3DWDA

Crystal structure of the arfgap domain of human arfgap1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
116
Chain Sequence
SPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor GTPase-activating protein 1
publication title Crystal structure of the ArfGAP domain of human ARFGAP1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 34
structure length 116
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3dwdA00
4F1PA 3LVQE 2B0OE 2IQJA 1DCQA 2OWAA 3LVRE 2P57A 3SUBA 2CRRA 3MDBC 3FM8C 3T9KA 3LJUX 2CRWA 3FEHA 3O47A 3JUEA 3DWDA
chains in the Genus database with same CATH superfamily
2LGVA 2K1JA 2EGPA 1T1HA 1ZBDB 5D1LB 3PHDA 1JM7A 2KWOA 4LADB 2YW8A 2OXQC 4WA6A 5G04B 4B86C 2CT2A 2M3HA 1JM7B 4CA1A 3EB5A 2JMIA 1WEEA 2F6NA 2XEUA 1WEOA 1K2FA 4H9DA 2KU3A 4I7CA 1WEQA 2E6SA 2KKXA 1MBMA 4OGEA 3LQHA 1X4JA 3L1XA 1F62A 3MDBC 3T9KA 1Z6UA 4WZ2A 2KE1A 2Y1MA 2KWJA 2CSZA 3HTKC 2D8UA 2PUYA 4OGCA 2EXUA 1WEVA 2YURA 2VJEA 2IQJA 1DCQA 4LKAA 1LDKC 2VPEA 4QF3A 2LGGA 4UP5A 5LCWB 2VJEB 2K4DA 3U5MA 3RPGC 1WE9A 3LJUX 4AYCA 4YABA 3HCSA 1WENA 2KKYA 4UP0A 4AYCB 2Y43A 4R7EA 4MVTA 4Z0RA 3M62A 2P57A 2MNZA 1Z60A 4YATA 1WESA 3GL6A 4FIPA 2MIQA 2EODA 2KGGA 2VJFA 4GNFA 2CKLA 3FEHA 3NG2A 2L75A 2H0DA 2VJFB 3PUQA 3ZTGA 4N3WA 2M6MA 4YBMA 1WEPA 2H0DB 1FBVA 4S3OC 2E6RA 3U5OA 2YT5A 2VP7A 2LQ6A 1RMDA 3M99A 3Q1DA 5DINA 3KQIA 5LKXA 3I2DA 2G6QA 2VPBA 3GV4A 1V87A 2LAUA 3QZVA 4F52B 2DJAA 3L1ZB 4IC2A 2QJ0A 2KR4A 2CRRA 1MM2A 3HCTA 2MD7B 3O35A 4ZQLA 3LRQA 4BHWA 2JRJA 4A0CD 4YADA 1MM3A 2MUMA 5TDRA 4MSXA 2IDAA 2FFWA 2JUNA 3EB6A 4R2YA 3KDEC 5EYAF 3O36A 2L0BA 1WEMA 3LVQE 1WEUA 2XP0A 3DQVR 4GNEA 5J3XA 4A4CA 3U5NA 2DSMA 3M63A 5AITA 4AP4A 5SVYA 5D1KB 3SUBA 2LN0A 4XI1A 2JMJA 5TRBA 2MT5A 2RI7A 3ZPVE 4WZ0A 3MHSA 4P5OB 5B76A 2LXPC 2YQLA 4GNGA 4YC9A 2ECVA 2AN6A 2ECJA 4LJNA 4WZ3B 5LKTA 1X4UA 3T7LA 4B7YC 2HYED 2QICA 2YSMA 2MD8C 2M1RA 4TKPB 3N9NA 3N9QA 3H7HA 4V3KC 2XOZA 3PURA 1WEWA 2L7PA 4YBTA 1WILA 5AIUA 2CRWA 3DDTA 2KIZA 2RSDA 2YREA 5KH9A 5FERA 2K17A 2MA6A 3FANA 3IHPA 5C13A 3O70A 1Z2QA 3ZPV1 5B79A 1X4IA 3O37A 5LKZA 1LDJB 3VK6A 4CCGX 2ECIA 2VNFA 5B8DA 5DKAA 2LGKA 4FJCA 2EGMA 3N9MA 4BBQA 5TDWA 5D1MB 2ZETC 1VFYA 1FP0A 2M85A 2KWNA 4YAXA 2KREA 2C2VS 5JG6A 4W4UA 