5B78A

Crystal structure of moz double phd finger mutant-s210d/n235r in complex with histone h3 crotonylation at k14
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'SLPHEKDKPVAEPIPICDFCLGTKEQNREKKPEELISCADCGRSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 119
sequence length 119
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b78A00
2VJEB 2KFTA 4B7YC 5FEYA 3ASLA 2FUIA 2VPBA 3U5OA 1WEQA 1K2FA 1WEWA 4WA6A 2M85A 2JMJA 4L58A 3HCUA 1JM7B 4A4CA 3L1ZB 4YAXA 4TKPB 2H0DA 2RSDA 3SOXA 5B76A 5I3LA 5B8DA 2K16A 3ZYQA 2VNFA 4LKAA 2HDPA 3PUQA 4ZUXU 3O37A 1V87A 5H1TA 4P5OB 3PHDA 2VPEA 5D1MB 4X3GA 5G0FA 4A49A 3N9MA 4AUQB 3C6WA 2PUYA 5H1UA 2AN6A 1LDKC 1BORA 3M62A 2E6RA 2EA6A 5TBNA 2UZGA 2JRJA 2L75A 3SOUA 1E4UA 4GNFA 1Z2QA 4BHWA 2VPGA 2LXHC 5FB0A 1WEEA 3ZNIA 1LDJB 4N4FA 5LKXA 1FP0A 5H9MA 3ZVYA 2YSMA 4I7DA 2XB1A 5TRBA 4QF2A 2LGVA 3ZVZB 2LGGA 4CCGX 4GNGA 5G04B 1X4JA 2YQMA 2CT2A 1WEMA 2JMDA 1T1HA 3EB5A 2VJFA 2K4DA 2VJFB 4WZ0A 3FL2A 5EYAF 4L7XA 3U5PA 3KNVA 2LXPC 4B86C 5B79A 4MVTA 3GV4A 4V3LC 3IHPA 4UP0A 2MIQA 3V43A 1WESA 4R2YA 3LQHA 5J3XA 2YQLA 2IDAA 2KWJA 2Y1MA 1X4IA 3DPLR 4UI9B 2LN0A 4A4BA 4GB0A 2L80A 2F42A 2KWKA 2VJEA 2KREA 2PNXA 4R8PK 3N9PA 2L43A 3HTKC 2YURA 4PPEA 2LDRA 3DQVR 5FERA 1JM7A 1JOCA 3GL6A 2ECNA 3KQIA 2DX8A 2XEUA 3NG2A 4Q6FA 2YSJA 1WFKA 3U5MA 3L1XA 2LGLA 5TDWA 4FJCA 4S3OC 2CSYA 2MUMA 3SHBA 3LQJA 5DKAA 1DVPA 5JG6A 2F6NA 3LQIA 3N9NA 1WE9A 4GNDA 4MSXA 1U6GB 5KH9A 1WEOA 1F62A 2ECGA 1G25A 2YU4A 3RPGB 1VFYA 4YABA 2M1RA 4YATA 4A0CD 2MT5A 2YW8A 2YYRA 2L0BA 4QF3A 4FO9A 2L5UA 5LKTA 2E6SA 2VPDA 2MNZA 4AVXA 2QICA 2KIZA 4I7CA 1VD4A 2RI7A 2OXQC 2KU3A 2K17A 4ZDTA 2ECTA 2F6JA 1WENA 3C5KA 2ECJA 3O36A 2ECVA 3SOWA 2I50A 2YHNA 2G43A 3RTRB 4FK5A 5KH3A 1FBVA 5C11A 5AIUA 4V3KC 4PTBA 2LRIC 5DINA 2LV9A 4R7EA 5LKUA 3N9LA 5C13A 1HYIA 1N87A 3M63A 4YBSA 1VYXA 2KWOA 2LGKA 4WZ3B 3KV6A 2VP7A 3O35A 1MM3A 4YBMA 3ZPV1 3N9OA 2MA6A 4LJNA 4YC9A 2KGIA 5TABA 3N9QA 4CA1A 4LLBA 1MM2A 1XWHA 1X4UA 1WEUA 2C2LA 3ZPVE 2FSAA 2MA5A 4XI1A 4AP4A 1WIMA 2MNYA 3T7LA 5H1VA 3U5NA 3HCTA 4FIPA 2D8SA 3I2DA 2ECWA 2Y1NA 4GNEA 5D1KB 4WZ2A 1ZBDB 2H0DB 1Z60A 2BAYA 2YHOA 4IC2A 2KR4A 2LQ6A 5KH7A 2HYED 4I7BA 1WGMA 4IC3A 4YBTA 4LK9A 3T6RA 2KWNA 2G6QA 1WEPA 2FUUA 1HYJA 3MHSA 2CSZA 3L11A 5FB1A 2C2VS 3M99A 3EB6A 2KYUA 5LCWB 3PURA 5AITA 4AYCA 2KGGA 4AYCB 2NAAA 3LRQA 1IYMA 2YT5A 2M3HA 2YUCA 1WEVA 3O34A 2ECIA 3RPGC 2MD8C 2CKLA 3O7AA 2CKLB 3O70A 3VK6A 2Y43A 1CHCA 4LADB 2QJ0A 4YADA 2KE1A 4NN2A 2ZETC 4N3WA 4W4UA 5D1LB 2K1JA 3MHHA 2EGPA 2M6MA 5G05B 3HCSA 2JMIA 3ZTGA 5B77A 2EODA 2MD7B 4C9ZA 5LKZA 1WILA 5B75A 3O33A 4F52B 1RMDA 3KV5A 4UP5A 2G45A 2YREA 2QIZA 4BBQA 4ZQLA 4O64A 1Z6UA 5B78A 5TDRA 3QZVA 4S3OB
