3SUBA

Crystal structure of the catalytic domain of plasmodium falciparum arf gtpase activating protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
GSHMNAAAVEFINRLKKEDESNNKCFDCGISNPDWVSVNHGIFLCINCSGVHRSLGVHISIVRSIKMDIFTDEQLKYIDKGGNKKCQTYLENYGISDFIPERKYRTKAADHYRKILRSIVHNVDPPAPLPLDEGKSLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic domain of Plasmodium falciparum ARF GTPase-activating protein (ARFGAP).
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase activator
molecule keywords ADP-ribosylation factor GTPase-activating protein
total genus 50
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3subA00
3T9KA 3FEHA 2IQJA 2CRRA 1DCQA 2B0OE 3DWDA 3LVQE 3O47A 3MDBC 3SUBA 2P57A 3LVRE 2CRWA 2OWAA 4F1PA 3FM8C 3JUEA 3LJUX
chains in the Genus database with same CATH superfamily
2FD4A 4UP5A 2KWOA 3C5KA 4FJCA 3U5PA 1WE9A 3KQIA 2VJEB 2JMDA 4N4FA 2XOCA 3ZYQA 4UI9B 2K17A 3SOXA 3O7AA 2MNYA 2JUNA 4ZUXU 2LGVA 4V3KC 2H0DB 4MVTA 4QQ4A 5FEYA 4OGCA 3LQIA 3SHBA 2CKLA 2DSMA 2YQMA 2PNXA 3N9QA 1WEMA 5FB1A 3KV6A 3U5NA 3V43A 4AP4A 3O47A 3DPLR 2D8UA 5DKAA 4L7XA 3O36A 3C6WA 2Y43A 5AITA 4BHWA 1MM2A 5H9MA 4UP0A 5D1KB 2JMIA 3N9MA 2YU4A 4IC2A 4YABA 5B79A 2KR4A 5JG6A 4WA6A 1FBVA 5LKZA 2YUCA 4A4BA 4WZ0A 2RI7A 2IQJA 1WIMA 5LCWB 2ZETC 3PHDA 2LRIC 5TDRA 1HYJA 1VYXA 4O64A 1RMDA 1X4IA 1WEWA 4CCGX 4I7CA 2VJFA 5SVIB 3I2DA 3L1XA 1HYIA 4AVXA 2XEUA 2CRRA 4S3OB 1WESA 2KE1A 3NG2A 4YATA 3ZVZB 3SOUA 2NAAA 2M1RA 2IDAA 3H7HA 2YSMA 2E6SA 3FEHA 5FB0A 3ASLA 5H1UA 5SVYA 2RSDA 2LV9A 1X4UA 2AN6A 2MD8C 2I50A 2G43A 1WEQA 2KFTA 3ZTGA 1G25A 3E2DA 5I3LA 2XOZA 5DINA 1JM7A 4A0CD 3LRQA 2JMJA 2MIQA 2ECTA 3T6RA 4CA1A 3HCUA 3EB6A 3ZPVE 2FFWA 4LADB 4A4CA 1WEVA 2KGIA 1V87A 2QIZA 3LDYA 5TDWA 2M13A 2KWJA 2VPBA 5LKUA 2F42A 3LQJA 4YBMA 2YW8A 2CONA 3O70A 1JM7B 4YAXA 2G45A 4B7YC 2LAUA 5C13A 2Y1NA 2FSAA 4GNDA 2K1JA 2QICA 3ZPV1 3U5MA 2B0OE 2EA6A 1WEEA 2LXPC 3RPGC 3N9PA 5C11A 4AYCA 5TABA 5B75A 1N87A 2ECWA 4ZQLA 5B77A 2CSVA 3LQHA 4Z0OA 4TKPB 3IHPA 4A49A 2CSZA 1Z60A 4O62A 2VPEA 2YHNA 4H9DA 2K4DA 3SOWA 2KKXA 4R7EA 2ECJA 3FL2A 4NN2A 2FUUA 2LXHC 2JRJA 2YURA 2YYRA 2M3HA 2RR4A 3RTRB 1F62A 2L75A 3LVRE 4GB0A 2L5UA 2K16A 2E6RA 5KH3A 2CKLB 2KWKA 2XB1A 4WZ3B 5B78A 4YBSA 4F52B 1WENA 2VJEA 1MBMA 5K3QA 5D1MB 2ECGA 4PTBA 5LKTA 