3DWDA

Crystal structure of the arfgap domain of human arfgap1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
118
structure length
116
Chain Sequence
SPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor GTPase-activating protein 1
publication title Crystal structure of the ArfGAP domain of human ARFGAP1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 34
structure length 116
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3dwdA00
3T9KA 2P57A 2IQJA 3MDBC 2B0OE 2CRWA 1DCQA 3LVRE 3DWDA 4F1PA 3SUBA 3LJUX 3O47A 3JUEA 3FM8C 2OWAA 3LVQE 2CRRA 3FEHA
chains in the Genus database with same CATH superfamily
2YREA 3SOXA 3EB5A 4WZ0A 2RR4A 2MIQA 4V3LC 3L1XA 1G25A 2F6NA 4PPEA 2FSAA 2LXPC 4S3OC 3O33A 4FIPA 2FFWA 5TBNA 2QIZA 4QF2A 1N87A 2YURA 4A4BA 4ZQLA 3C6WA 2MNYA 2M3HA 2QICA 3FEHA 1MM3A 2MA6A 4BHWA 4AYCA 4TKPB 2XEUA 5FB0A 2E6RA 4LLBA 2G6QA 2KYUA 2DSMA 2YQMA 2KWJA 2XB1A 4QQ4A 3T7LA 2KGGA 1WFKA 2CKLB 2MNZA 2MD7B 2YYRA 5B8DA 5LCWB 5LKUA 1MM2A 4R7EA 4FK5A 4FO9A 2XOCA 2L75A 4WZ2A 3MDBC 1VFYA 1BORA 2EXUA 2F42A 2KKXA 1JOCA 3LDYA 2K17A 2Y1NA 3L11A 4MSXA 4O62A 3O35A 5B78A 1JM7A 4MVTA 5D1LB 3JUEA 2JRJA 1WEPA 5LKZA 2KIZA 3V43A 2K4DA 2OWAA 2E61A 2LV9A 1FBVA 4AYCB 2YUCA 2CSYA 1WILA 2G43A 3E2DA 2H0DA 2MKEA 4OGCA 5H9MA 2KE1A 3M63A 3DWDA 1MBMA 5TDWA 1T1HA 1Z6UA 2I50A 3N9OA 3N9LA 3ZYQA 4YBTA 5FEYA 2HDPA 4GNDA 3ZPV1 3LVQE 2ECTA 5D1KB 4R2YA 2RSDA 5AIUA 3PHDA 1X4IA 2EODA 1VYXA 4F52B 1IYMA 4LKAA 3T6RA 2PNXA 3SOWA 5H1VA 2MT5A 1V87A 5I3LA 4A4CA 1F62A 1XWHA 2KGIA 3LQJA 4ZUXU 3Q1DA 2MA5A 2YHOA 3HCSA 3C5KA 2Y43A 2B0OE 3GL6A 3GV4A 4UP5A 2C2VS 2QJ0A 1U6GB 1WEQA 4WZ3B 2XOZA 4X3GA 2C2LA 3FANA 4QF3A 3ZNIA 5H1TA 3IHPA 2LGGA 1FP0A 3RTRB 1X4UA 3PURA 2KWKA 3FJUB 4CA1A 2VNFA 2KREA 5B75A 4LK9A 4L58A 5H1UA 2CRWA 2L80A 2ECIA 3SOUA 3O34A 5LKTA 4I7CA 2XP0A 1WEOA 1LDKC 4UP0A 2LGKA 2PUYA 4A49A 3ZTGA 4YC9A 3ZPVE 3ZVZB 1WIMA 3LQHA 4A0CD 3PUQA 4AUQB 2EGMA 5FERA 4Z0OA 3U5PA 2G45A 3RPGB 4I7DA 1ZBDB 4F1PA 1WE9A 2Y1MA 2FUUA 3O37A 1Z60A 2KKYA 3N9PA 1WEWA 4I7BA 2L43A 3H7HA 4B86C 2KWOA 5TRBA 4YBSA 5AITA 2K1JA 2JMDA 2M85A 3ZVYA 4LJNA 2VJEA 5G05B 2JMJA 3N9MA 4B7YC 4C9ZA 3DDTA 3O36A 2KU3A 3LJUX 4N4FA 2VJFA 2ECGA 2L0BA 3O7AA 2LXHC 4UI9B 2VPBA 2CRRA 3KNVA 2M6MA 