3SUBA

Crystal structure of the catalytic domain of plasmodium falciparum arf gtpase activating protein
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
GSHMNAAAVEFINRLKKEDESNNKCFDCGISNPDWVSVNHGIFLCINCSGVHRSLGVHISIVRSIKMDIFTDEQLKYIDKGGNKKCQTYLENYGISDFIPERKYRTKAADHYRKILRSIVHNVDPPAPLPLDEGKSLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the catalytic domain of Plasmodium falciparum ARF GTPase-activating protein (ARFGAP).
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase activator
molecule keywords ADP-ribosylation factor GTPase-activating protein
total genus 50
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3subA00
2OWAA 3T9KA 3O47A 2B0OE 3LJUX 3FEHA 3LVQE 2CRWA 2P57A 3MDBC 3SUBA 4F1PA 3FM8C 3DWDA 3LVRE 1DCQA 2CRRA 2IQJA 3JUEA
chains in the Genus database with same CATH superfamily
1MM2A 5FB0A 2XOYA 2L80A 4BHWA 2ECWA 1WEQA 3LRQA 4WZ0A 4L7XA 2L75A 5D1MB 1V87A 2VPBA 2JUNA 4Q6FA 2P57A 5LKUA 5H1VA 2KGGA 4PTBA 1F62A 1WIMA 1WEEA 4IC3A 3O34A 4QQ4A 2VP7A 4A4CA 4YBSA 3N9NA 2FUIA 5B78A 5G05B 3LVQE 5DINA 1VYXA 2ZETC 3O7AA 2YW8A 3LQJA 4NN2A 4LLBA 2MNYA 2CRRA 2QJ0A 2XP0A 5FB1A 4BBQA 4AP4A 2L7PA 2VJFA 2G6QA 5D1KB 4YC9A 2EXUA 2MA5A 2DSMA 2ECJA 3O70A 1Z2QA 4R2YA 4ZDTA 3HCUA 5SVIA 5KH7A 3C5KA 2VPGA 3N9PA 4A49A 2KREA 2MT5A 5B79A 2LAUA 3LVRE 1WEUA 2KWJA 2BAYA 3T9KA 2YSJA 2DJAA 2VPDA 4WZ2A 2YQLA 4AVXA 4A4BA 3U5OA 4LK9A 4AUQB 2F6JA 4UI9B 3ZVYA 3M99A 4YADA 3RPGB 2LGGA 2CSZA 2E6RA 4PPEA 3M62A 2LGKA 2FD4A 1X4JA 4YBMA 1K2FA 4OGEA 2ECTA 5B75A 2K16A 5AITA 2VJEA 1WEMA 5EYAF 2KWNA 2XOCA 3GV4A 2XB1A 2FSAA 2JMIA 1E4UA 3NG2A 4LKAA 2YHOA 2YVRA 2C2LA 3L1ZB 3HTKC 2HDPA 3LQHA 5TDRA 2XEUA 1WENA 5DKAA 3N9QA 3KV6A 2F42A 3L1XA 1WFKA 2RR4A 2LGLA 5AIUA 3Q1DA 4GB0A 1WEOA 3O47A 3SOWA 2K1JA 5C11A 2QICA 2M1RA 1ZBDB 2ECNA 3ZVZB 2KWOA 2LXHC 3EB6A 5LKXA 3O35A 3PUQA 2I50A 2ECGA 4F1PA 5TABA 3JUEA 1T1HA 3FEHA 2JM3A 5KH9A 3VK6A 1Z60A 2LN0A 1N87A 5G04B 5H1TA 2LV9A 4C9ZA 4B86C 2E61A 3SHBA 5LKTA 3SOXA 3ASLA 1DVPA 2DX8A 2H0DA 3HCTA 4WA6A 2YUCA 3N9MA 4WZ3B 1WGMA 1MM3A 4O62A 4GNDA 5TDWA 5TRBA 1WEPA 4IC2A 3C6WA 2MA6A 4LADB 4X3GA 4S3OB 2K17A 4LJNA 4FO9A 5KH3A 4L58A 2MUMA 2Y1MA 5SVYA 4XI1A 2UZGA 3GL6A 3I2DA 2M85A 3KDEC 4ZQLA 4S3OC 5D1LB 3O37A 2D8SA 1X4UA 5B77A 3IHPA 4O64A 2YQMA 2L5UA 1WE9A 4ZUXU 