4S3OC 4F1PA 3LJUX 1LDJB 1Z2QA 4OGEA 4ZDTA 3PLWA 4FK5A 4Z0RA 2ECNA 2DX8A 2LGKA 2F6JA 3FAOA 4GNGA 2MA5A 3O35A 4B86C 1VD4A 1FP0A 5G04B 4V3LC 2KREA 4N3WA 2CRWA 2KIZA 2OWAA 5EYAF 1ZBDB 3N9LA 3PURA 3O37A 2M6MA 3SUBA 2MNZA 3KV5A 4YC9A 2XOYA 3JUEA 4I7DA 4P5OB 1DCQA 2EODA 3N9OA 2LQ6A 1BORA 3HCTA 4AUQB 1JOCA 2E61A 5SVIA 2VPDA 4R2YA 3EB5A 2QJ0A 2YSJA 2P57A 3QZVA 1Z6UA 2PUYA 5SVXA 2DJAA 4FIPA 2YREA 5KH9A 3RPGB 2G6QA 4WZ2A 3ZNIA 5LKXA 1LDKC 2C2VS 2D8SA 3U5OA 2VNFA 2KU3A 1DVPA 3Q1DA 5G05B 3DWDA 2BAYA 3T7LA 2MA6A 3MHHA 2ECVA 3PUQA 2KGGA 4BBQA 3LVQE 5J3XA 3MDBC 1XWHA 3L1ZB 4LLBA 5TRBA 4MSXA 2FUIA 5FERA 5TBNA 2KKYA 4YADA 3M7KA 5B8DA 2CSYA 1E4UA 3FM8C 2VPGA 3T9KA 2YQLA 3M62A 5H1TA 2F6NA 1IYMA 1WILA 2KYUA 3HCSA 3M99A 4I7BA 2KWNA 2VJFB 4L58A 5D1LB 1U6GB 3MHSA 2C2LA 3KDEC 2ECIA 3DDTA 4GNFA 3HTKC 5B76A 3VK6A 3KNVA 2YHOA 2LGLA 3GV4A 1WEOA 2MUMA 4W4UA 3ZVYA 2L80A 2HYED 4QF2A 2VP7A 2CT2A 2HDPA 2EXUA 4YBTA 1K2FA 1T1HA 1CHCA 2M85A 2EGPA 4FO9A 4PPEA 2MD7B 4QF3A 2LGGA 3GL6A 4AYCB 4C9ZA 2XP0A 1WFKA 4Q6FA 2LDRA 3FANA 3L11A 1WGMA 4R8PK 5H1VA 3N9NA 2MKEA 2UZGA 4IC3A 5AIUA 4LK9A 1MM3A 3DQVR 3M63A 1X4JA 1VFYA 3O34A 2MT5A 5G0FA 3FJUB 4LKAA 3O33A 1WEPA 2L43A 2Y1MA 2YVRA 4GNEA 2LN0A 2YT5A 1WEUA 4LJNA 2JM3A 4XI1A 2EGMA 2L0BA 2OXQC 5KH7A 4X3GA 2H0DA 2L7PA
chains in the Genus database with same CATH topology
5K3QA 2YREA 1DCQA 3E2DA 2RR4A 3DDTA 5SVIB 3KDEC 2XOYA 2FD4A 2XOZA 3LVRE 2CSVA 4QQ4A 2CRWA 2OWAA 4F1PA 2CONA 4Z0OA 2KKYA 4OGCA 2EXUA 3LJUX 2E61A 3FJUB 2CRRA 5SVIA 2LAUA 3M7KA 3FM8C 4O62A 2FFWA 2XP0A 3Q1DA 2YVRA 4OGEA 3T9KA 2IQJA 2B0OE 3DWDA 3PLWA 3H7HA 4H9DA 4Z0RA 2P57A 3SUBA 2JM3A 2XOCA 3O47A 2EGMA 2D8UA 2KKXA 3FEHA 3LVQE 5SVXA 3MDBC 5SVYA 2DJAA 2MKEA 3LDYA 2JUNA 2M13A 3JUEA 2L7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9K A;  3FEH A;  2IQJ A;  2CRR A;  1DCQ A;  2B0O E;  3DWD A;  3LVQ E;  3O47 A;  3MDB C;  3SUB A;  2P57 A;  3LVR E;  2CRW A;  2OWA A;  4F1P A;  3FM8 C;  3JUE A;  3LJU X; 
#chains in the Genus database with same CATH topology
