5TDWA

Set3 phd finger in complex with histone h3k4me3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
GIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SET domain-containing protein 3
publication title Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 23
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tdwA00
2KGIA 1WESA 5FB1A 2D8SA 3V43A 3IHPA 4F52B 1DVPA 2YSJA 3T6RA 3ZTGA 2L80A 4L7XA 5C13A 3PHDA 1F62A 4A4CA 2KWKA 2K4DA 2ECVA 2C2VS 4N4FA 3DQVR 3DPLR 4ZDTA 5D1LB 1WEQA 2OXQC 2M85A 2MNZA 2L43A 4IC2A 5LCWB 4UP5A 4LKAA 1Z6UA 3ZPVE 2C2LA 1MM2A 3SOUA 2LGVA 4GNDA 1HYIA 5B76A 2ECJA 2K17A 2KR4A 1IYMA 4QF3A 4P5OB 4I7CA 3LQHA 4AUQB 2MIQA 3M99A 2LV9A 4XI1A 5LKTA 5D1MB 2I50A 3M62A 3O70A 3ZPV1 2K16A 3GL6A 1JOCA 2YREA 4WZ0A 1LDKC 4R8PK 4AYCA 3KV6A 5B78A 4GNFA 4Q6FA 5TDWA 3SHBA 2G43A 1XWHA 2RSDA 4YATA 3NG2A 2UZGA 2ECTA 3KNVA 3LQIA 5I3LA 5G0FA 4IC3A 5LKUA 1Z2QA 3SOXA 2JRJA 1WEMA 2BAYA 3N9MA 1WEEA 2KWOA 4YBTA 4TKPB 4I7BA 4ZQLA 2MD8C 2EA6A 4UP0A 4V3KC 5H1UA 5FEYA 3KQIA 2VP7A 2FSAA 2VPEA 3ASLA 1WENA 2MNYA 3U5MA 4YBMA 1RMDA 3LQJA 2HYED 2YU4A 4R2YA 3MHSA 4FIPA 2ECIA 4AP4A 3MHHA 2LGKA 2L75A 1FBVA 2YQMA 2QJ0A 2JMJA 3ZYQA 2E6RA 3HCTA 4AYCB 1WEUA 1WILA 5TABA 3O34A 1WEVA 4X3GA 1WEWA 2YHOA 4W4UA 2VJEA 3L11A 2EODA 3HCUA 4N3WA 2YURA 2E6SA 3C6WA 1WIMA 2JMDA 2MT5A 2QICA 4CA1A 2EGPA 3U5PA 1U6GB 2IDAA 4LJNA 4C9ZA 2LXPC 5TBNA 5DKAA 1MM3A 2L0BA 4FJCA 3N9NA 3EB6A 2ECGA 5H1TA 4S3OB 5TRBA 4YAXA 4LK9A 4LLBA 2YQLA 2M6MA 3L1ZB 5EYAF 5G05B 1X4UA 4MSXA 1WFKA 3RTRB 3N9LA 1V87A 2KU3A 1WEOA 1E4UA 3I2DA 3GV4A 1X4JA 5B75A 5G04B 4BHWA 3RPGB 2G45A 4PTBA 2F6NA 3O36A 3QZVA 5KH7A 2F6JA 2KYUA 2YUCA 4UI9B 1ZBDB 1HYJA 2VJEB 3SOWA 4B86C 1T1HA 4A0CD 2F42A 2ZETC 2KGGA 3N9PA 2LRIC 2FUUA 2HDPA 2MUMA 5H9MA 2KFTA 3EB5A 2MA5A 2KIZA 3N9OA 1CHCA 2YT5A 4B7YC 2VJFA 1X4IA 4PPEA 4R7EA 5B8DA 1LDJB 2VNFA 5TDRA 5D1KB 3ZNIA 3O7AA 4NN2A 3KV5A 3L1XA 1VYXA 2YYRA 5B79A 2YW8A 3LRQA 3PURA 4L58A 1N87A 2YSMA 3O35A 2KE1A 1JM7A 2XB1A 5FERA 4YC9A 2LGLA 2G6QA 2MD7B 2LDRA 3U5OA 2CSYA 2Y1MA 4ZUXU 1Z60A 2QIZA 4WA6A 4I7DA 5LKZA 5LKXA 5B77A 5AIUA 3HTKC 1FP0A 2MA6A 3ZVZB 2L5UA 5J3XA 