5KH3A 2KGIA 2CSYA 4QQ4A 1BORA 3ZVYA 5G05B 2RR4A 2XB1A 4Q6FA 2BAYA 2K16A 2MNYA 1WFKA 2F42A 5G0FA 5H1VA 2PNXA 5LKUA 4QF2A 1HYJA 2L43A 2JM3A 3ASLA 2CSVA 3FAOA 2NAAA 2LGLA 2E61A 3SOWA 4PTBA 2YSJA 3SOUA 5B78A 2FUUA 2YU4A 2YUCA 3E2DA 4LK9A 3FM8C 4L7XA 5H9MA 2YVRA 3O7AA 3O47A 2F6JA 2YYRA 2FD4A 2MA5A 2XOYA 3SOXA 4F1PA 3KV5A 3T6RA 2UZGA 4N4FA 2LV9A 3N9OA 4O64A 1E4UA 2EA6A 2YHOA 2ECWA 1VD4A 3L11A 4Z0OA 5FB0A 4I7DA 4A49A 1U6GB 3O34A 3PLWA 2KWKA 5FEYA 2G45A 2XOCA 4GNDA 2JMDA 4V3LC 5SVIA 3ZNIA 3C6WA 4FO9A 1N87A 3ZVZB 2YHNA 5SVIB 2I50A 4X3GA 4NN2A 1WIMA 3N9PA 4UI9B 2VPDA 5K3QA 2Y1NA 2LDRA 3V43A 2OWAA 3LVRE 3KNVA 2QIZA 2G43A 4L58A 2DX8A 2KFTA 4LLBA 5SVXA 2ECTA 1G25A 2C2LA 1XWHA 4I7BA 4PPEA 2HDPA 3RPGB 2D8SA 1CHCA 5C11A 3LQJA 5FB1A 5KH7A 2CONA 2L80A 5B77A 3MHHA 4ZDTA 2L5UA 4C9ZA 2FUIA 2KYUA 4ZUXU 5TBNA 2ECNA 3LQIA 3N9LA 1WGMA 3FL2A 2YQMA 5TABA 4AVXA 4R8PK 1VYXA 2MKEA 3FJUB 2LXHC 4O62A 3ZYQA 2VPGA 4FK5A 3O33A 3DPLR 2M13A 3KV6A 4GB0A 2CKLB 4AUQB 4A4BA 2B0OE 2ECGA 3SHBA 1JOCA 5B75A 3C5KA 4IC3A 5H1TA 2FSAA 3U5PA 2LRIC 1IYMA 4S3OB 3LDYA 5H1UA 5I3LA 1DVPA 3M7KA 3JUEA 1HYIA 3DWDA 4YBSA 3HCUA 3RTRB
chains in the Genus database with same CATH topology
2CSVA 2XOYA 3PLWA 2D8UA 4F1PA 3LVQE 2CONA 2XP0A 2YREA 2XOCA 2KKYA 2E61A 4OGCA 2B0OE 2EXUA 4Z0RA 2LAUA 5SVIA 4H9DA 2DJAA 2IQJA 1DCQA 2OWAA 3LVRE 4QQ4A 2P57A 5SVYA 3SUBA 2CRRA 2RR4A 2KKXA 3H7HA 4OGEA 2MKEA 2XOZA 5SVIB 5SVXA 3FJUB 2L7PA 3MDBC 3LDYA 3E2DA 4O62A 3FM8C 3Q1DA 3T9KA 2YVRA 3LJUX 2CRWA 3FEHA 4Z0OA 3M7KA 2EGMA 3O47A 3JUEA 3DDTA 2FFWA 2JUNA 3DWDA 3KDEC 2M13A 2JM3A 2FD4A 5K3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1P A;  3LVQ E;  2B0O E;  2IQJ A;  1DCQ A;  2OWA A;  3LVR E;  2P57 A;  3SUB A;  2CRR A;  3MDB C;  3FM8 C;  3T9K A;  3LJU X;  2CRW A;  3FEH A;  3O47 A;  3JUE A;  3DWD A; 
#chains in the Genus database with same CATH topology
 2LGV A;  2K1J A;  2EGP A;  1T1H A;  1ZBD B;  5D1L B;  3PHD A;  1JM7 A;  2KWO A;  4LAD B;  2YW8 A;  2OXQ C;  4WA6 A;  5G04 B;  4B86 C;  2CT2 A;  2M3H A;  1JM7 B;  4CA1 A;  3EB5 A;  2JMI A;  1WEE A;  2F6N A;  2XEU A;  1WEO A;  1K2F A;  4H9D A;  2KU3 A;  4I7C A;  1WEQ A;  2E6S A;  2KKX A;  1MBM A;  4OGE A;  3LQH A;  1X4J A;  3L1X A;  1F62 A;  