3ZPV1 1VFYA 3ZPVE 2KKYA 1FP0A 2CKLA 2JRJA 4YATA 2VPEA 2LXPC 2KKXA 3DWDA 4FJCA 4Z0RA 3ZNIA 2RSDA 3KV5A 3EB5A 2ECIA 4AYCA 5B8DA 5C13A 3H7HA 4GNGA 1G25A 3FAOA 2KR4A 3SOUA 3HCSA 1U6GB 1Z6UA 4A0CD 3M7KA 4CA1A 4UP0A 2JMJA 4B7YC 5H9MA 4V3KC 1HYJA 1LDJB 2YHNA 3RPGC 2CT2A 2YURA 2F6NA 2KGIA 4I7BA 3L11A 3U5MA 3MDBC 3MHSA 2MD7B 2ECVA 3FM8C 4P5OB 3E2DA 4GNEA 1VD4A 3M63A 2KIZA 1FBVA 2PUYA 3DPLR 3DQVR 4YBTA 4MSXA 2EGMA 2KFTA 4YAXA 2VJFB 4MVTA 1DCQA 3U5PA 2HYED 5K3QA 2LRIC 2MNZA 3RTRB 1LDKC 1WILA 3LDYA 1JM7B 2RI7A 4FIPA 2L43A 2CKLB 2H0DB 3FJUB 2M3HA 2IQJA 3FL2A 4Z0OA 2C2VS 2EA6A 5J3XA 2KYUA 1JOCA 4AYCB 4I7CA 3V43A 3QZVA 2CRWA 4H9DA 4CCGX 3O36A 2G43A 3KNVA 3MHHA 4V3LC 1X4IA 2AN6A 1CHCA 2B0OE 5FERA 4R7EA 2QIZA 3PHDA 4OGCA 2D8UA 1IYMA 4R8PK 4YABA 2MIQA 2YREA 2OWAA 2CSYA 2Y1NA 2Y43A 2XOZA 2KE1A 2PNXA 2YSMA 5JG6A 2MD8C 2G45A 2E6SA 2LGVA 2FFWA 2LQ6A 2EODA 2CONA 3PURA 3LQIA 2K4DA 5LCWB 1HYIA 2MKEA 4N3WA 3U5NA 3PLWA 5SVXA 4F52B 4TKPB 2VJEB 3FANA 1MBMA 1WEWA 4I7DA 5I3LA 2IDAA 3ZYQA 2EGPA 3O33A 4FK5A 1BORA 2FUUA 4N4FA 2NAAA 2JMDA 3KQIA 2YYRA 3ZTGA 1XWHA 3N9OA 4QF3A 2LDRA 4QF2A 2YT5A 1JM7A 3LJUX 2OXQC 2M13A 1WEVA 2CSVA 5LKZA 4W4UA 2KU3A 3T6RA 3T7LA 3SUBA 5SVIB 1RMDA 5B76A 3DDTA 4GNFA 1WESA 5G0FA 2KWKA 2VNFA 2L0BA 5FEYA 5H1UA 4UP5A 5TBNA 2YU4A 2M6MA 3N9LA
chains in the Genus database with same CATH topology
2M13A 2YVRA 2EXUA 4O62A 2CSVA 2XOZA 4H9DA 2XOYA 3FJUB 2EGMA 2IQJA 4QQ4A 4Z0OA 3LJUX 3SUBA 3M7KA 2FD4A 5SVIB 2KKYA 5SVIA 4OGEA 1DCQA 5SVYA 2E61A 3DDTA 2B0OE 2FFWA 2JUNA 3LVQE 4F1PA 2P57A 2RR4A 5K3QA 3Q1DA 2KKXA 2LAUA 2CONA 3DWDA 3LVRE 3JUEA 2CRRA 3O47A 4Z0RA 4OGCA 3KDEC 2XP0A 3T9KA 2D8UA 2DJAA 2MKEA 3FEHA 2L7PA 2CRWA 2JM3A 3MDBC 3LDYA 3PLWA 3FM8C 5SVXA 3E2DA 3H7HA 2YREA 2XOCA 2OWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWA A;  3T9K A;  3O47 A;  2B0O E;  3LJU X;  3FEH A;  3LVQ E;  2CRW A;  2P57 A;  3MDB C;  3SUB A;  4F1P A;  3FM8 C;  3DWD A;  3LVR E;  1DCQ A;  2CRR A;  2IQJ A;  3JUE A; 
#chains in the Genus database with same CATH topology