2ZETC 2EA6A 4O64A 2NAAA 1CHCA 3ASLA 2D8UA 2IQJA 5SVYA 5B77A 4V3KC 1WENA 2DX8A 1JM7B 3O47A 2ECVA 2KFTA 1K2FA 2VP7A 1WEUA 4AP4A 2YU4A 3FM8C 4YBMA 4LADB 4P5OB 4ZDTA 2KR4A 5D1MB 3RPGC 3KV6A 2LGVA 2VJEB 4BBQA 3L1ZB 4OGEA 2H0DB 1HYIA 2VJFB 2EGPA 4W4UA 5LKXA 5B76A 5JG6A 2LN0A 2IDAA 5DINA 2YVRA 2LDRA 1VD4A 3M99A 4Z0RA 2CONA 5TABA 2CSVA 3M62A 2UZGA 5B79A 3KQIA 2P57A 5DKAA 4YABA 5KH7A 2HYED 4R8PK 1WEVA 2ECWA 4PTBA 2LGLA 4IC3A 5K3QA 3I2DA 3U5MA 4CCGX 2AN6A 1LDJB 3N9QA 3LQIA 3HCUA 5SVIA 2ECNA 3MHHA 3NG2A 3VK6A 1X4JA 3SUBA 5FB1A 4YADA 4YAXA 4GNGA 4NN2A 2YHNA 2OXQC 2VPDA 2VPEA 3PLWA 1HYJA 2MD8C 5G0FA 1WGMA 3T9KA 3FAOA 5KH3A 4AVXA 3HTKC 1WEMA 3O70A 2FD4A 3QZVA 4GNFA 3MHSA 2M1RA 2CT2A 3SHBA 3LVRE 3N9NA 4S3OB 2F6JA 3U5OA 4FJCA 1RMDA 2YSMA 2LQ6A 4IC2A 2K16A 2KWNA 5G04B 2M13A 5KH9A 5SVIB 2JUNA 3DQVR 1WESA 4H9DA 2LAUA 4WA6A 4L7XA 2YQLA 2LRIC 3DPLR 2JM3A 2YW8A 1DVPA 4GB0A 2D8SA 2BAYA 2ECJA 2YSJA 3KV5A 2VPGA 4YATA 2JMIA 3KDEC 3HCTA 3LRQA 3M7KA 5TDRA 5C13A 4Q6FA 2L7PA 2DJAA 4GNEA 2CSZA 5EYAF 4XI1A 1E4UA 1DCQA 2RI7A 2FUIA 4N3WA 1Z2QA 2L5UA 5SVXA 1WEEA 2XOYA 3FL2A 2YT5A 3U5NA 5C11A 2MUMA 2CKLA 5J3XA 3EB6A 2E6SA
chains in the Genus database with same CATH topology
4Z0RA 2YREA 2E61A 2CONA 2RR4A 2CSVA 3H7HA 5SVIB 3T9KA 3M7KA 3FJUB 3Q1DA 2M13A 2P57A 2EGMA 2FD4A 4Z0OA 2D8UA 2IQJA 2L7PA 2XOCA 5SVIA 2DJAA 5SVYA 3MDBC 2B0OE 2CRWA 2EXUA 2JUNA 2MKEA 3E2DA 4OGCA 4OGEA 2KKXA 3LDYA 1DCQA 3LVRE 4H9DA 2LAUA 3DWDA 4F1PA 3DDTA 3SUBA 2FFWA 3LJUX 4O62A 2XP0A 3O47A 2XOZA 5SVXA 2XOYA 2JM3A 2KKYA 4QQ4A 3JUEA 3FM8C 3KDEC 2YVRA 3PLWA 2OWAA 3LVQE 2CRRA 5K3QA 3FEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9K A;  2P57 A;  2IQJ A;  3MDB C;  2B0O E;  2CRW A;  1DCQ A;  3LVR E;  3DWD A;  4F1P A;  3SUB A;  3LJU X;  3O47 A;  3JUE A;  3FM8 C;  2OWA A;  3LVQ E;  2CRR A;  3FEH A; 
#chains in the Genus database with same CATH topology
 2YRE A;  3SOX A;  3EB5 A;  4WZ0 A;  2RR4 A;  2MIQ A;  4V3L C;  3L1X A;  1G25 A;  2F6N A;  4PPE A;  2FSA A;  2LXP C;  4S3O C;  3O33 A;  4FIP A;  2FFW A;  5TBN A;  2QIZ A;  4QF2 A;  1N87 A;  2YUR A;  4A4B A;  4ZQL A;  3C6W A;  2MNY A;  2M3H A;  2QIC A;  3FEH A;  1MM3 A;  2MA6 A;  4BHW A;  4AYC A;  4TKP B;  2XEU A;  5FB0 A;  2E6R