4A 2ECJA 5FB0A 3FJUB 3JUEA 4L7XA 3N9LA 3EB5A 3N9OA 5B79A 1Z2QA 4YBMA 2L80A 2ECNA 2D8SA 3MHHA 1WEPA 1K2FA 2G45A 2CSYA 5DINA 2FD4A 2F6JA 3SHBA 3O33A 2JRJA 2ECTA 2ZETC 4IC2A 1X4JA 1MBMA 5SVXA 2RSDA 2DJAA 2FUIA 5FB1A 4B7YC 2KWOA 4O64A 2MT5A 4UI9B 2C2VS 2VPEA 2ECWA 5AITA 3O7AA 4S3OB 4YABA 2LGVA 2P57A 3FEHA 2PNXA 2Y1NA 3LJUX 2DSMA 4UP0A 5TABA 3LVRE 4W4UA 2KYUA 2KGIA 2YQLA 2CRRA 4XI1A 4I7BA 2K1JA 2AN6A 2KWNA 1Z60A 2DX8A 4L58A 4AYCB 3L1XA 4ZDTA 2KWKA 3ZPVE 5LKUA 4O62A 3I2DA 2Y1MA 2KKXA 3QZVA 2YSJA 4B86C 3PLWA 3U5OA 5C13A 3EB6A 3MHSA 2QIZA 1E4UA 1WEOA 2YW8A 5B77A 3ZNIA 2KIZA 5KH3A 2MIQA 2D8UA 2JUNA 4QF2A
chains in the Genus database with same CATH topology
5C11A 1G25A 3KV6A 1Z6UA 3C6WA 3N9QA 5I3LA 3ZTGA 1JOCA 4R8PK 2CKLB 4FIPA 4UP5A 3SOWA 4AYCA 2E6RA 1HYJA 5LKTA 3GL6A 4NN2A 4F52B 4LLBA 2ECIA 3N9NA 3C5KA 2KFTA 3KNVA 3U5MA 1WIMA 1FP0A 4FO9A 5JG6A 2H0DB 1WE9A 3N9PA 1V87A 2I50A 3O37A 4YBTA 3SOXA 3LQJA 4BHWA 4GNEA 4LK9A 2M85A 3PURA 3ZYQA 5TDRA 2FUUA 5B8DA 4ZQLA 1VYXA 2E6SA 4GNDA 5B75A 2NAAA 2CKLA 2VP7A 3DPLR 3NG2A 4LADB 2VJFB 4N3WA 1MM3A 4WA6A 1VD4A 4R7EA 2L43A 5D1LB 4A4CA 2VJEB 5H9MA 5G0FA 3ZVZB 3M99A 3LQHA 3DQVR 4V3KC 2H0DA 4A0CD 4YBSA 1WFKA 2YURA 1WENA 2LGKA 4X3GA 2LV9A 5TBNA 5G05B 2BAYA 1RMDA 1X4IA 1WEUA 2EA6A 2ECGA 2M1RA 4S3OC 2KR4A 5D1MB 2HDPA 2VJFA 4YATA 3RPGB 4AUQB 2VPDA 3VK6A 4LJNA 4YC9A 2JMDA 3L11A 3LQIA 3ASLA 5G04B 3O70A 2OXQC 3SOUA 2VJEA 1HYIA 2EODA 2IDAA 3LRQA 3RPGC 5LCWB 2YQMA 4WZ2A 1MM2A 4I7DA 1LDJB 1VFYA 4LKAA 3HTKC 5TDWA 4CA1A 5LKXA 4ZUXU 4A4BA 4MSXA 5FEYA 2LGLA 1F62A 3U5PA 3N9MA 1WGMA 4C9ZA 1WEVA 2QJ0A 3ZVYA 1WEEA 2L0BA 2F6NA 2YT5A 2FSAA 3U5NA 4P5OB 3M62A 3FL2A 4GNFA 2MNYA 3KQIA 5B76A 2L75A 2CT2A 2M6MA 2LQ6A 1N87A 2G6QA 3L1ZB 2LN0A 4PTBA 5KH9A 2JMIA 1WEQA 3ZPV1 5B78A 1FBVA 5H1TA 2Y43A 4CCGX 2YREA 2KREA 4Q6FA 4FJCA 3O36A 4IC3A 4FK5A 4PPEA 2XEUA 3IHPA 2MUMA 3O34A 3HCUA 1X4UA 2YSMA 2MNZA 1BORA 5TRBA 2EGPA 4YADA 2VNFA 2RI7A 3HCSA 2YYRA 1CHCA 4WZ0A 4GNGA 5DKAA 2LXHC 2YUCA 2CSZA 2LGGA 1JM7B 2F42A 3T7LA 4N4FA 5D1KB 2G43A 4MVTA 