 1MM2 A;  5FB0 A;  2XOY A;  2L80 A;  4BHW A;  2ECW A;  1WEQ A;  3LRQ A;  4WZ0 A;  4L7X A;  2L75 A;  5D1M B;  1V87 A;  2VPB A;  2JUN A;  4Q6F A;  2P57 A;  5LKU A;  5H1V A;  2KGG A;  4PTB A;  1F62 A;  1WIM A;  1WEE A;  4IC3 A;  3O34 A;  4QQ4 A;  2VP7 A;  4A4C A;  4YBS A;  3N9N A;  2FUI A;  5B78 A;  5G05 B;  3LVQ E;  5DIN A;  1VYX A;  2ZET C;  3O7A A;  2YW8 A;  3LQJ A;  4NN2 A;  4LLB A;  2MNY A;  2CRR A;  2QJ0 A;  2XP0 A;  5FB1 A;  4BBQ A;  4AP4 A;  2L7P A;  2VJF A;  2G6Q A;  5D1K B;  4YC9 A;  2EXU A;  2MA5 A;  2DSM A;  2ECJ A;  3O70 A;  1Z2Q A;  4R2Y A;  4ZDT A;  3HCU A;  5SVI A;  5KH7 A;  3C5K A;  2VPG A;  3N9P A;  4A49 A;  2KRE A;  2MT5 A;  5B79 A;  2LAU A;  3LVR E;  1WEU A;  2KWJ A;  2BAY A;  3T9K A;  2YSJ A;  2DJA A;  2VPD A;  4WZ2 A;  2YQL A;  4AVX A;  4A4B A;  3U5O A;  4LK9 A;  4AUQ B;  2F6J A;  4UI9 B;  3ZVY A;  3M99 A;  4YAD A;  3RPG B;  2LGG A;  2CSZ A;  2E6R A;  4PPE A;  3M62 A;  2LGK A;  2FD4 A;  1X4J A;  4YBM A;  1K2F A;  4OGE A;  2ECT A;  5B75 A;  2K16 A;  5AIT A;  2VJE A;  1WEM A;  5EYA F;  2KWN A;  2XOC A;  3GV4 A;  2XB1 A;  2FSA A;  2JMI A;  1E4U A;  3NG2 A;  4LKA A;  2YHO A;  2YVR A;  2C2L A;  3L1Z B;  3HTK C;  2HDP A;  3LQH A;  5TDR A;  2XEU A;  1WEN A;  5DKA A;  3N9Q A;  3KV6 A;  2F42 A;  3L1X A;  1WFK A;  2RR4 A;  2LGL A;  5AIU A;  3Q1D A;  4GB0 A;  1WEO A;  3O47 A;  3SOW A;  2K1J A;  5C11 A;  2QIC A;  2M1R A;  1ZBD B;  2ECN A;  3ZVZ B;  2KWO A;  2LXH C;  3EB6 A;  5LKX A;  3O35 A;  3PUQ A;  2I50 A;  2ECG A;  4F1P A;  5TAB A;  3JUE A;  1T1H A;  3FEH A;  2JM3 A;  5KH9 A;  3VK6 A;  1Z60 A;  2LN0 A;  1N87 A;  5G04 B;  5H1T A;  2LV9 A;  4C9Z A;  4B86 C;  2E61 A;  3SHB A;  5LKT A;  3SOX A;  3ASL A;  1DVP A;  2DX8 A;  2H0D A;  3HCT A;  4WA6 A;  2YUC A;  3N9M A;  4WZ3 B;  1WGM A;  1MM3 A;  4O62 A;  4GND A;  5TDW A;  5TRB A;  1WEP A;  4IC2 A;  3C6W A;  2MA6 A;  4LAD B;  4X3G A;  4S3O B;  2K17 A;  4LJN A;  4FO9 A;  5KH3 A;  4L58 A;  2MUM A;  2Y1M A;  5SVY A;  4XI1 A;  2UZG A;  3GL6 A;  3I2D A;  2M85 A;  3KDE C;  4ZQL A;  4S3O C;  5D1L B;  3O37 A;  2D8S A;  1X4U A;  5B77 A;  3IHP A;  4O64 A;  2YQM A;  2L5U A;  1WE9 A;  4ZUX U;  3ZPV 1;  1VFY A;  3ZPV E;  2KKY A;  1FP0 A;  2CKL A;  2JRJ A;  4YAT A;  2VPE A;  2LXP C;  2KKX A;  3DWD A;  4FJC A;  4Z0R A;  3ZNI A;  2RSD A;  3KV5 A;  3EB5 A;  2ECI A;  4AYC A;  5B8D A;  5C13 A;  3H7H A;  4GNG A;  1G25 A;  3FAO A;  2KR4 A;  3SOU A;  3HCS A;  1U6G B;  1Z6U A;  4A0C D;  3M7K A;  4CA1 A;  4UP0 A;  2JMJ A;  4B7Y C;  5H9M A;  4V3K C;  1HYJ A;  