5JG6A 2Y43A 2FUIA 2VPBA 4GNEA 1VFYA 3HCSA 2Y1NA 2LQ6A 4QF2A 4FK5A 4V3LC 3O37A 2VJFB 3C5KA 4O64A 4S3OC 4A4BA 2M3HA 4A49A 1G25A 1WEPA 2RI7A 5FB0A 3T7LA 2VPGA 2M1RA 2H0DA 2CKLA 3U5NA 5AITA 1BORA 2LGGA 1WE9A 3VK6A 5KH3A 2LN0A 2K1JA 2CSZA 1JM7B 2YHNA 4AVXA 4WZ2A 2XEUA 1K2FA 4YBSA 2DX8A 2KWJA 3FL2A 3RPGC 2KWNA 2PUYA 4YABA 2PNXA 2JMIA 5DINA 4CCGX 3PUQA 3N9QA 4LADB 2VPDA 3ZVYA 4WZ3B 2KREA 3O33A 4MVTA 4BBQA 2ECWA 2CT2A 4GB0A 5C11A 5KH9A 2CKLB 2H0DB 2ECNA 2LXHC 4FO9A 2NAAA 3M63A 2AN6A 4GNGA 1VD4A 5H1VA 1WGMA 4YADA
chains in the Genus database with same CATH superfamily
3JUEA 2KGIA 1WESA 5FB1A 2D8SA 3V43A 3IHPA 4F52B 1DVPA 2YSJA 3T6RA 3ZTGA 2FD4A 2L80A 4L7XA 5C13A 3LVQE 3PHDA 3DWDA 1F62A 4A4CA 2KWKA 2K4DA 2ECVA 2P57A 2C2VS 4N4FA 3DQVR 3DPLR 4ZDTA 2OWAA 5D1LB 1WEQA 2B0OE 2OXQC 2M85A 3LJUX 2MNZA 2L43A 4IC2A 5LCWB 4UP5A 2JM3A 4LKAA 1Z6UA 3ZPVE 2C2LA 1MM2A 3SOUA 2LGVA 4GNDA 1HYIA 5B76A 2ECJA 2K17A 2CONA 2KR4A 1IYMA 4QF3A 2CSVA 4P5OB 4I7CA 3LQHA 4AUQB 2MIQA 3FM8C 3M99A 4OGCA 2LV9A 2D8UA 4XI1A 5LKTA 2M13A 5D1MB 2I50A 3M62A 3O70A 3ZPV1 2K16A 3GL6A 1JOCA 2YREA 2JUNA 4WZ0A 1LDKC 4R8PK 4AYCA 3KV6A 5B78A 4OGEA 4GNFA 4Q6FA 5TDWA 3SHBA 4F1PA 2G43A 1XWHA 2RSDA 4YATA 3SUBA 2EGMA 3NG2A 2XOYA 2UZGA 2ECTA 3KNVA 3LQIA 5I3LA 5G0FA 4IC3A 5LKUA 1Z2QA 3E2DA 3SOXA 2JRJA 1WEMA 2BAYA 3N9MA 1WEEA 3KDEC 2KWOA 4YBTA 4TKPB 4I7BA 4ZQLA 2MD8C 2EA6A 4UP0A 4V3KC 5H1UA 5FEYA 3KQIA 2VP7A 2FSAA 2VPEA 3ASLA 1WENA 2MNYA 3Q1DA 3U5MA 4YBMA 1RMDA 3LQJA 2HYED 2YU4A 4R2YA 3MHSA 4FIPA 2ECIA 4AP4A 3MHHA 2LGKA 2L75A 1FBVA 2YQMA 2QJ0A 2JMJA 3ZYQA 2E6RA 2KKXA 2IQJA 2XOZA 3HCTA 4AYCB 1WEUA 1WILA 5TABA 3O34A 1WEVA 4X3GA 1WEWA 2YHOA 4W4UA 2VJEA 3L11A 2EODA 3HCUA 4N3WA 2YURA 2E6SA 3C6WA 1WIMA 2JMDA 2MT5A 2QICA 4CA1A 2EGPA 3U5PA 1U6GB 2IDAA 4LJNA 3FEHA 4C9ZA 2LXPC 2L7PA 5TBNA 5DKAA 1MM3A 4FJCA 2L0BA 3N9NA 3EB6A 2ECGA 5H1TA 2MKEA 4S3OB 5TRBA 2CRRA 1DCQA 4YAXA 4LK9A 4LLBA 2YQLA 2M6MA 3L1ZB 5K3QA 5EYAF 5G05B 1X4UA 2YVRA 3O47A 4MSXA 3FJUB 1WFKA 3N9LA 3RTRB 1V87A 2KU3A 1WEOA 3FANA 1E4UA 3I2DA 3GV4A 1X4JA 5B75A 5G04B 4BHWA 3RPGB 2G45A 4PTBA 2F6NA 3O36A 3QZVA 3M7KA 5KH7A 2F6JA 