2LRIC 1LDKC 4AVXA 3T6RA 1WEMA 3M63A 2KE1A 2KGGA 5LKZA 2JMJA 2VPBA 2MD7B 4YAXA 2K17A 4I7CA 2LDRA 4A49A 1DVPA 2MD8C 2KWJA 5FERA 1U6GB 5J3XA 4QF3A 2YHNA 3GV4A 1WEWA 5AIUA 5EYAF 5H1UA 2UZGA 3O35A 3PHDA 1IYMA 2QICA 2K4DA 4AP4A 1ZBDB 5KH7A 4TKPB 1JM7A 2XB1A 2C2LA 3PUQA 2MA6A 4GB0A 5H1VA 2M3HA 1WILA 4V3LC 1WESA 2KU3A 2HYED 2ECVA 2VPGA 4R2YA 2K16A 3RTRB 4BBQA 3HCTA 1T1HA 2LXPC 2MA5A 2YHOA 4WZ3B 3V43A 2PUYA 2L5UA 3KV5A 1XWHA 2YU4A 2ECJA 5FB0A 4L7XA 3N9LA 3EB5A 3N9OA 5B79A 1Z2QA 4YBMA 2L80A 2ECNA 2D8SA 3MHHA 1WEPA 1K2FA 2G45A 2CSYA 5DINA 2F6JA 3SHBA 3O33A 2JRJA 2ECTA 2ZETC 4IC2A 1X4JA 2RSDA 2FUIA 5FB1A 4B7YC 2KWOA 4O64A 2MT5A 4UI9B 2C2VS 2VPEA 2ECWA 5AITA 3O7AA 4S3OB 4YABA 2LGVA 2PNXA 2Y1NA 4UP0A 5TABA 4W4UA 2KYUA 2KGIA 2YQLA 4XI1A 4I7BA 2K1JA 2AN6A 2KWNA 1Z60A 2DX8A 4L58A 4AYCB 3L1XA 4ZDTA 2KWKA 3ZPVE 5LKUA 3I2DA 2Y1MA 3QZVA 2YSJA 4B86C 3U5OA 5C13A 3EB6A 3MHSA 2QIZA 1E4UA 1WEOA 2YW8A 5B77A 3ZNIA 2KIZA 5KH3A 2MIQA 4QF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C11 A;  1G25 A;  3KV6 A;  1Z6U A;  3C6W A;  3N9Q A;  5I3L A;  3ZTG A;  1JOC A;  4R8P K;  2CKL B;  4FIP A;  4UP5 A;  3SOW A;  4AYC A;  2E6R A;  1HYJ A;  5LKT A;  3GL6 A;  4NN2 A;  4F52 B;  4LLB A;  2ECI A;  3N9N A;  3C5K A;  2KFT A;  3KNV A;  3U5M A;  1WIM A;  1FP0 A;  4FO9 A;  5JG6 A;  2H0D B;  1WE9 A;  3N9P A;  1V87 A;  2I50 A;  3O37 A;  4YBT A;  3SOX A;  3LQJ A;  4BHW A;  4GNE A;  4LK9 A;  2M85 A;  3PUR A;  3ZYQ A;  5TDR A;  2FUU A;  5B8D A;  4ZQL A;  1VYX A;  2E6S A;  4GND A;  5B75 A;  2NAA A;  2CKL A;  2VP7 A;  3DPL R;  3NG2 A;  4LAD B;  2VJF B;  4N3W A;  1MM3 A;  4WA6 A;  1VD4 A;  4R7E A;  2L43 A;  5D1L B;  4A4C A;  2VJE B;  5H9M A;  5G0F A;  3ZVZ B;  3M99 A;  3LQH A;  3DQV R;  4V3K C;  2H0D A;  4A0C D;  4YBS A;  1WFK A;  2YUR A;  1WEN A;  2LGK A;  4X3G A;  2LV9 A;  5TBN A;  5G05 B;  2BAY A;  1RMD A;  1X4I A;  1WEU A;  2EA6 A;  2ECG A;  2M1R A;  4S3O C;  2KR4 A;  5D1M B;  2HDP A;  2VJF A;  4YAT A;  3RPG B;  4AUQ B;  2VPD A;  3VK6 A;  4LJN A;  4YC9 A;  2JMD A;  3L11 