5B78A

Crystal structure of moz double phd finger mutant-s210d/n235r in complex with histone h3 crotonylation at k14
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
SLPHEKDKPVAEPIPICDFCLGTKEQNREKKPEELISCADCGRSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT6A
total genus 29
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b78A00
4UP0A 2KWKA 2M1RA 5B78A 4I7CA 4Q6FA 5D1KB 5KH3A 3N9QA 5D1LB 4GB0A 4YBTA 3SHBA 1WFKA 2CKLB 2L43A 2L0BA 4BBQA 4YBSA 3GV4A 2G43A 3I2DA 2YYRA 1VYXA 4R2YA 2EODA 2ECTA 2Y1MA 4CCGX 2YW8A 2OXQC 2H0DA 5J3XA 2L75A 2C2LA 3VK6A 5B79A 2VP7A 3IHPA 2VPGA 1V87A 3ZYQA 4YABA 5DKAA 5B8DA 4ZUXU 2MNZA 2CT2A 2KREA 2Y1NA 2ECJA 4B86C 1MM2A 4LADB 2VJEB 3O33A 2YU4A 4GNEA 2ECGA 1X4JA 1X4IA 2C2VS 5H1UA 4W4UA 5AITA 1WE9A 4WZ2A 2QICA 4L7XA 2HYED 2MA5A 4LK9A 1CHCA 1WEUA 2VJFB 3LQHA 1XWHA 2ECIA 3O70A 2K16A 3N9MA 3U5PA 4F52B 5H1VA 2YHNA 3T7LA 1E4UA 2EA6A 1JM7B 2ECWA 4S3OB 3EB6A 3LQJA 4N4FA 4C9ZA 5D1MB 1X4UA 2FUIA 2NAAA 2YQMA 2YQLA 2FSAA 2LV9A 3SOWA 1HYJA 2CSZA 1MM3A 1WEOA 4WZ0A 2KWOA 2JMIA 4B7YC 1WEMA 2XEUA 2K4DA 3MHSA 5FB0A 1HYIA 2VPEA 5LKZA 2CKLA 2LGVA 4R7EA 4QF3A 5TDWA 2LQ6A 1BORA 4FIPA 3ZNIA 2F6NA 2MT5A 4AYCB 2YREA 4WZ3B 4FK5A 1JOCA 2BAYA 5LKUA 4TKPB 4PTBA 5FB1A 2DX8A 2ECNA 2K1JA 2L80A 3ZVZB 1WIMA 2QJ0A 4LJNA 4AUQB 5EYAF 5C13A 3O34A 2AN6A 3M63A 2KGGA 5H9MA 4UI9B 2RI7A 1WENA 2K17A 5B76A 2F6JA 2MA6A 3DQVR 2LGGA 4ZDTA 2LRIC 3U5NA 1FP0A 3ASLA 2YT5A 5G0FA 3O7AA 3PUQA 1VFYA 1WEWA 4FJCA 3KV5A 2M6MA 3QZVA 4IC3A 2CSYA 2LGLA 4I7BA 2VNFA 3N9PA 3RTRB 2JRJA 5KH9A 3N9OA 2RSDA 3GL6A 4LLBA 1VD4A 1K2FA 3PHDA 1Z6UA 5LCWB 4YAXA 4A49A 2VPDA 2KWJA 4X3GA 2KYUA 3MHHA 4CA1A 4QF2A 3U5OA 2LXHC 2FUUA 4N3WA 3LRQA 3V43A 3N9LA 2YUCA 2PUYA 4O64A 3L1ZB 4MVTA 5AIUA 2YHOA 4UP5A 3ZPV1 3PURA 3O35A 2JMDA 4ZQLA 2MUMA 4V3LC 1JM7A 3N9NA 2KR4A 1Z2QA 3RPGB 5DINA 2I50A 5C11A 2PNXA 4FO9A 2ECVA 2MIQA 1WEEA 1RMDA 2KU3A 1N87A 4WA6A 4GNFA 1WILA 3NG2A 2YSMA 5TABA 3T6RA 5I3LA 1Z60A 5TDRA 4YBMA 4V3KC 4P5OB 5B75A 2LDRA 5TRBA 5FEYA 5G05B 3KNVA 3ZPVE 3L11A 2VJFA 2JMJA 2L5UA 1LDJB 1ZBDB 5TBNA 2F42A 2MD8C 2E6SA 2QIZA 3RPGC 4A4CA 3KV6A 1T1HA 4YADA 4PPEA 4MSXA 3HCTA 3HTKC 3SOUA 5LKXA 3M62A 3U5MA 2M3HA 3HCUA 5JG6A 3L1XA 4GNGA 2G45A 2D8SA 4YC9A 2KIZA 3O37A 4S3OC 3ZTGA 1LDKC 1G25A 3C6WA 2Y43A 3HCSA 5KH7A 4A4BA 2YURA 2VJEA 2VPBA 4LKAA 5B77A 4A0CD 1U6GB 5LKTA 2LN0A 1WGMA 3FL2A 3C5KA 2LXPC 2YSJA 1DVPA 3EB5A 4AP4A 2MD7B 2H0DB 3M99A 3O36A 5FERA 4XI1A 2LGKA 4IC2A 2KE1A 1IYMA 2HDPA 3LQIA 1WESA 2MNYA 2ZETC 1WEPA 4YATA 2KFTA 2M85A 2IDAA 4GNDA 5G04B 4NN2A 2EGPA 2E6RA 3SOXA 4R8PK 3ZVYA 1WEVA 1WEQA 4AVXA 2UZGA 5H1TA 3DPLR 1F62A 2KWNA 4I7DA 3KQIA 4L58A 2G6QA 1FBVA 4AYCA 4BHWA 2KGIA 2XB1A
chains in the Genus database with same CATH superfamily
4UP0A 2KWKA 2M1RA 5B78A 4I7CA 4Q6FA 5D1KB 5KH3A 3N9QA 3FJUB 2XP0A 5D1LB 4YBTA 4GB0A 3SHBA 1WFKA 2CKLB 2L43A 2L0BA 4BBQA 2FFWA 4YBSA 3GV4A 2G43A 3FEHA 3I2DA 2L7PA 2YYRA 1VYXA 4R2YA 2EODA 2ECTA 2P57A 2Y1MA 4CCGX 2YW8A 2OXQC 2H0DA 5J3XA 3FM8C 2L75A 3Q1DA 2C2LA 3VK6A 5B79A 2VP7A 3IHPA 2VPGA 1V87A 3ZYQA 4YABA 5DKAA 5B8DA 4ZUXU 2MNZA 2CT2A 2KREA 2Y1NA 2ECJA 4B86C 1MM2A 3FANA 4LADB 2VJEB 3O33A 2YU4A 4GNEA 2ECGA 5SVXA 2M13A 1X4JA 2XOYA 1X4IA 2C2VS 5H1UA 4W4UA 5AITA 1WE9A 4WZ2A 2QICA 4L7XA 2HYED 2MA5A 4LK9A 1CHCA 1WEUA 2VJFB 3LQHA 1XWHA 2EXUA 2ECIA 3O70A 2K16A 3N9MA 3U5PA 4F52B 4O62A 5H1VA 2YHNA 2EGMA 3T7LA 5SVYA 2EA6A 1E4UA 1JM7B 2ECWA 4S3OB 3EB6A 3H7HA 3LQJA 4N4FA 4C9ZA 5D1MB 1X4UA 2FUIA 2NAAA 2E61A 2KKXA 2YQLA 2YQMA 2FSAA 2LV9A 3SOWA 1HYJA 2CSZA 3SUBA 1MM3A 3KDEC 1WEOA 4WZ0A 2KWOA 2JMIA 4B7YC 1WEMA 2XEUA 2K4DA 3MHSA 3FAOA 5FB0A 2KKYA 1HYIA 2VPEA 5LKZA 2CKLA 2LGVA 4R7EA 4QF3A 5TDWA 2LQ6A 1BORA 4FIPA 3ZNIA 2LAUA 2F6NA 2MT5A 4AYCB 2YREA 4WZ3B 4FK5A 1JOCA 2BAYA 5LKUA 4TKPB 4PTBA 5FB1A 2DX8A 2ECNA 2K1JA 2L80A 3ZVZB 1WIMA 2QJ0A 4LJNA 4AUQB 5EYAF 3DDTA 4OGEA 5C13A 3O34A 2AN6A 3M63A 2KGGA 5H9MA 3PLWA 4UI9B 1MBMA 2RI7A 1WENA 2K17A 5B76A 2F6JA 2MA6A 3MDBC 3DQVR 2LGGA 4ZDTA 2LRIC 3U5NA 1FP0A 3ASLA 2YT5A 5G0FA 3O7AA 3PUQA 2JM3A 1VFYA 1WEWA 4FJCA 3O47A 3KV5A 2M6MA 2IQJA 3QZVA 4IC3A 2CSYA 3LVQE 2LGLA 4I7BA 2VNFA 3N9PA 3RTRB 2JRJA 5KH9A 5SVIA 3N9OA 2RSDA 3GL6A 4LLBA 1VD4A 1K2FA 3LJUX 3PHDA 1Z6UA 5LCWB 4YAXA 2CONA 4A49A 2VPDA 2RR4A 2KWJA 4X3GA 2KYUA 3MHHA 4CA1A 4QF2A 3U5OA 2LXHC 2FUUA 2DJAA 4N3WA 3LRQA 3V43A 3N9LA 2YUCA 2PUYA 4O64A 3L1ZB 4MVTA 5AIUA 2YHOA 4UP5A 3ZPV1 1DCQA 3PURA 3O35A 2JMDA 4ZQLA 4QQ4A 2MUMA 3E2DA 4V3LC 1JM7A 3N9NA 2KR4A 1Z2QA 5DINA 3RPGB 2I50A 5C11A 2PNXA 4FO9A 2ECVA 2MIQA 1WEEA 1RMDA 2KU3A 1N87A 4WA6A 4GNFA 1WILA 3NG2A 2YSMA 5TABA 3T6RA 5I3LA 1Z60A 5TDRA 4YBMA 3M7KA 4V3KC 4P5OB 5B75A 2LDRA 5TRBA 5FEYA 5G05B 3KNVA 3ZPVE 4F1PA 3L11A 2VJFA 2JMJA 2XOZA 2L5UA 1LDJB 1ZBDB 5TBNA 2F42A 2MD8C 2FD4A 2E6SA 2QIZA 3RPGC 4H9DA 4A4CA 3KV6A 1T1HA 