2KYUA 2YUCA 4UI9B 2XP0A 1ZBDB 1HYJA 2VJEB 3SOWA 4B86C 1T1HA 5SVIA 3H7HA 4A0CD 2F42A 2ZETC 2KGGA 3N9PA 2LRIC 2FUUA 2HDPA 2MUMA 3DDTA 5H9MA 2KFTA 3EB5A 2MA5A 2KIZA 3N9OA 1CHCA 2E61A 2YT5A 4B7YC 2VJFA 1X4IA 4PPEA 4R7EA 5B8DA 1LDJB 2VNFA 5TDRA 5D1KB 3ZNIA 3O7AA 3MDBC 4NN2A 3KV5A 3L1XA 1VYXA 2YYRA 5B79A 2YW8A 3LRQA 3PURA 2CRWA 4L58A 1N87A 2YSMA 3O35A 2KE1A 1JM7A 5SVYA 2XB1A 5FERA 4YC9A 2EXUA 2LGLA 2G6QA 2MD7B 2LDRA 3U5OA 2CSYA 2Y1MA 4ZUXU 1Z60A 2QIZA 4WA6A 4I7DA 5LKZA 5LKXA 5B77A 3HTKC 5AIUA 1FP0A 2MA6A 5SVIB 2DSMA 2DJAA 3ZVZB 2L5UA 5J3XA 5JG6A 2Y43A 2KKYA 2FUIA 2VPBA 4GNEA 1VFYA 3HCSA 2Y1NA 2LQ6A 4QF2A 4Z0OA 3T9KA 3LVRE 4FK5A 4V3LC 3O37A 3FAOA 2VJFB 2XOCA 3C5KA 4O64A 4S3OC 4A4BA 2M3HA 4A49A 1G25A 1WEPA 2RI7A 5FB0A 3T7LA 2VPGA 2M1RA 2CKLA 2H0DA 3U5NA 5AITA 1BORA 2LGGA 1WE9A 4H9DA 3VK6A 5KH3A 2LN0A 2K1JA 2CSZA 1JM7B 2YHNA 4AVXA 2FFWA 4WZ2A 2LAUA 2XEUA 1K2FA 4YBSA 2DX8A 2KWJA 4Z0RA 3FL2A 3RPGC 2KWNA 2PUYA 5SVXA 4YABA 2PNXA 2JMIA 5DINA 4CCGX 3PUQA 3N9QA 4LADB 2VPDA 3ZVYA 2RR4A 4WZ3B 2KREA 3O33A 4MVTA 4BBQA 2ECWA 2CT2A 4GB0A 5C11A 3PLWA 4O62A 5KH9A 1MBMA 2CKLB 2H0DB 2ECNA 2LXHC 4FO9A 2NAAA 3M63A 2AN6A 3LDYA 4GNGA 1VD4A 5H1VA 4QQ4A 1WGMA 4YADA
chains in the Genus database with same CATH topology
2KGIA 1WESA 5FB1A 2D8SA 3V43A 3IHPA 4F52B 1DVPA 2YSJA 3T6RA 3ZTGA 2L80A 4L7XA 5C13A 3PHDA 1F62A 4A4CA 2KWKA 2K4DA 2ECVA 2C2VS 4N4FA 3DQVR 3DPLR 4ZDTA 5D1LB 1WEQA 2OXQC 2M85A 2MNZA 2L43A 4IC2A 5LCWB 4UP5A 4LKAA 1Z6UA 3ZPVE 2C2LA 1MM2A 3SOUA 2LGVA 4GNDA 1HYIA 5B76A 2ECJA 2K17A 2KR4A 1IYMA 4QF3A 4P5OB 4I7CA 3LQHA 4AUQB 2MIQA 3M99A 2LV9A 4XI1A 5LKTA 5D1MB 2I50A 3M62A 3O70A 3ZPV1 2K16A 3GL6A 1JOCA 2YREA 4WZ0A 1LDKC 4R8PK 4AYCA 3KV6A 5B78A 4GNFA 4Q6FA 5TDWA 3SHBA 2G43A 1XWHA 2RSDA 4YATA 3NG2A 2UZGA 2ECTA 3KNVA 3LQIA 5I3LA 5G0FA 4IC3A 5LKUA 1Z2QA 3SOXA 2JRJA 1WEMA 2BAYA 3N9MA 1WEEA 2KWOA 4YBTA 4TKPB 4I7BA 4ZQLA 2MD8C 2EA6A 4UP0A 4V3KC 5H1UA 5FEYA 3KQIA 2VP7A 2FSAA 2VPEA 3ASLA 1WENA 2MNYA 3U5MA 4YBMA 1RMDA 3LQJA 2HYED 2YU4A 4R2YA 3MHSA 4FIPA 2ECIA 4AP4A 3MHHA 2LGKA 2L75A 1FBVA 2YQMA 2QJ0A 2JMJA 3ZYQA 2E6RA 3HCTA 4AYCB 1WEUA 1WILA 5TABA 