1LDJ B;  2YHN A;  3RPG C;  2CT2 A;  2YUR A;  2F6N A;  2KGI A;  4I7B A;  3L11 A;  3U5M A;  3MDB C;  3MHS A;  2MD7 B;  2ECV A;  3FM8 C;  4P5O B;  3E2D A;  4GNE A;  1VD4 A;  3M63 A;  2KIZ A;  1FBV A;  2PUY A;  3DPL R;  3DQV R;  4YBT A;  4MSX A;  2EGM A;  2KFT A;  4YAX A;  2VJF B;  4MVT A;  1DCQ A;  3U5P A;  2HYE D;  5K3Q A;  2LRI C;  2MNZ A;  3RTR B;  1LDK C;  1WIL A;  3LDY A;  1JM7 B;  2RI7 A;  4FIP A;  2L43 A;  2CKL B;  2H0D B;  3FJU B;  2M3H A;  2IQJ A;  3FL2 A;  4Z0O A;  2C2V S;  2EA6 A;  5J3X A;  2KYU A;  1JOC A;  4AYC B;  4I7C A;  3V43 A;  3QZV A;  2CRW A;  4H9D A;  4CCG X;  3O36 A;  2G43 A;  3KNV A;  3MHH A;  4V3L C;  1X4I A;  2AN6 A;  1CHC A;  2B0O E;  5FER A;  4R7E A;  2QIZ A;  3PHD A;  4OGC A;  2D8U A;  1IYM A;  4R8P K;  4YAB A;  2MIQ A;  2YRE A;  2OWA A;  2CSY A;  2Y1N A;  2Y43 A;  2XOZ A;  2KE1 A;  2PNX A;  2YSM A;  5JG6 A;  2MD8 C;  2G45 A;  2E6S A;  2LGV A;  2FFW A;  2LQ6 A;  2EOD A;  2CON A;  3PUR A;  3LQI A;  2K4D A;  5LCW B;  1HYI A;  2MKE A;  4N3W A;  3U5N A;  3PLW A;  5SVX A;  4F52 B;  4TKP B;  2VJE B;  3FAN A;  1MBM A;  1WEW A;  4I7D A;  5I3L A;  2IDA A;  3ZYQ A;  2EGP A;  3O33 A;  4FK5 A;  1BOR A;  2FUU A;  4N4F A;  2NAA A;  2JMD A;  3KQI A;  2YYR A;  3ZTG A;  1XWH A;  3N9O A;  4QF3 A;  2LDR A;  4QF2 A;  2YT5 A;  1JM7 A;  3LJU X;  2OXQ C;  2M13 A;  1WEV A;  2CSV A;  5LKZ A;  4W4U A;  2KU3 A;  3T6R A;  3T7L A;  3SUB A;  5SVI B;  1RMD A;  5B76 A;  3DDT A;  4GNF A;  1WES A;  5G0F A;  2KWK A;  2VNF A;  2L0B A;  5FEY A;  5H1U A;  4UP5 A;  5TBN A;  2YU4 A;  2M6M A;  3N9L A; 
#chains in the Genus database with same CATH homology
 2M13 A;  2YVR A;  2EXU A;  4O62 A;  2CSV A;  2XOZ A;  4H9D A;  2XOY A;  3FJU B;  2EGM A;  2IQJ A;  4QQ4 A;  4Z0O A;  3LJU X;  3SUB A;  3M7K A;  2FD4 A;  5SVI B;  2KKY A;  5SVI A;  4OGE A;  1DCQ A;  5SVY A;  2E61 A;  3DDT A;  2B0O E;  2FFW A;  2JUN A;  3LVQ E;  4F1P A;  2P57 A;  2RR4 A;  5K3Q A;  3Q1D A;  2KKX A;  2LAU A;  2CON A;  3DWD A;  3LVR E;  3JUE A;  2CRR A;  3O47 A;  4Z0R A;  4OGC A;  3KDE C;  2XP0 A;  3T9K A;  2D8U A;  2DJA A;  2MKE A;  3FEH A;  2L7P A;  2CRW A;  2JM3 A;  3MDB C;  3LDY A;  3PLW A;  3FM8 C;  5SVX A;  3E2D A;  3H7H A;  2YRE A;  2XOC A;  2OWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...