chains in the Genus database with same CATH superfamily
2VJEB 2KFTA 4B7YC 1DCQA 5FEYA 3ASLA 2FUIA 2VPBA 3U5OA 2M13A 2XOCA 1WEQA 3JUEA 5SVYA 1K2FA 1WEWA 4WA6A 2M85A 2JMJA 2KKYA 2CONA 4L58A 3HCUA 1JM7B 4A4CA 3L1ZB 4YAXA 4TKPB 2H0DA 2RSDA 3SOXA 5B76A 5I3LA 5B8DA 2K16A 3ZYQA 2EGMA 2VNFA 4LKAA 2HDPA 3PUQA 4ZUXU 3O37A 1V87A 5H1TA 2FD4A 4P5OB 3PHDA 2VPEA 5D1MB 2XOYA 4X3GA 5G0FA 4A49A 3N9MA 4AUQB 3C6WA 2PUYA 3LJUX 5H1UA 2AN6A 1LDKC 1BORA 3M62A 3DWDA 2E6RA 2EA6A 5TBNA 2UZGA 2JRJA 2L75A 3KDEC 3SOUA 1E4UA 4GNFA 2EXUA 1Z2QA 4BHWA 2VPGA 2LXHC 5FB0A 1WEEA 3ZNIA 1LDJB 4N4FA 5LKXA 1FP0A 5H9MA 3ZVYA 2YSMA 4I7DA 2XB1A 5TRBA 4QF2A 2LGVA 3ZVZB 2LGGA 4CCGX 2XOZA 4GNGA 5G04B 1X4JA 2YQMA 2CT2A 1WEMA 2JMDA 1T1HA 3EB5A 2VJFA 2K4DA 2VJFB 4WZ0A 2CRRA 3FL2A 5EYAF 4L7XA 3U5PA 3KNVA 2LXPC 3LDYA 4B86C 5B79A 4MVTA 3GV4A 4V3LC 3IHPA 4UP0A 2MIQA 3V43A 1WESA 4R2YA 3LQHA 5J3XA 2YQLA 2IDAA 3M7KA 2KWJA 2Y1MA 1X4IA 3DPLR 4UI9B 2LN0A 4A4BA 4Z0OA 4GB0A 2L80A 2F42A 2KWKA 2VJEA 2KREA 2PNXA 4R8PK 3N9PA 2L43A 3HTKC 2D8UA 2YURA 4PPEA 2LDRA 3DQVR 5FERA 1JM7A 1JOCA 3GL6A 2ECNA 3KQIA 3LVRE 2DX8A 2XEUA 3NG2A 4Q6FA 2YSJA 1WFKA 2IQJA 3U5MA 3L1XA 2LGLA 5TDWA 4FJCA 4OGCA 4S3OC 2CSYA 2MUMA 3SHBA 2MKEA 3H7HA 3LQJA 5DKAA 1DVPA 5JG6A 2F6NA 3LQIA 3N9NA 1WE9A 2DSMA 4GNDA 4MSXA 1U6GB 5KH9A 4H9DA 1WEOA 1F62A 2ECGA 2DJAA 1G25A 3Q1DA 2YU4A 3RPGB 1VFYA 4YABA 2L7PA 2M1RA 4YATA 4A0CD 2MT5A 2YW8A 2YYRA 2L0BA 4QF3A 4FO9A 2L5UA 5LKTA 2E6SA 2VPDA 2MNZA 4AVXA 2QICA 2KIZA 5SVIA 4I7CA 1VD4A 2RI7A 5SVIB 2OXQC 2KU3A 2K17A 4ZDTA 2ECTA 2F6JA 1MBMA 1WENA 3C5KA 4OGEA 2ECJA 3O36A 2JM3A 2ECVA 3SOWA 2I50A 2YHNA 2G43A 2OWAA 3RTRB 4FK5A 2B0OE 5KH3A 1FBVA 2RR4A 4F1PA 5C11A 5AIUA 4V3KC 4PTBA 3E2DA 2LRIC 5DINA 2LV9A 4R7EA 5LKUA 3N9LA 3FJUB 3LVQE 5C13A 1HYIA 1N87A 3M63A 4YBSA 1VYXA 2KWOA 2LGKA 4WZ3B 3KV6A 2VP7A 4Z0RA 3O35A 3DDTA 1MM3A 4YBMA 3ZPV1 3N9OA 2MA6A 4LJNA 4YC9A 2KGIA 5TABA 3N9QA 4CA1A 4LLBA 2LAUA 1MM2A 1XWHA 1X4UA 2XP0A 1WEUA 3PLWA 2C2LA 3ZPVE 2FSAA 2MA5A 4XI1A 4AP4A 1WIMA 2MNYA 5SVXA 3T7LA 5H1VA 3U5NA 3HCTA 4FIPA 2CRWA 2D8SA 3I2DA 2ECWA 2Y1NA 4GNEA 5D1KB 