3MDB C;  3T9K A;  1Z6U A;  4WZ2 A;  2KE1 A;  2Y1M A;  2KWJ A;  2CSZ A;  3HTK C;  2D8U A;  2PUY A;  4OGC A;  2EXU A;  1WEV A;  2YUR A;  2VJE A;  2IQJ A;  1DCQ A;  4LKA A;  1LDK C;  2VPE A;  4QF3 A;  2LGG A;  4UP5 A;  5LCW B;  2VJE B;  2K4D A;  3U5M A;  3RPG C;  1WE9 A;  3LJU X;  4AYC A;  4YAB A;  3HCS A;  1WEN A;  2KKY A;  4UP0 A;  4AYC B;  2Y43 A;  4R7E A;  4MVT A;  4Z0R A;  3M62 A;  2P57 A;  2MNZ A;  1Z60 A;  4YAT A;  1WES A;  3GL6 A;  4FIP A;  2MIQ A;  2EOD A;  2KGG A;  2VJF A;  4GNF A;  2CKL A;  3FEH A;  3NG2 A;  2L75 A;  2H0D A;  2VJF B;  3PUQ A;  3ZTG A;  4N3W A;  2M6M A;  4YBM A;  1WEP A;  2H0D B;  1FBV A;  4S3O C;  2E6R A;  3U5O A;  2YT5 A;  2VP7 A;  2LQ6 A;  1RMD A;  3M99 A;  3Q1D A;  5DIN A;  3KQI A;  5LKX A;  3I2D A;  2G6Q A;  2VPB A;  3GV4 A;  1V87 A;  2LAU A;  3QZV A;  4F52 B;  2DJA A;  3L1Z B;  4IC2 A;  2QJ0 A;  2KR4 A;  2CRR A;  1MM2 A;  3HCT A;  2MD7 B;  3O35 A;  4ZQL A;  3LRQ A;  4BHW A;  2JRJ A;  4A0C D;  4YAD A;  1MM3 A;  2MUM A;  5TDR A;  4MSX A;  2IDA A;  2FFW A;  2JUN A;  3EB6 A;  4R2Y A;  3KDE C;  5EYA F;  3O36 A;  2L0B A;  1WEM A;  3LVQ E;  1WEU A;  2XP0 A;  3DQV R;  4GNE A;  5J3X A;  4A4C A;  3U5N A;  2DSM A;  3M63 A;  5AIT A;  4AP4 A;  5SVY A;  5D1K B;  3SUB A;  2LN0 A;  4XI1 A;  2JMJ A;  5TRB A;  2MT5 A;  2RI7 A;  3ZPV E;  4WZ0 A;  3MHS A;  4P5O B;  5B76 A;  2LXP C;  2YQL A;  4GNG A;  4YC9 A;  2ECV A;  2AN6 A;  2ECJ A;  4LJN A;  4WZ3 B;  5LKT A;  1X4U A;  3T7L A;  4B7Y C;  2HYE D;  2QIC A;  2YSM A;  2MD8 C;  2M1R A;  4TKP B;  3N9N A;  3N9Q A;  3H7H A;  4V3K C;  2XOZ A;  3PUR A;  1WEW A;  2L7P A;  4YBT A;  1WIL A;  5AIU A;  2CRW A;  3DDT A;  2KIZ A;  2RSD A;  2YRE A;  5KH9 A;  5FER A;  2K17 A;  2MA6 A;  3FAN A;  3IHP A;  5C13 A;  3O70 A;  1Z2Q A;  3ZPV 1;  5B79 A;  1X4I A;  3O37 A;  5LKZ A;  1LDJ B;  3VK6 A;  4CCG X;  2ECI A;  2VNF A;  5B8D A;  5DKA A;  2LGK A;  4FJC A;  2EGM A;  3N9M A;  4BBQ A;  5TDW A;  5D1M B;  2ZET C;  1VFY A;  1FP0 A;  2M85 A;  2KWN A;  4YAX A;  2KRE A;  2C2V S;  5JG6 A;  4W4U A;  5KH3 A;  2KGI A;  2CSY A;  4QQ4 A;  1BOR A;  3ZVY A;  5G05 B;  2RR4 A;  2XB1 A;  4Q6F A;  2BAY A;  2K16 A;  2MNY A;  1WFK A;  2F42 A;  5G0F A;  5H1V A;  2PNX A;  5LKU A;  4QF2 