A;  3LQI A;  3ASL A;  5G04 B;  3O70 A;  2OXQ C;  3SOU A;  2VJE A;  1HYI A;  2EOD A;  2IDA A;  3LRQ A;  3RPG C;  5LCW B;  2YQM A;  4WZ2 A;  1MM2 A;  4I7D A;  1LDJ B;  1VFY A;  4LKA A;  3HTK C;  5TDW A;  4CA1 A;  5LKX A;  4ZUX U;  4A4B A;  4MSX A;  5FEY A;  2LGL A;  1F62 A;  3U5P A;  3N9M A;  1WGM A;  4C9Z A;  1WEV A;  2QJ0 A;  3ZVY A;  1WEE A;  2L0B A;  2F6N A;  2YT5 A;  2FSA A;  3U5N A;  4P5O B;  3M62 A;  3FL2 A;  4GNF A;  2MNY A;  3KQI A;  5B76 A;  2L75 A;  2CT2 A;  2M6M A;  2LQ6 A;  1N87 A;  2G6Q A;  3L1Z B;  2LN0 A;  4PTB A;  5KH9 A;  2JMI A;  1WEQ A;  3ZPV 1;  5B78 A;  1FBV A;  5H1T A;  2Y43 A;  4CCG X;  2YRE A;  2KRE A;  4Q6F A;  4FJC A;  3O36 A;  4IC3 A;  4FK5 A;  4PPE A;  2XEU A;  3IHP A;  2MUM A;  3O34 A;  3HCU A;  1X4U A;  2YSM A;  2MNZ A;  1BOR A;  5TRB A;  2EGP A;  4YAD A;  2VNF A;  2RI7 A;  3HCS A;  2YYR A;  1CHC A;  4WZ0 A;  4GNG A;  5DKA A;  2LXH C;  2YUC A;  2CSZ A;  2LGG A;  1JM7 B;  2F42 A;  3T7L A;  4N4F A;  5D1K B;  2G43 A;  4MVT A;  2LRI C;  1LDK C;  4AVX A;  3T6R A;  1WEM A;  3M63 A;  2KE1 A;  2KGG A;  5LKZ A;  2JMJ A;  2VPB A;  2MD7 B;  4YAX A;  2K17 A;  4I7C A;  2LDR A;  4A49 A;  1DVP A;  2MD8 C;  2KWJ A;  5FER A;  1U6G B;  5J3X A;  4QF3 A;  2YHN A;  3GV4 A;  1WEW A;  5AIU A;  5EYA F;  5H1U A;  2UZG A;  3O35 A;  3PHD A;  1IYM A;  2QIC A;  2K4D A;  4AP4 A;  1ZBD B;  5KH7 A;  4TKP B;  1JM7 A;  2XB1 A;  2C2L A;  3PUQ A;  2MA6 A;  4GB0 A;  5H1V A;  2M3H A;  1WIL A;  4V3L C;  1WES A;  2KU3 A;  2HYE D;  2ECV A;  2VPG A;  4R2Y A;  2K16 A;  3RTR B;  4BBQ A;  3HCT A;  1T1H A;  2LXP C;  2MA5 A;  2YHO A;  4WZ3 B;  3V43 A;  2PUY A;  2L5U A;  3KV5 A;  1XWH A;  2YU4 A;  2ECJ A;  5FB0 A;  4L7X A;  3N9L A;  3EB5 A;  3N9O A;  5B79 A;  1Z2Q A;  4YBM A;  2L80 A;  2ECN A;  2D8S A;  3MHH A;  1WEP A;  1K2F A;  2G45 A;  2CSY A;  5DIN A;  2F6J A;  3SHB A;  3O33 A;  2JRJ A;  2ECT A;  2ZET C;  4IC2 A;  1X4J A;  2RSD A;  2FUI A;  5FB1 A;  4B7Y C;  2KWO A;  4O64 A;  2MT5 A;  4UI9 B;  2C2V S;  2VPE A;  2ECW A;  5AIT A;  3O7A A;  