 2FD4 A;  4UP5 A;  2KWO A;  3C5K A;  4FJC A;  3U5P A;  1WE9 A;  3KQI A;  2VJE B;  2JMD A;  4N4F A;  2XOC A;  3ZYQ A;  4UI9 B;  2K17 A;  3SOX A;  3O7A A;  2MNY A;  2JUN A;  4ZUX U;  2LGV A;  4V3K C;  2H0D B;  4MVT A;  4QQ4 A;  5FEY A;  4OGC A;  3LQI A;  3SHB A;  2CKL A;  2DSM A;  2YQM A;  2PNX A;  3N9Q A;  1WEM A;  5FB1 A;  3KV6 A;  3U5N A;  3V43 A;  4AP4 A;  3O47 A;  3DPL R;  2D8U A;  5DKA A;  4L7X A;  3O36 A;  3C6W A;  2Y43 A;  5AIT A;  4BHW A;  1MM2 A;  5H9M A;  4UP0 A;  5D1K B;  2JMI A;  3N9M A;  2YU4 A;  4IC2 A;  4YAB A;  5B79 A;  2KR4 A;  5JG6 A;  4WA6 A;  1FBV A;  5LKZ A;  2YUC A;  4A4B A;  4WZ0 A;  2RI7 A;  2IQJ A;  1WIM A;  5LCW B;  2ZET C;  3PHD A;  2LRI C;  5TDR A;  1HYJ A;  1VYX A;  4O64 A;  1RMD A;  1X4I A;  1WEW A;  4CCG X;  4I7C A;  2VJF A;  5SVI B;  3I2D A;  3L1X A;  1HYI A;  4AVX A;  2XEU A;  2CRR A;  4S3O B;  1WES A;  2KE1 A;  3NG2 A;  4YAT A;  3ZVZ B;  3SOU A;  2NAA A;  2M1R A;  2IDA A;  3H7H A;  2YSM A;  2E6S A;  3FEH A;  5FB0 A;  3ASL A;  5H1U A;  5SVY A;  2RSD A;  2LV9 A;  1X4U A;  2AN6 A;  2MD8 C;  2I50 A;  2G43 A;  1WEQ A;  2KFT A;  3ZTG A;  1G25 A;  3E2D A;  5I3L A;  2XOZ A;  5DIN A;  1JM7 A;  4A0C D;  3LRQ A;  2JMJ A;  2MIQ A;  2ECT A;  3T6R A;  4CA1 A;  3HCU A;  3EB6 A;  3ZPV E;  2FFW A;  4LAD B;  4A4C A;  1WEV A;  2KGI A;  1V87 A;  2QIZ A;  3LDY A;  5TDW A;  2M13 A;  2KWJ A;  2VPB A;  5LKU A;  2F42 A;  3LQJ A;  4YBM A;  2YW8 A;  2CON A;  3O70 A;  1JM7 B;  4YAX A;  2G45 A;  4B7Y C;  2LAU A;  5C13 A;  2Y1N A;  2FSA A;  4GND A;  2K1J A;  2QIC A;  3ZPV 1;  3U5M A;  2B0O E;  2EA6 A;  1WEE A;  2LXP C;  3RPG C;  3N9P A;  5C11 A;  4AYC A;  5TAB A;  5B75 A;  1N87 A;  2ECW A;  4ZQL A;  5B77 A;  2CSV A;  3LQH A;  4Z0O A;  4TKP B;  3IHP A;  4A49 A;  2CSZ A;  1Z60 A;  4O62 A;  2VPE A;  2YHN A;  4H9D A;  2K4D A;  3SOW A;  2KKX A;  4R7E A;  2ECJ A;  3FL2 A;  4NN2 A;  2FUU A;  2LXH C;  2JRJ A;  2YUR A;  2YYR A;  2M3H A;  2RR4 A;  3RTR B;  1F62 A;  2L75 A;  3LVR E;  4GB0 A;  2L5U A;  2K16 A;  2E6R A;  5KH3 A;  2CKL B;  2KWK A;  2XB1 A;  4WZ3 B;  5B78 A;  4YBS A;  4F52 B;  1WEN A;  2VJE A;  1MBM A;  5K3Q A;  5D1M B;  2ECG A;  4PTB A;  5LKT A;  4S3O C;  4F1P A;  3LJU X;  1LDJ B;  1Z2Q A;  4OGE A;  4ZDT A;  3PLW A;  4FK5 A;  4Z0R A;  2ECN A;  2DX8 A;  2LGK A;  2F6J A;  3FAO A;  4GNG A;  2MA5 A;  3O35 A;  4B86 C;  1VD4 A;  1FP0 A;  5G04 B;  4V3L C;  2KRE A;  4N3W A;  2CRW A;  2KIZ A;  2OWA A;  5EYA F;  1ZBD B;  3N9L A;  3PUR A;  3O37 A;  2M6M A;  3SUB A;  2MNZ A;  3KV5 A;  4YC9 A;  