4WZ2A 3T9KA 3FANA 3SUBA 1ZBDB 2H0DB 1Z60A 3FEHA 2BAYA 2YHOA 4IC2A 3O47A 2KR4A 2LQ6A 5KH7A 2JUNA 2HYED 4I7BA 1WGMA 4IC3A 4YBTA 4LK9A 2KKXA 2KWNA 3T6RA 2G6QA 1WEPA 2FUUA 1HYJA 3MHSA 2CSZA 3L11A 5FB1A 2C2VS 3FM8C 3M99A 3EB6A 2KYUA 5LCWB 3PURA 2P57A 5AITA 4AYCA 2KGGA 4AYCB 2NAAA 3LRQA 1IYMA 2YT5A 2M3HA 2YVRA 2YUCA 1WEVA 3O34A 2ECIA 3RPGC 2MD8C 2CKLA 3O7AA 2CKLB 3O70A 3VK6A 2Y43A 1CHCA 4LADB 2QJ0A 4YADA 2KE1A 4NN2A 2ZETC 4N3WA 4W4UA 3FAOA 5D1LB 2K1JA 3MHHA 2EGPA 2M6MA 5G05B 3MDBC 3HCSA 2JMIA 3ZTGA 5B77A 2EODA 2MD7B 4C9ZA 5LKZA 1WILA 2CSVA 5B75A 3O33A 4F52B 2E61A 1RMDA 3KV5A 5K3QA 4UP5A 2G45A 4QQ4A 2YREA 2FFWA 2QIZA 4BBQA 4ZQLA 4O64A 1Z6UA 5B78A 5TDRA 4O62A 3QZVA 4S3OB
chains in the Genus database with same CATH topology
2VJEB 2KFTA 4B7YC 5FEYA 3ASLA 2FUIA 2VPBA 3U5OA 1WEQA 1K2FA 1WEWA 4WA6A 2M85A 2JMJA 4L58A 3HCUA 1JM7B 4A4CA 3L1ZB 4YAXA 4TKPB 2H0DA 2RSDA 3SOXA 5B76A 5I3LA 5B8DA 2K16A 3ZYQA 2VNFA 4LKAA 2HDPA 3PUQA 4ZUXU 3O37A 1V87A 5H1TA 4P5OB 3PHDA 2VPEA 5D1MB 4X3GA 5G0FA 4A49A 3N9MA 4AUQB 3C6WA 2PUYA 5H1UA 2AN6A 1LDKC 1BORA 3M62A 2E6RA 2EA6A 5TBNA 2UZGA 2JRJA 2L75A 3SOUA 1E4UA 4GNFA 1Z2QA 4BHWA 2VPGA 2LXHC 5FB0A 1WEEA 3ZNIA 1LDJB 4N4FA 5LKXA 1FP0A 5H9MA 3ZVYA 2YSMA 4I7DA 2XB1A 5TRBA 4QF2A 2LGVA 3ZVZB 2LGGA 4CCGX 4GNGA 5G04B 1X4JA 2YQMA 2CT2A 1WEMA 2JMDA 1T1HA 3EB5A 2VJFA 2K4DA 2VJFB 4WZ0A 3FL2A 5EYAF 4L7XA 3U5PA 3KNVA 2LXPC 4B86C 5B79A 4MVTA 3GV4A 4V3LC 3IHPA 4UP0A 2MIQA 3V43A 1WESA 4R2YA 3LQHA 5J3XA 2YQLA 2IDAA 2KWJA 2Y1MA 1X4IA 3DPLR 4UI9B 2LN0A 4A4BA 4GB0A 2L80A 2F42A 2KWKA 2VJEA 2KREA 2PNXA 4R8PK 3N9PA 2L43A 3HTKC 2YURA 4PPEA 2LDRA 3DQVR 5FERA 1JM7A 1JOCA 3GL6A 2ECNA 3KQIA 2DX8A 2XEUA 3NG2A 4Q6FA 2YSJA 1WFKA 3U5MA 3L1XA 2LGLA 5TDWA 4FJCA 4S3OC 2CSYA 2MUMA 3SHBA 3LQJA 5DKAA 1DVPA 5JG6A 2F6NA 3LQIA 3N9NA 1WE9A 4GNDA 4MSXA 1U6GB 5KH9A 1WEOA 1F62A 2ECGA 1G25A 2YU4A 3RPGB 1VFYA 4YABA 2M1RA 4YATA 4A0CD 2MT5A 2YW8A 2YYRA 2L0BA 4QF3A 4FO9A 2L5UA 5LKTA 2E6SA 2VPDA 2MNZA 4AVXA 2QICA 2KIZA 4I7CA 1VD4A 2RI7A 2OXQC 2KU3A 2K17A 4ZDTA 2ECTA 2F6JA 1WENA 3C5KA 2ECJA 3O36A 2ECVA 3SOWA 2I50A 2YHNA 2G43A 3RTRB 4FK5A 5KH3A 1FBVA 5C11A 5AIUA 4V3KC 4PTBA 2LRIC 5DINA 2LV9A 4R7EA 5LKUA 3N9LA 5C13A 1HYIA 1N87A 3M63A 4YBSA 1VYXA 2KWOA 2LGKA 4WZ3B 3KV6A 2VP7A 3O35A 1MM3A 4YBMA 3ZPV1 3N9OA 2MA6A 4LJNA 4YC9A 2KGIA 5TABA 3N9QA 4CA1A 4LLBA 1MM2A 1XWHA 1X4UA 1WEUA 2C2LA 3ZPVE 2FSAA 2MA5A 