4S3O B;  4YAB A;  2LGV A;  2PNX A;  2Y1N A;  4UP0 A;  5TAB A;  4W4U A;  2KYU A;  2KGI A;  2YQL A;  4XI1 A;  4I7B A;  2K1J A;  2AN6 A;  2KWN A;  1Z60 A;  2DX8 A;  4L58 A;  4AYC B;  3L1X A;  4ZDT A;  2KWK A;  3ZPV E;  5LKU A;  3I2D A;  2Y1M A;  3QZV A;  2YSJ A;  4B86 C;  3U5O A;  5C13 A;  3EB6 A;  3MHS A;  2QIZ A;  1E4U A;  1WEO A;  2YW8 A;  5B77 A;  3ZNI A;  2KIZ A;  5KH3 A;  2MIQ A;  4QF2 A; 
#chains in the Genus database with same CATH topology
 5C11 A;  1G25 A;  3KV6 A;  1Z6U A;  3C6W A;  3N9Q A;  3FAO A;  5I3L A;  3ZTG A;  1JOC A;  4R8P K;  2CKL B;  4FIP A;  4UP5 A;  3SOW A;  4AYC A;  2E6R A;  2JM3 A;  5LKT A;  1HYJ A;  3GL6 A;  4NN2 A;  4F52 B;  4LLB A;  2ECI A;  2XOY A;  3E2D A;  3N9N A;  3C5K A;  2KFT A;  3KNV A;  3H7H A;  3U5M A;  1WIM A;  1FP0 A;  4FO9 A;  5JG6 A;  1WE9 A;  2H0D B;  3N9P A;  1V87 A;  2I50 A;  3O37 A;  4YBT A;  3SOX A;  2XOZ A;  3LQJ A;  4BHW A;  4GNE A;  4LK9 A;  2M85 A;  3PUR A;  3ZYQ A;  5TDR A;  3FM8 C;  2FUU A;  5B8D A;  4ZQL A;  1VYX A;  2E6S A;  4GND A;  5B75 A;  4QQ4 A;  2NAA A;  2CKL A;  2VP7 A;  3DPL R;  3NG2 A;  4LAD B;  2VJF B;  4N3W A;  1MM3 A;  4WA6 A;  1DCQ A;  1VD4 A;  4R7E A;  2L43 A;  5D1L B;  4A4C A;  2CRW A;  2VJE B;  5H9M A;  3T9K A;  5G0F A;  3ZVZ B;  3M99 A;  3LQH A;  3DQV R;  4V3K C;  2H0D A;  4A0C D;  4YBS A;  1WFK A;  2YUR A;  1WEN A;  2LGK A;  4X3G A;  2LV9 A;  5TBN A;  5G05 B;  2BAY A;  1RMD A;  1X4I A;  1WEU A;  2EA6 A;  4OGC A;  2ECG A;  2M1R A;  4S3O C;  2KR4 A;  5D1M B;  2HDP A;  2OWA A;  2VJF A;  4YAT A;  3RPG B;  4AUQ B;  2VPD A;  3VK6 A;  4LJN A;  4Z0R A;  4YC9 A;  2JMD A;  3L11 A;  3LQI A;  3ASL A;  5G04 B;  3O70 A;  2OXQ C;  3SOU A;  2VJE A;  3SUB A;  1HYI A;  2EOD A;  2IDA A;  3LRQ A;  2XP0 A;  3DDT A;  3RPG C;  5LCW B;  2YQM A;  4WZ2 A;  1MM2 A;  4I7D A;  1LDJ B;  1VFY A;  3M7K A;  4LKA A;  3HTK C;  5TDW A;  2CSV A;  2FFW A;  5SVY A;  4CA1 A;  5LKX A;  4ZUX U;  4A4B A;  4MSX A;  3FAN A;  5FEY A;  2LGL A;  1F62 A;  4OGE A;  3N9M A;  2RR4 A;  3U5P A;  1WGM A;  2IQJ A;  4C9Z A;  1WEV A;  2QJ0 A;  2XOC A;  3Q1D A;  3ZVY A;  1WEE A;  2L0B A;  2F6N A;  2YT5 A;  2FSA A;  3U5N A;  4P5O B;  3M62 A;  3FL2 A;  4GNF A;  2MNY A;  3KQI A;  4F1P A;  2MKE A;  5B76 A;  2L75 A;  2CT2 A;  2M6M A;  2LQ6 A;  1N87 A;  2G6Q A;  3L1Z B;  2LN0 A;  4PTB A;  5KH9 A;  2JMI A;  1WEQ A;  3ZPV 1;  5B78 A;  1FBV A;  5H1T A;  2Y43 A;  4CCG X;  2YRE A;  2KRE A;  3KDE C;  4Q6F A;  4FJC A;  3LVQ E;  3O36 A;  2KKY A;  4IC3 A;  4FK5 A;  4PPE A;  2XEU A;  3IHP A;  2M13 A;  2MUM A;  3O34 A;  3HCU A;  1X4U A;  5K3Q A;  2YSM A;  2MNZ A;  1BOR A;  5TRB A;  2EGP A;  2EXU A;  4YAD A;  2LAU A;  2VNF A;  2RI7 A;  3MDB C;  3HCS A;  2YYR A;  1CHC A;  4WZ0 A;  4GNG A;  5DKA A;  2LXH C;  2YUC A;  2CSZ A;  2LGG A;  1JM7 B;  2F42 A;  3T7L A;  4N4F A;  5D1K B;  2G43 A;  4MVT A;  2LRI C;  1LDK C;  4AVX A;  3T6R A;  1WEM A;  3M63 A;  2KE1 A;  2B0O E;  2CON A;  2KGG A;  5LKZ A;  2JMJ A;  2VPB A;  2MD7 B;  2L7P A;  4YAX A;  2K17 A;  4I7C A;  4Z0O A;  5SVI B;  2LDR A;  3DWD A;  4A49 A;  1DVP A;  2MD8 C;  2KWJ A;  3LDY A;  5FER A;  1U6G B;  5J3X A;  4QF3 A;  4H9D A;  2YHN A;  2E61 A;  3GV4 A;  1WEW A;  5AIU A;  5EYA F;  5H1U A;  2UZG A;  3O35 A;  3PHD A;  1IYM A;  2QIC A;  2K4D A;  4AP4 A;  1ZBD B;  5KH7 A;  4TKP B;  1JM7 A;  2XB1 A;  2C2L A;  3PUQ A;  2MA6 A;  4GB0 A;  5H1V A;  2M3H A;  1WIL A;  4V3L C;  1WES A;  2KU3 A;  2YVR A;  2HYE D;  2ECV A;  2VPG A;  4R2Y A;  3O47 A;  2EGM A;  2K16 A;  3RTR B;  5SVI A;  4BBQ A;  3HCT A;  1T1H A;  2LXP C;  2MA5 A;  2YHO A;  4WZ3 B;  3V43 A;  2PUY A;  2L5U A;  3KV5 A;  1XWH A;  2YU4 A;  2ECJ A;  5FB0 A;  3FJU B;  3JUE A;  4L7X A;  3N9L A;  3EB5 A;  3N9O A;  5B79 A;  1Z2Q A;  4YBM A;  2L80 A;  2ECN A;  2D8S A;  3MHH A;  1WEP A;  1K2F A;  2G45 A;  2CSY A;  5DIN A;  2FD4 A;  2F6J A;  3SHB A;  3O33 A;  2JRJ A;  2ECT A;  2ZET C;  4IC2 A;  1X4J A;  1MBM A;  5SVX A;  2RSD A;  2DJA A;  2FUI A;  5FB1 A;  4B7Y C;  2KWO A;  4O64 A;  2MT5 A;  4UI9 B;  2C2V S;  2VPE A;  2ECW A;  5AIT A;  3O7A A;  4S3O B;  4YAB A;  2LGV