3O34A 1WEVA 4X3GA 1WEWA 2YHOA 4W4UA 2VJEA 3L11A 2EODA 3HCUA 4N3WA 2YURA 2E6SA 3C6WA 1WIMA 2JMDA 2MT5A 2QICA 4CA1A 2EGPA 3U5PA 1U6GB 2IDAA 4LJNA 4C9ZA 2LXPC 5TBNA 5DKAA 1MM3A 2L0BA 4FJCA 3N9NA 3EB6A 2ECGA 5H1TA 4S3OB 5TRBA 4YAXA 4LK9A 4LLBA 2YQLA 2M6MA 3L1ZB 5EYAF 5G05B 1X4UA 4MSXA 1WFKA 3RTRB 3N9LA 1V87A 2KU3A 1WEOA 1E4UA 3I2DA 3GV4A 1X4JA 5B75A 5G04B 4BHWA 3RPGB 2G45A 4PTBA 2F6NA 3O36A 3QZVA 5KH7A 2F6JA 2KYUA 2YUCA 4UI9B 1ZBDB 1HYJA 2VJEB 3SOWA 4B86C 1T1HA 4A0CD 2F42A 2ZETC 2KGGA 3N9PA 2LRIC 2FUUA 2HDPA 2MUMA 5H9MA 2KFTA 3EB5A 2MA5A 2KIZA 3N9OA 1CHCA 2YT5A 4B7YC 2VJFA 1X4IA 4PPEA 4R7EA 5B8DA 1LDJB 2VNFA 5TDRA 5D1KB 3ZNIA 3O7AA 4NN2A 3KV5A 3L1XA 1VYXA 2YYRA 5B79A 2YW8A 3LRQA 3PURA 4L58A 1N87A 2YSMA 3O35A 2KE1A 1JM7A 2XB1A 5FERA 4YC9A 2LGLA 2G6QA 2MD7B 2LDRA 3U5OA 2CSYA 2Y1MA 4ZUXU 1Z60A 2QIZA 4WA6A 4I7DA 5LKZA 5LKXA 5B77A 5AIUA 3HTKC 1FP0A 2MA6A 3ZVZB 2L5UA 5J3XA 5JG6A 2Y43A 2FUIA 2VPBA 4GNEA 1VFYA 3HCSA 2Y1NA 2LQ6A 4QF2A 4FK5A 4V3LC 3O37A 2VJFB 3C5KA 4O64A 4S3OC 4A4BA 2M3HA 4A49A 1G25A 1WEPA 2RI7A 5FB0A 3T7LA 2VPGA 2M1RA 2H0DA 2CKLA 3U5NA 5AITA 1BORA 2LGGA 1WE9A 3VK6A 5KH3A 2LN0A 2K1JA 2CSZA 1JM7B 2YHNA 4AVXA 4WZ2A 2XEUA 1K2FA 4YBSA 2DX8A 2KWJA 3FL2A 3RPGC 2KWNA 2PUYA 4YABA 2PNXA 2JMIA 5DINA 4CCGX 3PUQA 3N9QA 4LADB 2VPDA 3ZVYA 4WZ3B 2KREA 3O33A 4MVTA 4BBQA 2ECWA 2CT2A 4GB0A 5C11A 5KH9A 2CKLB 2H0DB 2ECNA 2LXHC 4FO9A 2NAAA 3M63A 2AN6A 4GNGA 1VD4A 5H1VA 1WGMA 4YADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGI A;  1WES A;  5FB1 A;  2D8S A;  3V43 A;  3IHP A;  4F52 B;  1DVP A;  2YSJ A;  3T6R A;  3ZTG A;  2L80 A;  4L7X A;  5C13 A;  3PHD A;  1F62 A;  4A4C A;  2KWK A;  2K4D A;  2ECV A;  2C2V S;  4N4F A;  3DQV R;  3DPL R;  4ZDT A;  5D1L B;  1WEQ A;  2OXQ C;  2M85 A;  2MNZ A;  2L43 A;  4IC2 A;  5LCW B;  4UP5 A;  4LKA A;  1Z6U A;  3ZPV E;  2C2L A;  1MM2 A;  3SOU A;  2LGV A;  4GND A;  1HYI A;  5B76 A;  2ECJ A;  2K17 A;  2KR4 A;  1IYM A;  4QF3 A;  4P5O B;  4I7C A;  3LQH A;  4AUQ B;  2MIQ A;  3M99 A;  2LV9 A;  4XI1 A;  5LKT A;  5D1M B;  2I50 A;  3M62 A;  3O70 A;  3ZPV 1;  2K16 A;  3GL6 A;  1JOC A;  2YRE A;  4WZ0 