4XI1A 4AP4A 1WIMA 2MNYA 3T7LA 5H1VA 3U5NA 3HCTA 4FIPA 2D8SA 3I2DA 2ECWA 2Y1NA 4GNEA 5D1KB 4WZ2A 1ZBDB 2H0DB 1Z60A 2BAYA 2YHOA 4IC2A 2KR4A 2LQ6A 5KH7A 2HYED 4I7BA 1WGMA 4IC3A 4YBTA 4LK9A 3T6RA 2KWNA 2G6QA 1WEPA 2FUUA 1HYJA 3MHSA 2CSZA 3L11A 5FB1A 2C2VS 3M99A 3EB6A 2KYUA 5LCWB 3PURA 5AITA 4AYCA 2KGGA 4AYCB 2NAAA 3LRQA 1IYMA 2YT5A 2M3HA 2YUCA 1WEVA 3O34A 2ECIA 3RPGC 2MD8C 2CKLA 3O7AA 2CKLB 3O70A 3VK6A 2Y43A 1CHCA 4LADB 2QJ0A 4YADA 2KE1A 4NN2A 2ZETC 4N3WA 4W4UA 5D1LB 2K1JA 3MHHA 2EGPA 2M6MA 5G05B 3HCSA 2JMIA 3ZTGA 5B77A 2EODA 2MD7B 4C9ZA 5LKZA 1WILA 5B75A 3O33A 4F52B 1RMDA 3KV5A 4UP5A 2G45A 2YREA 2QIZA 4BBQA 4ZQLA 4O64A 1Z6UA 5B78A 5TDRA 3QZVA 4S3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE B;  2KFT A;  4B7Y C;  5FEY A;  3ASL A;  2FUI A;  2VPB A;  3U5O A;  1WEQ A;  1K2F A;  1WEW A;  4WA6 A;  2M85 A;  2JMJ A;  4L58 A;  3HCU A;  1JM7 B;  4A4C A;  3L1Z B;  4YAX A;  4TKP B;  2H0D A;  2RSD A;  3SOX A;  5B76 A;  5I3L A;  5B8D A;  2K16 A;  3ZYQ A;  2VNF A;  4LKA A;  2HDP A;  3PUQ A;  4ZUX U;  3O37 A;  1V87 A;  5H1T A;  4P5O B;  3PHD A;  2VPE A;  5D1M B;  4X3G A;  5G0F A;  4A49 A;  3N9M A;  4AUQ B;  3C6W A;  2PUY A;  5H1U A;  2AN6 A;  1LDK C;  1BOR A;  3M62 A;  2E6R A;  2EA6 A;  5TBN A;  2UZG A;  2JRJ A;  2L75 A;  3SOU A;  1E4U A;  4GNF A;  1Z2Q A;  4BHW A;  2VPG A;  2LXH C;  5FB0 A;  1WEE A;  3ZNI A;  1LDJ B;  4N4F A;  5LKX A;  1FP0 A;  5H9M A;  3ZVY A;  2YSM A;  4I7D A;  2XB1 A;  5TRB A;  4QF2 A;  2LGV A;  3ZVZ B;  2LGG A;  4CCG X;  4GNG A;  5G04 B;  1X4J A;  2YQM A;  2CT2 A;  1WEM A;  2JMD A;  1T1H A;  3EB5 A;  2VJF A;  2K4D A;  2VJF B;  4WZ0 A;  3FL2 A;  5EYA F;  4L7X A;  3U5P A;  3KNV A;  2LXP C;  4B86 C;  5B79 A;  4MVT A;  3GV4 A;  4V3L C;  3IHP A;  4UP0 A;  2MIQ A;  3V43 A;  1WES A;  4R2Y A;  3LQH A;  5J3X A;  2YQL A;  2IDA A;  2KWJ A;  2Y1M A;  1X4I A;  3DPL R;  4UI9 B;  2LN0 A;  4A4B A;  4GB0 A;  2L80 A;  2F42 A;  2KWK A;  2VJE A;  2KRE A;  2PNX A;  4R8P K;  3N9P A;  2L43 A;  3HTK C;  2YUR A;  4PPE A;  2LDR A;  3DQV R;  5FER A;  1JM7 A;  1JOC A;  3GL6 A;  2ECN A;  3KQI A;  2DX8 A;  2XEU A;  3NG2 A;  4Q6F A;  2YSJ A;  1WFK A;  3U5M A;  3L1X A;  2LGL A;  5TDW A;  4FJC A;  4S3O C;  2CSY A;  2MUM A;  3SHB A;  3LQJ A;  5DKA A;  1DVP A;  5JG6 A;  2F6N A;  3LQI A;  3N9N A;  1WE9 A;  4GND A;  4MSX A;  1U6G B;  5KH9 A;  1WEO A;  1F62 A;  2ECG A;  1G25 A;  