A;  2P57 A;  3FEH A;  2PNX A;  2Y1N A;  3LJU X;  2DSM A;  4UP0 A;  5TAB A;  3LVR E;  4W4U A;  2KYU A;  2KGI A;  2YQL A;  2CRR A;  4XI1 A;  4I7B A;  2K1J A;  2AN6 A;  2KWN A;  1Z60 A;  2DX8 A;  4L58 A;  4AYC B;  3L1X A;  4ZDT A;  2KWK A;  3ZPV E;  5LKU A;  4O62 A;  3I2D A;  2Y1M A;  2KKX A;  3QZV A;  2YSJ A;  4B86 C;  3PLW A;  3U5O A;  5C13 A;  3EB6 A;  3MHS A;  2QIZ A;  1E4U A;  1WEO A;  2YW8 A;  5B77 A;  3ZNI A;  2KIZ A;  5KH3 A;  2MIQ A;  2D8U A;  2JUN A;  4QF2 A; 
#chains in the Genus database with same CATH homology
 5C11 A;  1G25 A;  3KV6 A;  1Z6U A;  3C6W A;  3N9Q A;  5I3L A;  3ZTG A;  1JOC A;  4R8P K;  2CKL B;  4FIP A;  4UP5 A;  3SOW A;  4AYC A;  2E6R A;  1HYJ A;  5LKT A;  3GL6 A;  4NN2 A;  4F52 B;  4LLB A;  2ECI A;  3N9N A;  3C5K A;  2KFT A;  3KNV A;  3U5M A;  1WIM A;  1FP0 A;  4FO9 A;  5JG6 A;  2H0D B;  1WE9 A;  3N9P A;  1V87 A;  2I50 A;  3O37 A;  4YBT A;  3SOX A;  3LQJ A;  4BHW A;  4GNE A;  4LK9 A;  2M85 A;  3PUR A;  3ZYQ A;  5TDR A;  2FUU A;  5B8D A;  4ZQL A;  1VYX A;  2E6S A;  4GND A;  5B75 A;  2NAA A;  2CKL A;  2VP7 A;  3DPL R;  3NG2 A;  4LAD B;  2VJF B;  4N3W A;  1MM3 A;  4WA6 A;  1VD4 A;  4R7E A;  2L43 A;  5D1L B;  4A4C A;  2VJE B;  5H9M A;  5G0F A;  3ZVZ B;  3M99 A;  3LQH A;  3DQV R;  4V3K C;  2H0D A;  4A0C D;  4YBS A;  1WFK A;  2YUR A;  1WEN A;  2LGK A;  4X3G A;  2LV9 A;  5TBN A;  5G05 B;  2BAY A;  1RMD A;  1X4I A;  1WEU A;  2EA6 A;  2ECG A;  2M1R A;  4S3O C;  2KR4 A;  5D1M B;  2HDP A;  2VJF A;  4YAT A;  3RPG B;  4AUQ B;  2VPD A;  3VK6 A;  4LJN A;  4YC9 A;  2JMD A;  3L11 A;  3LQI A;  3ASL A;  5G04 B;  3O70 A;  2OXQ C;  3SOU A;  2VJE A;  1HYI A;  2EOD A;  2IDA A;  3LRQ A;  3RPG C;  5LCW B;  2YQM A;  4WZ2 A;  1MM2 A;  4I7D A;  1LDJ B;  1VFY A;  4LKA A;  3HTK C;  5TDW A;  4CA1 A;  5LKX A;  4ZUX U;  4A4B A;  4MSX A;  5FEY A;  2LGL A;  1F62 A;  3U5P A;  3N9M A;  1WGM A;  4C9Z A;  1WEV A;  2QJ0 A;  3ZVY A;  1WEE A;  2L0B A;  2F6N A;  2YT5 A;  2FSA A;  3U5N A;  4P5O B;  3M62 A;  3FL2 A;  4GNF A;  2MNY A;  3KQI A;  