4YADA 4PPEA 4MSXA 3HCTA 5SVIB 3HTKC 2B0OE 3SOUA 2D8UA 5LKXA 2XOCA 3M62A 3U5MA 2M3HA 3HCUA 5JG6A 3L1XA 4GNGA 2G45A 2YVRA 2D8SA 2CRWA 4YC9A 2KIZA 3O37A 4S3OC 3ZTGA 3LDYA 1LDKC 1G25A 3C6WA 2Y43A 3LVRE 3HCSA 5KH7A 4A4BA 2YURA 2VJEA 2VPBA 2JUNA 4LKAA 5B77A 3JUEA 4A0CD 1U6GB 5LKTA 2LN0A 1WGMA 3FL2A 3C5KA 2LXPC 2YSJA 1DVPA 3EB5A 4OGCA 4AP4A 2MD7B 2H0DB 3M99A 3O36A 5FERA 4XI1A 2LGKA 2OWAA 4IC2A 4Z0OA 2KE1A 1IYMA 2HDPA 2MKEA 3LQIA 1WESA 2MNYA 2ZETC 1WEPA 4YATA 2KFTA 2M85A 2IDAA 4GNDA 5G04B 2CRRA 4NN2A 2EGPA 2E6RA 3SOXA 4R8PK 3ZVYA 1WEVA 1WEQA 2DSMA 4AVXA 2UZGA 5H1TA 3DPLR 1F62A 5K3QA 4Z0RA 2KWNA 4I7DA 3KQIA 4L58A 2G6QA 1FBVA 4AYCA 3DWDA 4BHWA 3T9KA 2CSVA 2KGIA 2XB1A
chains in the Genus database with same CATH topology
4UP0A 2KWKA 2M1RA 5B78A 4I7CA 4Q6FA 5D1KB 5KH3A 3N9QA 5D1LB 4GB0A 4YBTA 3SHBA 1WFKA 2CKLB 2L43A 2L0BA 4BBQA 4YBSA 3GV4A 2G43A 3I2DA 2YYRA 1VYXA 4R2YA 2EODA 2ECTA 2Y1MA 4CCGX 2YW8A 2OXQC 2H0DA 5J3XA 2L75A 2C2LA 3VK6A 5B79A 2VP7A 3IHPA 2VPGA 1V87A 3ZYQA 4YABA 5DKAA 5B8DA 4ZUXU 2MNZA 2CT2A 2KREA 2Y1NA 2ECJA 4B86C 1MM2A 4LADB 2VJEB 3O33A 2YU4A 4GNEA 2ECGA 1X4JA 1X4IA 2C2VS 5H1UA 4W4UA 5AITA 1WE9A 4WZ2A 2QICA 4L7XA 2HYED 2MA5A 4LK9A 1CHCA 1WEUA 2VJFB 3LQHA 1XWHA 2ECIA 3O70A 2K16A 3N9MA 3U5PA 4F52B 5H1VA 2YHNA 3T7LA 1E4UA 2EA6A 1JM7B 2ECWA 4S3OB 3EB6A 3LQJA 4N4FA 4C9ZA 5D1MB 1X4UA 2FUIA 2NAAA 2YQMA 2YQLA 2FSAA 2LV9A 3SOWA 1HYJA 2CSZA 1MM3A 1WEOA 4WZ0A 2KWOA 2JMIA 4B7YC 1WEMA 2XEUA 2K4DA 3MHSA 5FB0A 1HYIA 2VPEA 5LKZA 2CKLA 2LGVA 4R7EA 4QF3A 5TDWA 2LQ6A 1BORA 4FIPA 3ZNIA 2F6NA 2MT5A 4AYCB 2YREA 4WZ3B 4FK5A 1JOCA 2BAYA 5LKUA 4TKPB 4PTBA 5FB1A 2DX8A 2ECNA 2K1JA 2L80A 3ZVZB 1WIMA 2QJ0A 4LJNA 4AUQB 5EYAF 5C13A 3O34A 2AN6A 3M63A 2KGGA 5H9MA 4UI9B 2RI7A 1WENA 2K17A 5B76A 2F6JA 2MA6A 3DQVR 2LGGA 4ZDTA 2LRIC 3U5NA 1FP0A 3ASLA 2YT5A 5G0FA 3O7AA 3PUQA 1VFYA 1WEWA 4FJCA 3KV5A 2M6MA 3QZVA 4IC3A 2CSYA 2LGLA 4I7BA 2VNFA 3N9PA 3RTRB 2JRJA 5KH9A 3N9OA 2RSDA 3GL6A 4LLBA 1VD4A 1K2FA 3PHDA 1Z6UA 5LCWB 4YAXA 4A49A 2VPDA 2KWJA 4X3GA 2KYUA 3MHHA 4CA1A 4QF2A 3U5OA 2LXHC 2FUUA 4N3WA 3LRQA 3V43A 3N9LA 2YUCA 2PUYA 4O64A 3L1ZB 4MVTA 5AIUA 2YHOA 4UP5A 3ZPV1 3PURA 3O35A 2JMDA 4ZQLA 2MUMA 4V3LC 1JM7A 3N9NA 2KR4A 1Z2QA 3RPGB 5DINA 2I50A 5C11A 2PNXA 4FO9A 2ECVA 2MIQA 1WEEA 1RMDA 2KU3A 1N87A 4WA6A 4GNFA 1WILA 3NG2A 2YSMA 5TABA 3T6RA 5I3LA 1Z60A 5TDRA 4YBMA 4V3KC 4P5OB 5B75A 2LDRA 5TRBA 5FEYA 5G05B 3KNVA 3ZPVE 3L11A 2VJFA 2JMJA 2L5UA 1LDJB 1ZBDB 5TBNA 2F42A 2MD8C 2E6SA 2QIZA 3RPGC 4A4CA 3KV6A 1T1HA 4YADA 4PPEA 4MSXA 3HCTA 3HTKC 3SOUA 5LKXA 3M62A 3U5MA 2M3HA 3HCUA 5JG6A 3L1XA 4GNGA 2G45A 2D8SA 4YC9A 2KIZA 3O37A 4S3OC 3ZTGA 1LDKC 1G25A 3C6WA 2Y43A 3HCSA 5KH7A 4A4BA 2YURA 2VJEA 2VPBA 4LKAA 5B77A 4A0CD 1U6GB 5LKTA 2LN0A 1WGMA 3FL2A 3C5KA 2LXPC 2YSJA 1DVPA 3EB5A 4AP4A 2MD7B 2H0DB 3M99A 3O36A 5FERA 4XI1A 2LGKA 4IC2A 2KE1A 1IYMA 2HDPA 3LQIA 1WESA 2MNYA 2ZETC 1WEPA 4YATA 2KFTA 2M85A 2IDAA 4GNDA 5G04B 4NN2A 2EGPA 2E6RA 3SOXA 4R8PK 3ZVYA 1WEVA 1WEQA 4AVXA 2UZGA 5H1TA 3DPLR 1F62A 2KWNA 4I7DA 3KQIA 4L58A 2G6QA 1FBVA 4AYCA 4BHWA 2KGIA 2XB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP0 A;  2KWK A;  2M1R A;  5B78 A;  4I7C A;  4Q6F A;  5D1K B;  5KH3 A;  3N9Q A;  5D1L B;  4GB0 A;  4YBT A;  3SHB A;  1WFK A;  2CKL B;  2L43 A;  2L0B A;  4BBQ A;  4YBS A;  3GV4 A;  2G43 A;  3I2D A;  2YYR A;  1VYX A;  4R2Y A;  2EOD A;  2ECT A;  2Y1M A;  4CCG X;  2YW8 A;  2OXQ C;  2H0D A;  5J3X A;  2L75 A;  2C2L A;  3VK6 A;  5B79 A;  2VP7 A;  3IHP A;  2VPG A;  1V87 A;  3ZYQ A;  4YAB A;  5DKA A;  5B8D A;  4ZUX U;  2MNZ A;  2CT2 A;  2KRE A;  2Y1N A;  2ECJ A;  4B86 C;  1MM2 A;  4LAD B;  2VJE B;  3O33 A;  2YU4 A;  4GNE A;  2ECG A;  1X4J A;  1X4I A;  2C2V S;  5H1U A;  4W4U A;  5AIT A;  1WE9 A;  4WZ2 A;  2QIC A;  4L7X A;  2HYE D;  2MA5 A;  4LK9 A;  1CHC A;  1WEU A;  2VJF B;  3LQH A;  1XWH A;  2ECI A;  3O70 A;  2K16 A;  3N9M A;  3U5P A;  4F52 B;  5H1V A;  2YHN A;  3T7L A;  1E4U A;  2EA6 A;  1JM7 B;  2ECW A;  4S3O B;  3EB6 A;  3LQJ A;  4N4F A;  4C9Z A;  5D1M B;  1X4U A;  2FUI A;  2NAA A;  2YQM A;  2YQL A;  2FSA A;  2LV9 A;  3SOW A;  1HYJ A;  2CSZ A;  1MM3 A;  1WEO A;  4WZ0 A;  2KWO A;  2JMI A;  4B7Y C;  1WEM A;  2XEU A;  2K4D A;  3MHS A;  5FB0 A;  1HYI A;  2VPE A;  5LKZ A;  2CKL A;  2LGV A;  4R7E A;  4QF3 A;  5TDW A;  2LQ6 A;  1BOR A;  4FIP A;  3ZNI A;  2F6N A;  2MT5 A;  4AYC B;  2YRE A;  4WZ3 B;  4FK5 A;  1JOC A;  2BAY A;  5LKU A;  4TKP B;  4PTB A;  5FB1 A;  2DX8 A;  2ECN A;  2K1J A;  2L80 A;  3ZVZ B;  1WIM A;  2QJ0 A;  4LJN A;  4AUQ B;  5EYA F;  5C13 A;  3O34 A;  2AN6 A;  3M63 A;  2KGG A;  5H9M A;  4UI9 B;  2RI7 A;  1WEN A;  2K17 A;  5B76 A;  2F6J A;  2MA6 A;  3DQV R;  2LGG A;  4ZDT A;  2LRI C;  3U5N A;  1FP0 A;  3ASL A;  2YT5 A;  5G0F A;  3O7A A;  3PUQ A;  1VFY A;  1WEW A;  4FJC