A;  1LDK C;  4R8P K;  4AYC A;  3KV6 A;  5B78 A;  4GNF A;  4Q6F A;  5TDW A;  3SHB A;  2G43 A;  1XWH A;  2RSD A;  4YAT A;  3NG2 A;  2UZG A;  2ECT A;  3KNV A;  3LQI A;  5I3L A;  5G0F A;  4IC3 A;  5LKU A;  1Z2Q A;  3SOX A;  2JRJ A;  1WEM A;  2BAY A;  3N9M A;  1WEE A;  2KWO A;  4YBT A;  4TKP B;  4I7B A;  4ZQL A;  2MD8 C;  2EA6 A;  4UP0 A;  4V3K C;  5H1U A;  5FEY A;  3KQI A;  2VP7 A;  2FSA A;  2VPE A;  3ASL A;  1WEN A;  2MNY A;  3U5M A;  4YBM A;  1RMD A;  3LQJ A;  2HYE D;  2YU4 A;  4R2Y A;  3MHS A;  4FIP A;  2ECI A;  4AP4 A;  3MHH A;  2LGK A;  2L75 A;  1FBV A;  2YQM A;  2QJ0 A;  2JMJ A;  3ZYQ A;  2E6R A;  3HCT A;  4AYC B;  1WEU A;  1WIL A;  5TAB A;  3O34 A;  1WEV A;  4X3G A;  1WEW A;  2YHO A;  4W4U A;  2VJE A;  3L11 A;  2EOD A;  3HCU A;  4N3W A;  2YUR A;  2E6S A;  3C6W A;  1WIM A;  2JMD A;  2MT5 A;  2QIC A;  4CA1 A;  2EGP A;  3U5P A;  1U6G B;  2IDA A;  4LJN A;  4C9Z A;  2LXP C;  5TBN A;  5DKA A;  1MM3 A;  2L0B A;  4FJC A;  3N9N A;  3EB6 A;  2ECG A;  5H1T A;  4S3O B;  5TRB A;  4YAX A;  4LK9 A;  4LLB A;  2YQL A;  2M6M A;  3L1Z B;  5EYA F;  5G05 B;  1X4U A;  4MSX A;  1WFK A;  3RTR B;  3N9L A;  1V87 A;  2KU3 A;  1WEO A;  1E4U A;  3I2D A;  3GV4 A;  1X4J A;  5B75 A;  5G04 B;  4BHW A;  3RPG B;  2G45 A;  4PTB A;  2F6N A;  3O36 A;  3QZV A;  5KH7 A;  2F6J A;  2KYU A;  2YUC A;  4UI9 B;  1ZBD B;  1HYJ A;  2VJE B;  3SOW A;  4B86 C;  1T1H A;  4A0C D;  2F42 A;  2ZET C;  2KGG A;  3N9P A;  2LRI C;  2FUU A;  2HDP A;  2MUM A;  5H9M A;  2KFT A;  3EB5 A;  2MA5 A;  2KIZ A;  3N9O A;  1CHC A;  2YT5 A;  4B7Y C;  2VJF A;  1X4I A;  4PPE A;  4R7E A;  5B8D A;  1LDJ B;  2VNF A;  5TDR A;  5D1K B;  3ZNI A;  3O7A A;  4NN2 A;  3KV5 A;  3L1X A;  1VYX A;  2YYR A;  5B79 A;  2YW8 A;  3LRQ A;  3PUR A;  4L58 A;  1N87 A;  2YSM A;  3O35 A;  2KE1 A;  1JM7 A;  2XB1 A;  5FER A;  4YC9 A;  2LGL A;  2G6Q A;  2MD7 B;  2LDR A;  3U5O A;  2CSY A;  2Y1M A;  4ZUX U;  1Z60 A;  2QIZ A;  4WA6 A;  4I7D A;  5LKZ A;  5LKX A;  5B77 A;  5AIU A;  3HTK C;  1FP0 A;  2MA6 A;  3ZVZ B;  2L5U A;  5J3X A;  5JG6 A;  2Y43 A;  2FUI A;  2VPB A;  4GNE A;  1VFY A;  3HCS A;  2Y1N A;  2LQ6 