2YU4 A;  3RPG B;  1VFY A;  4YAB A;  2M1R A;  4YAT A;  4A0C D;  2MT5 A;  2YW8 A;  2YYR A;  2L0B A;  4QF3 A;  4FO9 A;  2L5U A;  5LKT A;  2E6S A;  2VPD A;  2MNZ A;  4AVX A;  2QIC A;  2KIZ A;  4I7C A;  1VD4 A;  2RI7 A;  2OXQ C;  2KU3 A;  2K17 A;  4ZDT A;  2ECT A;  2F6J A;  1WEN A;  3C5K A;  2ECJ A;  3O36 A;  2ECV A;  3SOW A;  2I50 A;  2YHN A;  2G43 A;  3RTR B;  4FK5 A;  5KH3 A;  1FBV A;  5C11 A;  5AIU A;  4V3K C;  4PTB A;  2LRI C;  5DIN A;  2LV9 A;  4R7E A;  5LKU A;  3N9L A;  5C13 A;  1HYI A;  1N87 A;  3M63 A;  4YBS A;  1VYX A;  2KWO A;  2LGK A;  4WZ3 B;  3KV6 A;  2VP7 A;  3O35 A;  1MM3 A;  4YBM A;  3ZPV 1;  3N9O A;  2MA6 A;  4LJN A;  4YC9 A;  2KGI A;  5TAB A;  3N9Q A;  4CA1 A;  4LLB A;  1MM2 A;  1XWH A;  1X4U A;  1WEU A;  2C2L A;  3ZPV E;  2FSA A;  2MA5 A;  4XI1 A;  4AP4 A;  1WIM A;  2MNY A;  3T7L A;  5H1V A;  3U5N A;  3HCT A;  4FIP A;  2D8S A;  3I2D A;  2ECW A;  2Y1N A;  4GNE A;  5D1K B;  4WZ2 A;  1ZBD B;  2H0D B;  1Z60 A;  2BAY A;  2YHO A;  4IC2 A;  2KR4 A;  2LQ6 A;  5KH7 A;  2HYE D;  4I7B A;  1WGM A;  4IC3 A;  4YBT A;  4LK9 A;  3T6R A;  2KWN A;  2G6Q A;  1WEP A;  2FUU A;  1HYJ A;  3MHS A;  2CSZ A;  3L11 A;  5FB1 A;  2C2V S;  3M99 A;  3EB6 A;  2KYU A;  5LCW B;  3PUR A;  5AIT A;  4AYC A;  2KGG A;  4AYC B;  2NAA A;  3LRQ A;  1IYM A;  2YT5 A;  2M3H A;  2YUC A;  1WEV A;  3O34 A;  2ECI A;  3RPG C;  2MD8 C;  2CKL A;  3O7A A;  2CKL B;  3O70 A;  3VK6 A;  2Y43 A;  1CHC A;  4LAD B;  2QJ0 A;  4YAD A;  2KE1 A;  4NN2 A;  2ZET C;  4N3W A;  4W4U A;  5D1L B;  2K1J A;  3MHH A;  2EGP A;  2M6M A;  5G05 B;  3HCS A;  2JMI A;  3ZTG A;  5B77 A;  2EOD A;  2MD7 B;  4C9Z A;  5LKZ A;  1WIL A;  5B75 A;  3O33 A;  4F52 B;  1RMD A;  3KV5 A;  4UP5 A;  2G45 A;  2YRE A;  2QIZ A;  4BBQ A;  4ZQL A;  4O64 A;  1Z6U A;  5B78 A;  5TDR A;  3QZV A;  4S3O B; 
#chains in the Genus database with same CATH topology
 2VJE B;  2KFT A;  4B7Y C;  1DCQ A;  5FEY A;  3ASL A;  2FUI A;  2VPB A;  3U5O A;  2M13 A;  2XOC A;  1WEQ A;  3JUE A;  5SVY A;  1K2F A;  1WEW A;  4WA6 A;  2M85 A;  2JMJ A;  2KKY A;  2CON A;  4L58 A;  3HCU A;  1JM7 B;  4A4C A;  3L1Z B;  4YAX A;  4TKP B;  2H0D A;  2RSD A;  3SOX A;  5B76 A;  5I3L A;  5B8D A;  2K16 A;  3ZYQ A;  2EGM A;  2VNF A;  4LKA A;  2HDP A;  3PUQ A;  4ZUX U;  3O37 A;  1V87 A;  5H1T A;  2FD4 A;  4P5O B;  3PHD A;  2VPE A;  5D1M B;  2XOY A;  4X3G A;  5G0F A;  4A49 A;  3N9M A;  4AUQ B;  3C6W A;  2PUY A;  3LJU X;  5H1U A;  2AN6 A;  1LDK C;  1BOR A;  3M62 A;  3DWD A;  2E6R A;  2EA6 A;  5TBN A;  2UZG A;  2JRJ A;  2L75 A;  3KDE C;  3SOU A;  1E4U A;  4GNF A;  2EXU A;  1Z2Q A;  4BHW A;  2VPG A;  2LXH C;  5FB0 A;  1WEE A;  3ZNI A;  1LDJ B;  4N4F A;  5LKX A;  1FP0 A;  5H9M A;  3ZVY A;  2YSM A;  4I7D A;  2XB1 A;  5TRB A;  4QF2 A;  2LGV A;  3ZVZ B;  2LGG A;  4CCG X;  2XOZ A;  4GNG A;  5G04 B;  1X4J A;  2YQM A;  2CT2 A;  1WEM A;  2JMD A;  1T1H A;  3EB5 A;  2VJF A;  2K4D A;  2VJF B;  4WZ0 A;  2CRR A;  3FL2 A;  5EYA F;  4L7X A;  3U5P A;  3KNV A;  2LXP C;  3LDY A;  4B86 C;  5B79 A;  4MVT A;  3GV4 A;  4V3L C;  3IHP A;  4UP0 A;  2MIQ A;  3V43 A;  1WES A;  4R2Y A;  3LQH A;  5J3X A;  2YQL A;  2IDA A;  3M7K A;  2KWJ A;  2Y1M A;  1X4I A;  3DPL R;  4UI9 B;  2LN0 A;  4A4B A;  4Z0O A;  4GB0 A;  2L80 A;  2F42 A;  2KWK A;  2VJE A;  2KRE A;  2PNX A;  4R8P K;  3N9P A;  2L43 A;  3HTK C;  2D8U A;  2YUR A;  4PPE A;  2LDR A;  3DQV R;  5FER A;  1JM7 A;  1JOC A;  3GL6 A;  2ECN A;  3KQI A;  3LVR E;  2DX8 A;  2XEU A;  3NG2 A;  4Q6F A;  2YSJ A;  1WFK A;  2IQJ A;  3U5M A;  3L1X A;  2LGL A;  5TDW A;  4FJC A;  4OGC A;  4S3O C;  2CSY A;  2MUM A;  3SHB A;  2MKE A;  3H7H A;  3LQJ A;  5DKA A;  1DVP A;  5JG6 A;  2F6N A;  3LQI A;  3N9N A;  1WE9 A;  2DSM A;  4GND A;  4MSX A;  1U6G B;  5KH9 A;  4H9D A;  1WEO A;  1F62 A;  2ECG A;  2DJA A;  1G25 A;  3Q1D A;  2YU4 A;  3RPG B;  1VFY A;  4YAB A;  2L7P A;  2M1R A;  4YAT A;  4A0C D;  2MT5 A;  2YW8 A;  2YYR A;  2L0B A;  4QF3 A;  4FO9 A;  2L5U A;  5LKT A;  2E6S A;  2VPD A;  2MNZ A;  4AVX A;  2QIC A;  2KIZ A;  5SVI A;  4I7C A;  1VD4 A;  2RI7 A;  5SVI B;  2OXQ C;  2KU3 A;  2K17 A;  4ZDT A;  2ECT A;  2F6J A;  1MBM A;  1WEN A;  3C5K A;  4OGE A;  2ECJ A;  3O36 A;  2JM3 A;  2ECV A;  3SOW A;  2I50 A;  2YHN A;  2G43 A;  2OWA A;  3RTR B;  4FK5 A;  2B0O E;  5KH3 A;  1FBV A;  2RR4 A;  4F1P A;  5C11 A;  5AIU A;  4V3K C;  4PTB A;  3E2D A;  2LRI C;  5DIN A;  2LV9 A;  4R7E A;  5LKU A;  3N9L A;  3FJU B;  3LVQ E;  5C13 A;  1HYI A;  1N87 A;  3M63 A;  4YBS A;  1VYX A;  2KWO A;  2LGK A;  4WZ3 B;  3KV6 A;  2VP7 A;  4Z0R A;  3O35 A;  3DDT A;  1MM3 A;  4YBM A;  3ZPV 1;  3N9O A;  2MA6 A;  4LJN A;  4YC9 A;  2KGI A;  5TAB A;  3N9Q A;  4CA1 A;  4LLB A;  2LAU A;  1MM2 A;  1XWH A;  1X4U A;  2XP0 A;  1WEU A;  3PLW A;  2C2L A;  3ZPV E;  2FSA A;  2MA5 A;  4XI1 A;  4AP4 