A;  3KV5 A;  2M6M A;  3QZV A;  4IC3 A;  2CSY A;  2LGL A;  4I7B A;  2VNF A;  3N9P A;  3RTR B;  2JRJ A;  5KH9 A;  3N9O A;  2RSD A;  3GL6 A;  4LLB A;  1VD4 A;  1K2F A;  3PHD A;  1Z6U A;  5LCW B;  4YAX A;  4A49 A;  2VPD A;  2KWJ A;  4X3G A;  2KYU A;  3MHH A;  4CA1 A;  4QF2 A;  3U5O A;  2LXH C;  2FUU A;  4N3W A;  3LRQ A;  3V43 A;  3N9L A;  2YUC A;  2PUY A;  4O64 A;  3L1Z B;  4MVT A;  5AIU A;  2YHO A;  4UP5 A;  3ZPV 1;  3PUR A;  3O35 A;  2JMD A;  4ZQL A;  2MUM A;  4V3L C;  1JM7 A;  3N9N A;  2KR4 A;  1Z2Q A;  3RPG B;  5DIN A;  2I50 A;  5C11 A;  2PNX A;  4FO9 A;  2ECV A;  2MIQ A;  1WEE A;  1RMD A;  2KU3 A;  1N87 A;  4WA6 A;  4GNF A;  1WIL A;  3NG2 A;  2YSM A;  5TAB A;  3T6R A;  5I3L A;  1Z60 A;  5TDR A;  4YBM A;  4V3K C;  4P5O B;  5B75 A;  2LDR A;  5TRB A;  5FEY A;  5G05 B;  3KNV A;  3ZPV E;  3L11 A;  2VJF A;  2JMJ A;  2L5U A;  1LDJ B;  1ZBD B;  5TBN A;  2F42 A;  2MD8 C;  2E6S A;  2QIZ A;  3RPG C;  4A4C A;  3KV6 A;  1T1H A;  4YAD A;  4PPE A;  4MSX A;  3HCT A;  3HTK C;  3SOU A;  5LKX A;  3M62 A;  3U5M A;  2M3H A;  3HCU A;  5JG6 A;  3L1X A;  4GNG A;  2G45 A;  2D8S A;  4YC9 A;  2KIZ A;  3O37 A;  4S3O C;  3ZTG A;  1LDK C;  1G25 A;  3C6W A;  2Y43 A;  3HCS A;  5KH7 A;  4A4B A;  2YUR A;  2VJE A;  2VPB A;  4LKA A;  5B77 A;  4A0C D;  1U6G B;  5LKT A;  2LN0 A;  1WGM A;  3FL2 A;  3C5K A;  2LXP C;  2YSJ A;  1DVP A;  3EB5 A;  4AP4 A;  2MD7 B;  2H0D B;  3M99 A;  3O36 A;  5FER A;  4XI1 A;  2LGK A;  4IC2 A;  2KE1 A;  1IYM A;  2HDP A;  3LQI A;  1WES A;  2MNY A;  2ZET C;  1WEP A;  4YAT A;  2KFT A;  2M85 A;  2IDA A;  4GND A;  5G04 B;  4NN2 A;  2EGP A;  2E6R A;  3SOX A;  4R8P K;  3ZVY A;  1WEV A;  1WEQ A;  4AVX A;  2UZG A;  5H1T A;  3DPL R;  1F62 A;  2KWN A;  4I7D A;  3KQI A;  4L58 A;  2G6Q A;  1FBV A;  4AYC A;  4BHW A;  2KGI A;  2XB1 A; 
#chains in the Genus database with same CATH topology
 4UP0 A;  2KWK A;  2M1R A;  5B78 A;  4I7C A;  4Q6F A;  5D1K B;  5KH3 A;  3N9Q A;  3FJU B;  2XP0 A;  5D1L B;  4YBT A;  4GB0 A;  3SHB A;  1WFK A;  2CKL B;  2L43 A;  2L0B A;  4BBQ A;  2FFW A;  4YBS A;  3GV4 A;  2G43 A;  3FEH A;  3I2D A;  2L7P A;  2YYR A;  1VYX A;  4R2Y A;  2EOD A;  2ECT A;  2P57 A;  2Y1M A;  4CCG X;  2YW8 A;  2OXQ C;  2H0D A;  5J3X A;  3FM8 C;  2L75 A;  3Q1D A;  2C2L A;  3VK6 A;  5B79 A;  2VP7 A;  3IHP A;  2VPG A;  1V87 A;  3ZYQ A;  4YAB A;  5DKA A;  5B8D A;  4ZUX U;  2MNZ A;  2CT2 