A;  4QF2 A;  4FK5 A;  4V3L C;  3O37 A;  2VJF B;  3C5K A;  4O64 A;  4S3O C;  4A4B A;  2M3H A;  4A49 A;  1G25 A;  1WEP A;  2RI7 A;  5FB0 A;  3T7L A;  2VPG A;  2M1R A;  2H0D A;  2CKL A;  3U5N A;  5AIT A;  1BOR A;  2LGG A;  1WE9 A;  3VK6 A;  5KH3 A;  2LN0 A;  2K1J A;  2CSZ A;  1JM7 B;  2YHN A;  4AVX A;  4WZ2 A;  2XEU A;  1K2F A;  4YBS A;  2DX8 A;  2KWJ A;  3FL2 A;  3RPG C;  2KWN A;  2PUY A;  4YAB A;  2PNX A;  2JMI A;  5DIN A;  4CCG X;  3PUQ A;  3N9Q A;  4LAD B;  2VPD A;  3ZVY A;  4WZ3 B;  2KRE A;  3O33 A;  4MVT A;  4BBQ A;  2ECW A;  2CT2 A;  4GB0 A;  5C11 A;  5KH9 A;  2CKL B;  2H0D B;  2ECN A;  2LXH C;  4FO9 A;  2NAA A;  3M63 A;  2AN6 A;  4GNG A;  1VD4 A;  5H1V A;  1WGM A;  4YAD A; 
#chains in the Genus database with same CATH topology
 3JUE A;  2KGI A;  1WES A;  5FB1 A;  2D8S A;  3V43 A;  3IHP A;  4F52 B;  1DVP A;  2YSJ A;  3T6R A;  3ZTG A;  2FD4 A;  2L80 A;  4L7X A;  5C13 A;  3LVQ E;  3PHD A;  3DWD A;  1F62 A;  4A4C A;  2KWK A;  2K4D A;  2ECV A;  2P57 A;  2C2V S;  4N4F A;  3DQV R;  3DPL R;  4ZDT A;  2OWA A;  5D1L B;  1WEQ A;  2B0O E;  2OXQ C;  2M85 A;  3LJU X;  2MNZ A;  2L43 A;  4IC2 A;  5LCW B;  4UP5 A;  2JM3 A;  4LKA A;  1Z6U A;  3ZPV E;  2C2L A;  1MM2 A;  3SOU A;  2LGV A;  4GND A;  1HYI A;  5B76 A;  2ECJ A;  2K17 A;  2CON A;  2KR4 A;  1IYM A;  4QF3 A;  2CSV A;  4P5O B;  4I7C A;  3LQH A;  4AUQ B;  2MIQ A;  3FM8 C;  3M99 A;  4OGC A;  2LV9 A;  2D8U A;  4XI1 A;  5LKT A;  2M13 A;  5D1M B;  2I50 A;  3M62 A;  3O70 A;  3ZPV 1;  2K16 A;  3GL6 A;  1JOC A;  2YRE A;  2JUN A;  4WZ0 A;  1LDK C;  4R8P K;  4AYC A;  3KV6 A;  5B78 A;  4OGE A;  4GNF A;  4Q6F A;  5TDW A;  3SHB A;  4F1P A;  2G43 A;  1XWH A;  2RSD A;  4YAT A;  3SUB A;  2EGM A;  3NG2 A;  2XOY A;  2UZG A;  2ECT A;  3KNV A;  3LQI A;  5I3L A;  5G0F A;  4IC3 A;  5LKU A;  1Z2Q A;  3E2D A;  3SOX A;  2JRJ A;  1WEM A;  2BAY A;  3N9M A;  1WEE A;  3KDE C;  2KWO A;  4YBT A;  4TKP B;  4I7B A;  4ZQL A;  2MD8 C;  2EA6 A;  4UP0 A;  4V3K C;  5H1U A;  5FEY A;  3KQI A;  2VP7 A;  2FSA A;  2VPE A;  3ASL A;  1WEN A;  2MNY A;  3Q1D A;  3U5M A;  4YBM A;  1RMD A;  3LQJ A;  2HYE D;  2YU4 