A;  1HYJ A;  2L43 A;  2JM3 A;  3ASL A;  2CSV A;  3FAO A;  2NAA A;  2LGL A;  2E61 A;  3SOW A;  4PTB A;  2YSJ A;  3SOU A;  5B78 A;  2FUU A;  2YU4 A;  2YUC A;  3E2D A;  4LK9 A;  3FM8 C;  4L7X A;  5H9M A;  2YVR A;  3O7A A;  3O47 A;  2F6J A;  2YYR A;  2FD4 A;  2MA5 A;  2XOY A;  3SOX A;  4F1P A;  3KV5 A;  3T6R A;  2UZG A;  4N4F A;  2LV9 A;  3N9O A;  4O64 A;  1E4U A;  2EA6 A;  2YHO A;  2ECW A;  1VD4 A;  3L11 A;  4Z0O A;  5FB0 A;  4I7D A;  4A49 A;  1U6G B;  3O34 A;  3PLW A;  2KWK A;  5FEY A;  2G45 A;  2XOC A;  4GND A;  2JMD A;  4V3L C;  5SVI A;  3ZNI A;  3C6W A;  4FO9 A;  1N87 A;  3ZVZ B;  2YHN A;  5SVI B;  2I50 A;  4X3G A;  4NN2 A;  1WIM A;  3N9P A;  4UI9 B;  2VPD A;  5K3Q A;  2Y1N A;  2LDR A;  3V43 A;  2OWA A;  3LVR E;  3KNV A;  2QIZ A;  2G43 A;  4L58 A;  2DX8 A;  2KFT A;  4LLB A;  5SVX A;  2ECT A;  1G25 A;  2C2L A;  1XWH A;  4I7B A;  4PPE A;  2HDP A;  3RPG B;  2D8S A;  1CHC A;  5C11 A;  3LQJ A;  5FB1 A;  5KH7 A;  2CON A;  2L80 A;  5B77 A;  3MHH A;  4ZDT A;  2L5U A;  4C9Z A;  2FUI A;  2KYU A;  4ZUX U;  5TBN A;  2ECN A;  3LQI A;  3N9L A;  1WGM A;  3FL2 A;  2YQM A;  5TAB A;  4AVX A;  4R8P K;  1VYX A;  2MKE A;  3FJU B;  2LXH C;  4O62 A;  3ZYQ A;  2VPG A;  4FK5 A;  3O33 A;  3DPL R;  2M13 A;  3KV6 A;  4GB0 A;  2CKL B;  4AUQ B;  4A4B A;  2B0O E;  2ECG A;  3SHB A;  1JOC A;  5B75 A;  3C5K A;  4IC3 A;  5H1T A;  2FSA A;  3U5P A;  2LRI C;  1IYM A;  4S3O B;  3LDY A;  5H1U A;  5I3L A;  1DVP A;  3M7K A;  3JUE A;  1HYI A;  3DWD A;  4YBS A;  3HCU A;  3RTR B; 
#chains in the Genus database with same CATH homology
 2CSV A;  2XOY A;  3PLW A;  2D8U A;  4F1P A;  3LVQ E;  2CON A;  2XP0 A;  2YRE A;  2XOC A;  2KKY A;  2E61 A;  4OGC A;  2B0O E;  2EXU A;  4Z0R A;  2LAU A;  5SVI A;  4H9D A;  2DJA A;  2IQJ A;  1DCQ A;  2OWA A;  3LVR E;  4QQ4 A;  2P57 A;  5SVY A;  3SUB A;  2CRR A;  2RR4 A;  2KKX A;  3H7H A;  4OGE A;  2MKE A;  2XOZ A;  5SVI B;  5SVX A;  3FJU B;  2L7P A;  3MDB C;  3LDY A;  3E2D A;  4O62 A;  3FM8 C;  3Q1D A;  3T9K A;  2YVR A;  3LJU X;  2CRW A;  3FEH A;  4Z0O A;  3M7K A;  2EGM A;  3O47 A;  3JUE A;  3DDT A;  2FFW A;  2JUN A;  3DWD A;  3KDE C;  2M13 A;  2JM3 A;  2FD4 A;  5K3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...