A;  1WIM A;  2MNY A;  5SVX A;  3T7L A;  5H1V A;  3U5N A;  3HCT A;  4FIP A;  2CRW A;  2D8S A;  3I2D A;  2ECW A;  2Y1N A;  4GNE A;  5D1K B;  4WZ2 A;  3T9K A;  3FAN A;  3SUB A;  1ZBD B;  2H0D B;  1Z60 A;  3FEH A;  2BAY A;  2YHO A;  4IC2 A;  3O47 A;  2KR4 A;  2LQ6 A;  5KH7 A;  2JUN A;  2HYE D;  4I7B A;  1WGM A;  4IC3 A;  4YBT A;  4LK9 A;  2KKX A;  2KWN A;  3T6R A;  2G6Q A;  1WEP A;  2FUU A;  1HYJ A;  3MHS A;  2CSZ A;  3L11 A;  5FB1 A;  2C2V S;  3FM8 C;  3M99 A;  3EB6 A;  2KYU A;  5LCW B;  3PUR A;  2P57 A;  5AIT A;  4AYC A;  2KGG A;  4AYC B;  2NAA A;  3LRQ A;  1IYM A;  2YT5 A;  2M3H A;  2YVR A;  2YUC A;  1WEV A;  3O34 A;  2ECI A;  3RPG C;  2MD8 C;  2CKL A;  3O7A A;  2CKL B;  3O70 A;  3VK6 A;  2Y43 A;  1CHC A;  4LAD B;  2QJ0 A;  4YAD A;  2KE1 A;  4NN2 A;  2ZET C;  4N3W A;  4W4U A;  3FAO A;  5D1L B;  2K1J A;  3MHH A;  2EGP A;  2M6M A;  5G05 B;  3MDB C;  3HCS A;  2JMI A;  3ZTG A;  5B77 A;  2EOD A;  2MD7 B;  4C9Z A;  5LKZ A;  1WIL A;  2CSV A;  5B75 A;  3O33 A;  4F52 B;  2E61 A;  1RMD A;  3KV5 A;  5K3Q A;  4UP5 A;  2G45 A;  4QQ4 A;  2YRE A;  2FFW A;  2QIZ A;  4BBQ A;  4ZQL A;  4O64 A;  1Z6U A;  5B78 A;  5TDR A;  4O62 A;  3QZV A;  4S3O B; 
#chains in the Genus database with same CATH homology
 2VJE B;  2KFT A;  4B7Y C;  5FEY A;  3ASL A;  2FUI A;  2VPB A;  3U5O A;  1WEQ A;  1K2F A;  1WEW A;  4WA6 A;  2M85 A;  2JMJ A;  4L58 A;  3HCU A;  1JM7 B;  4A4C A;  3L1Z B;  4YAX A;  4TKP B;  2H0D A;  2RSD A;  3SOX A;  5B76 A;  5I3L A;  5B8D A;  2K16 A;  3ZYQ A;  2VNF A;  4LKA A;  2HDP A;  3PUQ A;  4ZUX U;  3O37 A;  1V87 A;  5H1T A;  4P5O B;  3PHD A;  2VPE A;  5D1M B;  4X3G A;  5G0F A;  4A49 A;  3N9M A;  4AUQ B;  3C6W A;  2PUY A;  5H1U A;  2AN6 A;  1LDK C;  1BOR A;  3M62 A;  2E6R A;  2EA6 A;  5TBN A;  2UZG A;  2JRJ A;  2L75 A;  3SOU A;  1E4U A;  4GNF A;  1Z2Q A;  4BHW A;  2VPG A;  2LXH C;  5FB0 A;  1WEE A;  3ZNI A;  1LDJ B;  4N4F A;  5LKX A;  1FP0 A;  5H9M A;  3ZVY A;  2YSM A;  4I7D A;  2XB1 A;  5TRB A;  4QF2 A;  2LGV A;  3ZVZ B;  2LGG A;  4CCG X;  4GNG A;  5G04 B;  1X4J A;  2YQM A;  2CT2 A;  1WEM A;  2JMD A;  1T1H A;  3EB5 A;  2VJF A;  2K4D A;  2VJF B;  4WZ0 A;  3FL2 A;  5EYA F;  4L7X A;  3U5P A;  3KNV A;  2LXP C;  4B86 C;  5B79 A;  4MVT A;  3GV4 A;  4V3L C;  3IHP A;  4UP0 A;  2MIQ A;  3V43 A;  1WES A;  4R2Y A;  3LQH A;  5J3X A;  2YQL A;  2IDA A;  2KWJ A;  2Y1M A;  1X4I A;  3DPL