A;  4R2Y A;  3MHS A;  4FIP A;  2ECI A;  4AP4 A;  3MHH A;  2LGK A;  2L75 A;  1FBV A;  2YQM A;  2QJ0 A;  2JMJ A;  3ZYQ A;  2E6R A;  2KKX A;  2IQJ A;  2XOZ A;  3HCT A;  4AYC B;  1WEU A;  1WIL A;  5TAB A;  3O34 A;  1WEV A;  4X3G A;  1WEW A;  2YHO A;  4W4U A;  2VJE A;  3L11 A;  2EOD A;  3HCU A;  4N3W A;  2YUR A;  2E6S A;  3C6W A;  1WIM A;  2JMD A;  2MT5 A;  2QIC A;  4CA1 A;  2EGP A;  3U5P A;  1U6G B;  2IDA A;  4LJN A;  3FEH A;  4C9Z A;  2LXP C;  2L7P A;  5TBN A;  5DKA A;  1MM3 A;  4FJC A;  2L0B A;  3N9N A;  3EB6 A;  2ECG A;  5H1T A;  2MKE A;  4S3O B;  5TRB A;  2CRR A;  1DCQ A;  4YAX A;  4LK9 A;  4LLB A;  2YQL A;  2M6M A;  3L1Z B;  5K3Q A;  5EYA F;  5G05 B;  1X4U A;  2YVR A;  3O47 A;  4MSX A;  3FJU B;  1WFK A;  3N9L A;  3RTR B;  1V87 A;  2KU3 A;  1WEO A;  3FAN A;  1E4U A;  3I2D A;  3GV4 A;  1X4J A;  5B75 A;  5G04 B;  4BHW A;  3RPG B;  2G45 A;  4PTB A;  2F6N A;  3O36 A;  3QZV A;  3M7K A;  5KH7 A;  2F6J A;  2KYU A;  2YUC A;  4UI9 B;  2XP0 A;  1ZBD B;  1HYJ A;  2VJE B;  3SOW A;  4B86 C;  1T1H A;  5SVI A;  3H7H A;  4A0C D;  2F42 A;  2ZET C;  2KGG A;  3N9P A;  2LRI C;  2FUU A;  2HDP A;  2MUM A;  3DDT A;  5H9M A;  2KFT A;  3EB5 A;  2MA5 A;  2KIZ A;  3N9O A;  1CHC A;  2E61 A;  2YT5 A;  4B7Y C;  2VJF A;  1X4I A;  4PPE A;  4R7E A;  5B8D A;  1LDJ B;  2VNF A;  5TDR A;  5D1K B;  3ZNI A;  3O7A A;  3MDB C;  4NN2 A;  3KV5 A;  3L1X A;  1VYX A;  2YYR A;  5B79 A;  2YW8 A;  3LRQ A;  3PUR A;  2CRW A;  4L58 A;  1N87 A;  2YSM A;  3O35 A;  2KE1 A;  1JM7 A;  5SVY A;  2XB1 A;  5FER A;  4YC9 A;  2EXU A;  2LGL A;  2G6Q A;  2MD7 B;  2LDR A;  3U5O A;  2CSY A;  2Y1M A;  4ZUX U;  1Z60 A;  2QIZ A;  4WA6 A;  4I7D A;  5LKZ A;  5LKX A;  5B77 A;  3HTK C;  5AIU A;  1FP0 A;  2MA6 A;  5SVI B;  2DSM A;  2DJA A;  3ZVZ B;  2L5U A;  5J3X A;  5JG6 A;  2Y43 A;  2KKY A;  2FUI A;  2VPB A;  4GNE A;  1VFY A;  3HCS A;  2Y1N A;  2LQ6 A;  4QF2 A;  4Z0O A;  3T9K A;  3LVR E;  4FK5 A;  4V3L C;  3O37 A;  3FAO A;  2VJF B;  2XOC A;  3C5K A;  4O64 A;  4S3O C;  4A4B A;  2M3H A;  4A49 A;  1G25 A;  1WEP A;  2RI7 A;  5FB0 A;  3T7L A;  2VPG A;  2M1R A;  2CKL A;  2H0D A;  3U5N