A;  4LLB A;  2G6Q A;  2KYU A;  2DSM A;  2YQM A;  2KWJ A;  2XB1 A;  4QQ4 A;  3T7L A;  2KGG A;  1WFK A;  2CKL B;  2MNZ A;  2MD7 B;  2YYR A;  5B8D A;  5LCW B;  5LKU A;  1MM2 A;  4R7E A;  4FK5 A;  4FO9 A;  2XOC A;  2L75 A;  4WZ2 A;  3MDB C;  1VFY A;  1BOR A;  2EXU A;  2F42 A;  2KKX A;  1JOC A;  3LDY A;  2K17 A;  2Y1N A;  3L11 A;  4MSX A;  4O62 A;  3O35 A;  5B78 A;  1JM7 A;  4MVT A;  5D1L B;  3JUE A;  2JRJ A;  1WEP A;  5LKZ A;  2KIZ A;  3V43 A;  2K4D A;  2OWA A;  2E61 A;  2LV9 A;  1FBV A;  4AYC B;  2YUC A;  2CSY A;  1WIL A;  2G43 A;  3E2D A;  2H0D A;  2MKE A;  4OGC A;  5H9M A;  2KE1 A;  3M63 A;  3DWD A;  1MBM A;  5TDW A;  1T1H A;  1Z6U A;  2I50 A;  3N9O A;  3N9L A;  3ZYQ A;  4YBT A;  5FEY A;  2HDP A;  4GND A;  3ZPV 1;  3LVQ E;  2ECT A;  5D1K B;  4R2Y A;  2RSD A;  5AIU A;  3PHD A;  1X4I A;  2EOD A;  1VYX A;  4F52 B;  1IYM A;  4LKA A;  3T6R A;  2PNX A;  3SOW A;  5H1V A;  2MT5 A;  1V87 A;  5I3L A;  4A4C A;  1F62 A;  1XWH A;  2KGI A;  3LQJ A;  4ZUX U;  3Q1D A;  2MA5 A;  2YHO A;  3HCS A;  3C5K A;  2Y43 A;  2B0O E;  3GL6 A;  3GV4 A;  4UP5 A;  2C2V S;  2QJ0 A;  1U6G B;  1WEQ A;  4WZ3 B;  2XOZ A;  4X3G A;  2C2L A;  3FAN A;  4QF3 A;  3ZNI A;  5H1T A;  3IHP A;  2LGG A;  1FP0 A;  3RTR B;  1X4U A;  3PUR A;  2KWK A;  3FJU B;  4CA1 A;  2VNF A;  2KRE A;  5B75 A;  4LK9 A;  4L58 A;  5H1U A;  2CRW A;  2L80 A;  2ECI A;  3SOU A;  3O34 A;  5LKT A;  4I7C A;  2XP0 A;  1WEO A;  1LDK C;  4UP0 A;  2LGK A;  2PUY A;  4A49 A;  3ZTG A;  4YC9 A;  3ZPV E;  3ZVZ B;  1WIM A;  3LQH A;  4A0C D;  3PUQ A;  4AUQ B;  2EGM A;  5FER A;  4Z0O A;  3U5P A;  2G45 A;  3RPG B;  4I7D A;  1ZBD B;  4F1P A;  1WE9 A;  2Y1M A;  2FUU A;  3O37 A;  1Z60 A;  2KKY A;  3N9P A;  1WEW A;  4I7B A;  2L43 A;  3H7H A;  4B86 C;  2KWO A;  5TRB A;  4YBS A;  5AIT A;  2K1J A;  2JMD A;  2M85 A;  3ZVY A;  4LJN A;  2VJE A;  5G05 B;  2JMJ A;  3N9M A;  4B7Y C;  4C9Z A;  3DDT A;  3O36 A;  2KU3 A;  3LJU X;  4N4F A;  2VJF A;  2ECG A;  2L0B A;  3O7A A;  2LXH C;  4UI9 B;  2VPB A;  2CRR A;  3KNV A;  2M6M A;  2ZET C;  2EA6 A;  4O64 A;  2NAA A;  1CHC A;  3ASL A;  2D8U A;  2IQJ A;  5SVY A;  5B77 A;  4V3K C;  1WEN A;  2DX8 A;  1JM7 B;  3O47 A;  2ECV A;  2KFT A;  1K2F A;  2VP7 A;  1WEU A;  4AP4 A;  