A;  2KRE A;  2Y1N A;  2ECJ A;  4B86 C;  1MM2 A;  3FAN A;  4LAD B;  2VJE B;  3O33 A;  2YU4 A;  4GNE A;  2ECG A;  5SVX A;  2M13 A;  1X4J A;  2XOY A;  1X4I A;  2C2V S;  5H1U A;  4W4U A;  5AIT A;  1WE9 A;  4WZ2 A;  2QIC A;  4L7X A;  2HYE D;  2MA5 A;  4LK9 A;  1CHC A;  1WEU A;  2VJF B;  3LQH A;  1XWH A;  2EXU A;  2ECI A;  3O70 A;  2K16 A;  3N9M A;  3U5P A;  4F52 B;  4O62 A;  5H1V A;  2YHN A;  2EGM A;  3T7L A;  5SVY A;  2EA6 A;  1E4U A;  1JM7 B;  2ECW A;  4S3O B;  3EB6 A;  3H7H A;  3LQJ A;  4N4F A;  4C9Z A;  5D1M B;  1X4U A;  2FUI A;  2NAA A;  2E61 A;  2KKX A;  2YQL A;  2YQM A;  2FSA A;  2LV9 A;  3SOW A;  1HYJ A;  2CSZ A;  3SUB A;  1MM3 A;  3KDE C;  1WEO A;  4WZ0 A;  2KWO A;  2JMI A;  4B7Y C;  1WEM A;  2XEU A;  2K4D A;  3MHS A;  3FAO A;  5FB0 A;  2KKY A;  1HYI A;  2VPE A;  5LKZ A;  2CKL A;  2LGV A;  4R7E A;  4QF3 A;  5TDW A;  2LQ6 A;  1BOR A;  4FIP A;  3ZNI A;  2LAU A;  2F6N A;  2MT5 A;  4AYC B;  2YRE A;  4WZ3 B;  4FK5 A;  1JOC A;  2BAY A;  5LKU A;  4TKP B;  4PTB A;  5FB1 A;  2DX8 A;  2ECN A;  2K1J A;  2L80 A;  3ZVZ B;  1WIM A;  2QJ0 A;  4LJN A;  4AUQ B;  5EYA F;  3DDT A;  4OGE A;  5C13 A;  3O34 A;  2AN6 A;  3M63 A;  2KGG A;  5H9M A;  3PLW A;  4UI9 B;  1MBM A;  2RI7 A;  1WEN A;  2K17 A;  5B76 A;  2F6J A;  2MA6 A;  3MDB C;  3DQV R;  2LGG A;  4ZDT A;  2LRI C;  3U5N A;  1FP0 A;  3ASL A;  2YT5 A;  5G0F A;  3O7A A;  3PUQ A;  2JM3 A;  1VFY A;  1WEW A;  4FJC A;  3O47 A;  3KV5 A;  2M6M A;  2IQJ A;  3QZV A;  4IC3 A;  2CSY A;  3LVQ E;  2LGL A;  4I7B A;  2VNF A;  3N9P A;  3RTR B;  2JRJ A;  5KH9 A;  5SVI A;  3N9O A;  2RSD A;  3GL6 A;  4LLB A;  1VD4 A;  1K2F A;  3LJU X;  3PHD A;  1Z6U A;  5LCW B;  4YAX A;  2CON A;  4A49 A;  2VPD A;  2RR4 A;  2KWJ A;  4X3G A;  2KYU A;  3MHH A;  4CA1 A;  4QF2 A;  3U5O A;  2LXH C;  2FUU A;  2DJA A;  4N3W A;  3LRQ A;  3V43 A;  3N9L A;  2YUC A;  2PUY A;  4O64 A;  3L1Z B;  4MVT A;  5AIU A;  2YHO A;  4UP5 A;  3ZPV 1;  1DCQ A;  3PUR A;  3O35 A;  2JMD A;  4ZQL A;  4QQ4 A;  2MUM A;  3E2D A;  4V3L C;  1JM7 A;  3N9N A;  2KR4 A;  1Z2Q A;  5DIN A;  3RPG B;  2I50 A;  5C11 A;  2PNX A;  4FO9 A;  2ECV A;  2MIQ A;  1WEE A;  1RMD A;  2KU3 A;  1N87 A;  4WA6 A;  4GNF A;  1WIL A;  3NG2 A;  2YSM A;  5TAB A;  3T6R A;  5I3L A;  1Z60 A;  5TDR A;  4YBM A;  3M7K A;  4V3K C;  4P5O B;  5B75 A;  2LDR A;  5TRB A;  5FEY A;  5G05 B;  3KNV A;  3ZPV E;  4F1P A;  3L11 A;  2VJF