5B76 A;  2L75 A;  2CT2 A;  2M6M A;  2LQ6 A;  1N87 A;  2G6Q A;  3L1Z B;  2LN0 A;  4PTB A;  5KH9 A;  2JMI A;  1WEQ A;  3ZPV 1;  5B78 A;  1FBV A;  5H1T A;  2Y43 A;  4CCG X;  2YRE A;  2KRE A;  4Q6F A;  4FJC A;  3O36 A;  4IC3 A;  4FK5 A;  4PPE A;  2XEU A;  3IHP A;  2MUM A;  3O34 A;  3HCU A;  1X4U A;  2YSM A;  2MNZ A;  1BOR A;  5TRB A;  2EGP A;  4YAD A;  2VNF A;  2RI7 A;  3HCS A;  2YYR A;  1CHC A;  4WZ0 A;  4GNG A;  5DKA A;  2LXH C;  2YUC A;  2CSZ A;  2LGG A;  1JM7 B;  2F42 A;  3T7L A;  4N4F A;  5D1K B;  2G43 A;  4MVT A;  2LRI C;  1LDK C;  4AVX A;  3T6R A;  1WEM A;  3M63 A;  2KE1 A;  2KGG A;  5LKZ A;  2JMJ A;  2VPB A;  2MD7 B;  4YAX A;  2K17 A;  4I7C A;  2LDR A;  4A49 A;  1DVP A;  2MD8 C;  2KWJ A;  5FER A;  1U6G B;  5J3X A;  4QF3 A;  2YHN A;  3GV4 A;  1WEW A;  5AIU A;  5EYA F;  5H1U A;  2UZG A;  3O35 A;  3PHD A;  1IYM A;  2QIC A;  2K4D A;  4AP4 A;  1ZBD B;  5KH7 A;  4TKP B;  1JM7 A;  2XB1 A;  2C2L A;  3PUQ A;  2MA6 A;  4GB0 A;  5H1V A;  2M3H A;  1WIL A;  4V3L C;  1WES A;  2KU3 A;  2HYE D;  2ECV A;  2VPG A;  4R2Y A;  2K16 A;  3RTR B;  4BBQ A;  3HCT A;  1T1H A;  2LXP C;  2MA5 A;  2YHO A;  4WZ3 B;  3V43 A;  2PUY A;  2L5U A;  3KV5 A;  1XWH A;  2YU4 A;  2ECJ A;  5FB0 A;  4L7X A;  3N9L A;  3EB5 A;  3N9O A;  5B79 A;  1Z2Q A;  4YBM A;  2L80 A;  2ECN A;  2D8S A;  3MHH A;  1WEP A;  1K2F A;  2G45 A;  2CSY A;  5DIN A;  2F6J A;  3SHB A;  3O33 A;  2JRJ A;  2ECT A;  2ZET C;  4IC2 A;  1X4J A;  2RSD A;  2FUI A;  5FB1 A;  4B7Y C;  2KWO A;  4O64 A;  2MT5 A;  4UI9 B;  2C2V S;  2VPE A;  2ECW A;  5AIT A;  3O7A A;  4S3O B;  4YAB A;  2LGV A;  2PNX A;  2Y1N A;  4UP0 A;  5TAB A;  4W4U A;  2KYU A;  2KGI A;  2YQL A;  4XI1 A;  4I7B A;  2K1J A;  2AN6 A;  2KWN A;  1Z60 A;  2DX8 A;  4L58 A;  4AYC B;  3L1X A;  4ZDT A;  2KWK A;  3ZPV E;  5LKU A;  3I2D A;  2Y1M A;  3QZV A;  2YSJ A;  4B86 C;  3U5O A;  5C13 A;  3EB6 A;  3MHS A;  2QIZ A;  1E4U A;  1WEO A;  2YW8 A;  5B77 A;  3ZNI A;  2KIZ A;  5KH3 A;  2MIQ A;  4QF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...