R;  4UI9 B;  2LN0 A;  4A4B A;  4GB0 A;  2L80 A;  2F42 A;  2KWK A;  2VJE A;  2KRE A;  2PNX A;  4R8P K;  3N9P A;  2L43 A;  3HTK C;  2YUR A;  4PPE A;  2LDR A;  3DQV R;  5FER A;  1JM7 A;  1JOC A;  3GL6 A;  2ECN A;  3KQI A;  2DX8 A;  2XEU A;  3NG2 A;  4Q6F A;  2YSJ A;  1WFK A;  3U5M A;  3L1X A;  2LGL A;  5TDW A;  4FJC A;  4S3O C;  2CSY A;  2MUM A;  3SHB A;  3LQJ A;  5DKA A;  1DVP A;  5JG6 A;  2F6N A;  3LQI A;  3N9N A;  1WE9 A;  4GND A;  4MSX A;  1U6G B;  5KH9 A;  1WEO A;  1F62 A;  2ECG A;  1G25 A;  2YU4 A;  3RPG B;  1VFY A;  4YAB A;  2M1R A;  4YAT A;  4A0C D;  2MT5 A;  2YW8 A;  2YYR A;  2L0B A;  4QF3 A;  4FO9 A;  2L5U A;  5LKT A;  2E6S A;  2VPD A;  2MNZ A;  4AVX A;  2QIC A;  2KIZ A;  4I7C A;  1VD4 A;  2RI7 A;  2OXQ C;  2KU3 A;  2K17 A;  4ZDT A;  2ECT A;  2F6J A;  1WEN A;  3C5K A;  2ECJ A;  3O36 A;  2ECV A;  3SOW A;  2I50 A;  2YHN A;  2G43 A;  3RTR B;  4FK5 A;  5KH3 A;  1FBV A;  5C11 A;  5AIU A;  4V3K C;  4PTB A;  2LRI C;  5DIN A;  2LV9 A;  4R7E A;  5LKU A;  3N9L A;  5C13 A;  1HYI A;  1N87 A;  3M63 A;  4YBS A;  1VYX A;  2KWO A;  2LGK A;  4WZ3 B;  3KV6 A;  2VP7 A;  3O35 A;  1MM3 A;  4YBM A;  3ZPV 1;  3N9O A;  2MA6 A;  4LJN A;  4YC9 A;  2KGI A;  5TAB A;  3N9Q A;  4CA1 A;  4LLB A;  1MM2 A;  1XWH A;  1X4U A;  1WEU A;  2C2L A;  3ZPV E;  2FSA A;  2MA5 A;  4XI1 A;  4AP4 A;  1WIM A;  2MNY A;  3T7L A;  5H1V A;  3U5N A;  3HCT A;  4FIP A;  2D8S A;  3I2D A;  2ECW A;  2Y1N A;  4GNE A;  5D1K B;  4WZ2 A;  1ZBD B;  2H0D B;  1Z60 A;  2BAY A;  2YHO A;  4IC2 A;  2KR4 A;  2LQ6 A;  5KH7 A;  2HYE D;  4I7B A;  1WGM A;  4IC3 A;  4YBT A;  4LK9 A;  3T6R A;  2KWN A;  2G6Q A;  1WEP A;  2FUU A;  1HYJ A;  3MHS A;  2CSZ A;  3L11 A;  5FB1 A;  2C2V S;  3M99 A;  3EB6 A;  2KYU A;  5LCW B;  3PUR A;  5AIT A;  4AYC A;  2KGG A;  4AYC B;  2NAA A;  3LRQ A;  1IYM A;  2YT5 A;  2M3H A;  2YUC A;  1WEV A;  3O34 A;  2ECI A;  3RPG C;  2MD8 C;  2CKL A;  3O7A A;  2CKL B;  3O70 A;  3VK6 A;  2Y43 A;  1CHC A;  4LAD B;  2QJ0 A;  4YAD A;  2KE1 A;  4NN2 A;  2ZET C;  4N3W A;  4W4U A;  5D1L B;  2K1J A;  3MHH A;  2EGP A;  2M6M A;  5G05 B;  3HCS A;  2JMI A;  3ZTG A;  5B77 A;  2EOD A;  2MD7 B;  4C9Z A;  5LKZ A;  1WIL A;  5B75 A;  3O33 A;  4F52 B;  1RMD A;  3KV5 A;  4UP5 A;  2G45 A;  2YRE A;  2QIZ A;  4BBQ A;  4ZQL A;  4O64 A;  1Z6U A;  5B78 A;  5TDR A;  3QZV A;  4S3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...