A;  2JMJ A;  2XOZ A;  2L5U A;  1LDJ B;  1ZBD B;  5TBN A;  2F42 A;  2MD8 C;  2FD4 A;  2E6S A;  2QIZ A;  3RPG C;  4H9D A;  4A4C A;  3KV6 A;  1T1H A;  4YAD A;  4PPE A;  4MSX A;  3HCT A;  5SVI B;  3HTK C;  2B0O E;  3SOU A;  2D8U A;  5LKX A;  2XOC A;  3M62 A;  3U5M A;  2M3H A;  3HCU A;  5JG6 A;  3L1X A;  4GNG A;  2G45 A;  2YVR A;  2D8S A;  2CRW A;  4YC9 A;  2KIZ A;  3O37 A;  4S3O C;  3ZTG A;  3LDY A;  1LDK C;  1G25 A;  3C6W A;  2Y43 A;  3LVR E;  3HCS A;  5KH7 A;  4A4B A;  2YUR A;  2VJE A;  2VPB A;  2JUN A;  4LKA A;  5B77 A;  3JUE A;  4A0C D;  1U6G B;  5LKT A;  2LN0 A;  1WGM A;  3FL2 A;  3C5K A;  2LXP C;  2YSJ A;  1DVP A;  3EB5 A;  4OGC A;  4AP4 A;  2MD7 B;  2H0D B;  3M99 A;  3O36 A;  5FER A;  4XI1 A;  2LGK A;  2OWA A;  4IC2 A;  4Z0O A;  2KE1 A;  1IYM A;  2HDP A;  2MKE A;  3LQI A;  1WES A;  2MNY A;  2ZET C;  1WEP A;  4YAT A;  2KFT A;  2M85 A;  2IDA A;  4GND A;  5G04 B;  2CRR A;  4NN2 A;  2EGP A;  2E6R A;  3SOX A;  4R8P K;  3ZVY A;  1WEV A;  1WEQ A;  2DSM A;  4AVX A;  2UZG A;  5H1T A;  3DPL R;  1F62 A;  5K3Q A;  4Z0R A;  2KWN A;  4I7D A;  3KQI A;  4L58 A;  2G6Q A;  1FBV A;  4AYC A;  3DWD A;  4BHW A;  3T9K A;  2CSV A;  2KGI A;  2XB1 A; 
#chains in the Genus database with same CATH homology
 4UP0 A;  2KWK A;  2M1R A;  5B78 A;  4I7C A;  4Q6F A;  5D1K B;  5KH3 A;  3N9Q A;  5D1L B;  4GB0 A;  4YBT A;  3SHB A;  1WFK A;  2CKL B;  2L43 A;  2L0B A;  4BBQ A;  4YBS A;  3GV4 A;  2G43 A;  3I2D A;  2YYR A;  1VYX A;  4R2Y A;  2EOD A;  2ECT A;  2Y1M A;  4CCG X;  2YW8 A;  2OXQ C;  2H0D A;  5J3X A;  2L75 A;  2C2L A;  3VK6 A;  5B79 A;  2VP7 A;  3IHP A;  2VPG A;  1V87 A;  3ZYQ A;  4YAB A;  5DKA A;  5B8D A;  4ZUX U;  2MNZ A;  2CT2 A;  2KRE A;  2Y1N A;  2ECJ A;  4B86 C;  1MM2 A;  4LAD B;  2VJE B;  3O33 A;  2YU4 A;  4GNE A;  2ECG A;  1X4J A;  1X4I A;  2C2V S;  5H1U A;  4W4U A;  5AIT A;  1WE9 A;  4WZ2 A;  2QIC A;  4L7X A;  2HYE D;  2MA5 A;  4LK9 A;  1CHC A;  1WEU A;  2VJF B;  3LQH A;  1XWH A;  2ECI A;  3O70 A;  2K16 A;  3N9M A;  3U5P A;  4F52 B;  5H1V A;  2YHN A;  3T7L A;  1E4U A;  2EA6 A;  1JM7 B;  2ECW A;  4S3O B;  3EB6 A;  3LQJ A;  4N4F A;  4C9Z A;  5D1M B;  1X4U A;  2FUI A;  2NAA A;  2YQM A;  2YQL A;  2FSA A;  2LV9 A;  3SOW A;  1HYJ A;  2CSZ A;  1MM3 A;  1WEO A;  4WZ0 A;  2KWO A;  2JMI A;  4B7Y C;  1WEM A;  2XEU A;  2K4D A;  3MHS A;  5FB0 A;  1HYI A;  2VPE A;  5LKZ A;  2CKL A;  2LGV