2XOY A;  3JUE A;  4I7D A;  4P5O B;  1DCQ A;  2EOD A;  3N9O A;  2LQ6 A;  1BOR A;  3HCT A;  4AUQ B;  1JOC A;  2E61 A;  5SVI A;  2VPD A;  4R2Y A;  3EB5 A;  2QJ0 A;  2YSJ A;  2P57 A;  3QZV A;  1Z6U A;  2PUY A;  5SVX A;  2DJA A;  4FIP A;  2YRE A;  5KH9 A;  3RPG B;  2G6Q A;  4WZ2 A;  3ZNI A;  5LKX A;  1LDK C;  2C2V S;  2D8S A;  3U5O A;  2VNF A;  2KU3 A;  1DVP A;  3Q1D A;  5G05 B;  3DWD A;  2BAY A;  3T7L A;  2MA6 A;  3MHH A;  2ECV A;  3PUQ A;  2KGG A;  4BBQ A;  3LVQ E;  5J3X A;  3MDB C;  1XWH A;  3L1Z B;  4LLB A;  5TRB A;  4MSX A;  2FUI A;  5FER A;  5TBN A;  2KKY A;  4YAD A;  3M7K A;  5B8D A;  2CSY A;  1E4U A;  3FM8 C;  2VPG A;  3T9K A;  2YQL A;  3M62 A;  5H1T A;  2F6N A;  1IYM A;  1WIL A;  2KYU A;  3HCS A;  3M99 A;  4I7B A;  2KWN A;  2VJF B;  4L58 A;  5D1L B;  1U6G B;  3MHS A;  2C2L A;  3KDE C;  2ECI A;  3DDT A;  4GNF A;  3HTK C;  5B76 A;  3VK6 A;  3KNV A;  2YHO A;  2LGL A;  3GV4 A;  1WEO A;  2MUM A;  4W4U A;  3ZVY A;  2L80 A;  2HYE D;  4QF2 A;  2VP7 A;  2CT2 A;  2HDP A;  2EXU A;  4YBT A;  1K2F A;  1T1H A;  1CHC A;  2M85 A;  2EGP A;  4FO9 A;  4PPE A;  2MD7 B;  4QF3 A;  2LGG A;  3GL6 A;  4AYC B;  4C9Z A;  2XP0 A;  1WFK A;  4Q6F A;  2LDR A;  3FAN A;  3L11 A;  1WGM A;  4R8P K;  5H1V A;  3N9N A;  2MKE A;  2UZG A;  4IC3 A;  5AIU A;  4LK9 A;  1MM3 A;  3DQV R;  3M63 A;  1X4J A;  1VFY A;  3O34 A;  2MT5 A;  5G0F A;  3FJU B;  4LKA A;  3O33 A;  1WEP A;  2L43 A;  2Y1M A;  2YVR A;  4GNE A;  2LN0 A;  2YT5 A;  1WEU A;  4LJN A;  2JM3 A;  4XI1 A;  2EGM A;  2L0B A;  2OXQ C;  5KH7 A;  4X3G A;  2H0D A;  2L7P A; 
#chains in the Genus database with same CATH homology
 5K3Q A;  2YRE A;  1DCQ A;  3E2D A;  2RR4 A;  3DDT A;  5SVI B;  3KDE C;  2XOY A;  2FD4 A;  2XOZ A;  3LVR E;  2CSV A;  4QQ4 A;  2CRW A;  2OWA A;  4F1P A;  2CON A;  4Z0O A;  2KKY A;  4OGC A;  2EXU A;  3LJU X;  2E61 A;  3FJU B;  2CRR A;  5SVI A;  2LAU A;  3M7K A;  3FM8 C;  4O62 A;  2FFW A;  2XP0 A;  3Q1D A;  2YVR A;  4OGE A;  3T9K A;  2IQJ A;  2B0O E;  3DWD A;  3PLW A;  3H7H A;  4H9D A;  4Z0R A;  2P57 A;  3SUB A;  2JM3 A;  2XOC A;  3O47 A;  2EGM A;  2D8U A;  2KKX A;  3FEH A;  3LVQ E;  5SVX A;  3MDB C;  5SVY A;  2DJA A;  2MKE A;  3LDY A;  2JUN A;  2M13 A;  3JUE A;  2L7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...