2YU4 A;  3FM8 C;  4YBM A;  4LAD B;  4P5O B;  4ZDT A;  2KR4 A;  5D1M B;  3RPG C;  3KV6 A;  2LGV A;  2VJE B;  4BBQ A;  3L1Z B;  4OGE A;  2H0D B;  1HYI A;  2VJF B;  2EGP A;  4W4U A;  5LKX A;  5B76 A;  5JG6 A;  2LN0 A;  2IDA A;  5DIN A;  2YVR A;  2LDR A;  1VD4 A;  3M99 A;  4Z0R A;  2CON A;  5TAB A;  2CSV A;  3M62 A;  2UZG A;  5B79 A;  3KQI A;  2P57 A;  5DKA A;  4YAB A;  5KH7 A;  2HYE D;  4R8P K;  1WEV A;  2ECW A;  4PTB A;  2LGL A;  4IC3 A;  5K3Q A;  3I2D A;  3U5M A;  4CCG X;  2AN6 A;  1LDJ B;  3N9Q A;  3LQI A;  3HCU A;  5SVI A;  2ECN A;  3MHH A;  3NG2 A;  3VK6 A;  1X4J A;  3SUB A;  5FB1 A;  4YAD A;  4YAX A;  4GNG A;  4NN2 A;  2YHN A;  2OXQ C;  2VPD A;  2VPE A;  3PLW A;  1HYJ A;  2MD8 C;  5G0F A;  1WGM A;  3T9K A;  3FAO A;  5KH3 A;  4AVX A;  3HTK C;  1WEM A;  3O70 A;  2FD4 A;  3QZV A;  4GNF A;  3MHS A;  2M1R A;  2CT2 A;  3SHB A;  3LVR E;  3N9N A;  4S3O B;  2F6J A;  3U5O A;  4FJC A;  1RMD A;  2YSM A;  2LQ6 A;  4IC2 A;  2K16 A;  2KWN A;  5G04 B;  2M13 A;  5KH9 A;  5SVI B;  2JUN A;  3DQV R;  1WES A;  4H9D A;  2LAU A;  4WA6 A;  4L7X A;  2YQL A;  2LRI C;  3DPL R;  2JM3 A;  2YW8 A;  1DVP A;  4GB0 A;  2D8S A;  2BAY A;  2ECJ A;  2YSJ A;  3KV5 A;  2VPG A;  4YAT A;  2JMI A;  3KDE C;  3HCT A;  3LRQ A;  3M7K A;  5TDR A;  5C13 A;  4Q6F A;  2L7P A;  2DJA A;  4GNE A;  2CSZ A;  5EYA F;  4XI1 A;  1E4U A;  1DCQ A;  2RI7 A;  2FUI A;  4N3W A;  1Z2Q A;  2L5U A;  5SVX A;  1WEE A;  2XOY A;  3FL2 A;  2YT5 A;  3U5N A;  5C11 A;  2MUM A;  2CKL A;  5J3X A;  3EB6 A;  2E6S A; 
#chains in the Genus database with same CATH homology
 4Z0R A;  2YRE A;  2E61 A;  2CON A;  2RR4 A;  2CSV A;  3H7H A;  5SVI B;  3T9K A;  3M7K A;  3FJU B;  3Q1D A;  2M13 A;  2P57 A;  2EGM A;  2FD4 A;  4Z0O A;  2D8U A;  2IQJ A;  2L7P A;  2XOC A;  5SVI A;  2DJA A;  5SVY A;  3MDB C;  2B0O E;  2CRW A;  2EXU A;  2JUN A;  2MKE A;  3E2D A;  4OGC A;  4OGE A;  2KKX A;  3LDY A;  1DCQ A;  3LVR E;  4H9D A;  2LAU A;  3DWD A;  4F1P A;  3DDT A;  3SUB A;  2FFW A;  3LJU X;  4O62 A;  2XP0 A;  3O47 A;  2XOZ A;  5SVX A;  2XOY A;  2JM3 A;  2KKY A;  4QQ4 A;  3JUE A;  3FM8 C;  3KDE C;  2YVR A;  3PLW A;  2OWA A;  3LVQ E;  2CRR A;  5K3Q A;  3FEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...