A;  4R7E A;  4QF3 A;  5TDW A;  2LQ6 A;  1BOR A;  4FIP A;  3ZNI A;  2F6N A;  2MT5 A;  4AYC B;  2YRE A;  4WZ3 B;  4FK5 A;  1JOC A;  2BAY A;  5LKU A;  4TKP B;  4PTB A;  5FB1 A;  2DX8 A;  2ECN A;  2K1J A;  2L80 A;  3ZVZ B;  1WIM A;  2QJ0 A;  4LJN A;  4AUQ B;  5EYA F;  5C13 A;  3O34 A;  2AN6 A;  3M63 A;  2KGG A;  5H9M A;  4UI9 B;  2RI7 A;  1WEN A;  2K17 A;  5B76 A;  2F6J A;  2MA6 A;  3DQV R;  2LGG A;  4ZDT A;  2LRI C;  3U5N A;  1FP0 A;  3ASL A;  2YT5 A;  5G0F A;  3O7A A;  3PUQ A;  1VFY A;  1WEW A;  4FJC A;  3KV5 A;  2M6M A;  3QZV A;  4IC3 A;  2CSY A;  2LGL A;  4I7B A;  2VNF A;  3N9P A;  3RTR B;  2JRJ A;  5KH9 A;  3N9O A;  2RSD A;  3GL6 A;  4LLB A;  1VD4 A;  1K2F A;  3PHD A;  1Z6U A;  5LCW B;  4YAX A;  4A49 A;  2VPD A;  2KWJ A;  4X3G A;  2KYU A;  3MHH A;  4CA1 A;  4QF2 A;  3U5O A;  2LXH C;  2FUU A;  4N3W A;  3LRQ A;  3V43 A;  3N9L A;  2YUC A;  2PUY A;  4O64 A;  3L1Z B;  4MVT A;  5AIU A;  2YHO A;  4UP5 A;  3ZPV 1;  3PUR A;  3O35 A;  2JMD A;  4ZQL A;  2MUM A;  4V3L C;  1JM7 A;  3N9N A;  2KR4 A;  1Z2Q A;  3RPG B;  5DIN A;  2I50 A;  5C11 A;  2PNX A;  4FO9 A;  2ECV A;  2MIQ A;  1WEE A;  1RMD A;  2KU3 A;  1N87 A;  4WA6 A;  4GNF A;  1WIL A;  3NG2 A;  2YSM A;  5TAB A;  3T6R A;  5I3L A;  1Z60 A;  5TDR A;  4YBM A;  4V3K C;  4P5O B;  5B75 A;  2LDR A;  5TRB A;  5FEY A;  5G05 B;  3KNV A;  3ZPV E;  3L11 A;  2VJF A;  2JMJ A;  2L5U A;  1LDJ B;  1ZBD B;  5TBN A;  2F42 A;  2MD8 C;  2E6S A;  2QIZ A;  3RPG C;  4A4C A;  3KV6 A;  1T1H A;  4YAD A;  4PPE A;  4MSX A;  3HCT A;  3HTK C;  3SOU A;  5LKX A;  3M62 A;  3U5M A;  2M3H A;  3HCU A;  5JG6 A;  3L1X A;  4GNG A;  2G45 A;  2D8S A;  4YC9 A;  2KIZ A;  3O37 A;  4S3O C;  3ZTG A;  1LDK C;  1G25 A;  3C6W A;  2Y43 A;  3HCS A;  5KH7 A;  4A4B A;  2YUR A;  2VJE A;  2VPB A;  4LKA A;  5B77 A;  4A0C D;  1U6G B;  5LKT A;  2LN0 A;  1WGM A;  3FL2 A;  3C5K A;  2LXP C;  2YSJ A;  1DVP A;  3EB5 A;  4AP4 A;  2MD7 B;  2H0D B;  3M99 A;  3O36 A;  5FER A;  4XI1 A;  2LGK A;  4IC2 A;  2KE1 A;  1IYM A;  2HDP A;  3LQI A;  1WES A;  2MNY A;  2ZET C;  1WEP A;  4YAT A;  2KFT A;  2M85 A;  2IDA A;  4GND A;  5G04 B;  4NN2 A;  2EGP A;  2E6R A;  3SOX A;  4R8P K;  3ZVY A;  1WEV A;  1WEQ A;  4AVX A;  2UZG A;  5H1T A;  3DPL R;  1F62 A;  2KWN A;  4I7D A;  3KQI A;  4L58 A;  2G6Q A;  1FBV A;  4AYC A;  4BHW A;  2KGI A;  2XB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...