A;  5AIT A;  1BOR A;  2LGG A;  1WE9 A;  4H9D A;  3VK6 A;  5KH3 A;  2LN0 A;  2K1J A;  2CSZ A;  1JM7 B;  2YHN A;  4AVX A;  2FFW A;  4WZ2 A;  2LAU A;  2XEU A;  1K2F A;  4YBS A;  2DX8 A;  2KWJ A;  4Z0R A;  3FL2 A;  3RPG C;  2KWN A;  2PUY A;  5SVX A;  4YAB A;  2PNX A;  2JMI A;  5DIN A;  4CCG X;  3PUQ A;  3N9Q A;  4LAD B;  2VPD A;  3ZVY A;  2RR4 A;  4WZ3 B;  2KRE A;  3O33 A;  4MVT A;  4BBQ A;  2ECW A;  2CT2 A;  4GB0 A;  5C11 A;  3PLW A;  4O62 A;  5KH9 A;  1MBM A;  2CKL B;  2H0D B;  2ECN A;  2LXH C;  4FO9 A;  2NAA A;  3M63 A;  2AN6 A;  3LDY A;  4GNG A;  1VD4 A;  5H1V A;  4QQ4 A;  1WGM A;  4YAD A; 
#chains in the Genus database with same CATH homology
 2KGI A;  1WES A;  5FB1 A;  2D8S A;  3V43 A;  3IHP A;  4F52 B;  1DVP A;  2YSJ A;  3T6R A;  3ZTG A;  2L80 A;  4L7X A;  5C13 A;  3PHD A;  1F62 A;  4A4C A;  2KWK A;  2K4D A;  2ECV A;  2C2V S;  4N4F A;  3DQV R;  3DPL R;  4ZDT A;  5D1L B;  1WEQ A;  2OXQ C;  2M85 A;  2MNZ A;  2L43 A;  4IC2 A;  5LCW B;  4UP5 A;  4LKA A;  1Z6U A;  3ZPV E;  2C2L A;  1MM2 A;  3SOU A;  2LGV A;  4GND A;  1HYI A;  5B76 A;  2ECJ A;  2K17 A;  2KR4 A;  1IYM A;  4QF3 A;  4P5O B;  4I7C A;  3LQH A;  4AUQ B;  2MIQ A;  3M99 A;  2LV9 A;  4XI1 A;  5LKT A;  5D1M B;  2I50 A;  3M62 A;  3O70 A;  3ZPV 1;  2K16 A;  3GL6 A;  1JOC A;  2YRE A;  4WZ0 A;  1LDK C;  4R8P K;  4AYC A;  3KV6 A;  5B78 A;  4GNF A;  4Q6F A;  5TDW A;  3SHB A;  2G43 A;  1XWH A;  2RSD A;  4YAT A;  3NG2 A;  2UZG A;  2ECT A;  3KNV A;  3LQI A;  5I3L A;  5G0F A;  4IC3 A;  5LKU A;  1Z2Q A;  3SOX A;  2JRJ A;  1WEM A;  2BAY A;  3N9M A;  1WEE A;  2KWO A;  4YBT A;  4TKP B;  4I7B A;  4ZQL A;  2MD8 C;  2EA6 A;  4UP0 A;  4V3K C;  5H1U A;  5FEY A;  3KQI A;  2VP7 A;  2FSA A;  2VPE A;  3ASL A;  1WEN A;  2MNY A;  3U5M A;  4YBM A;  1RMD A;  3LQJ A;  2HYE D;  2YU4 A;  4R2Y A;  3MHS A;  4FIP A;  2ECI A;  4AP4 A;  3MHH A;  2LGK A;  2L75 A;  1FBV A;  2YQM A;  2QJ0 A;  2JMJ A;  3ZYQ A;  2E6R A;  3HCT A;  4AYC B;  1WEU A;  1WIL A;  5TAB A;  3O34 A;  1WEV A;  4X3G A;  1WEW A;  2YHO A;  4W4U A;  2VJE A;  3L11 A;  2EOD A;  3HCU A;  4N3W A;  2YUR A;  2E6S A;  3C6W A;  1WIM A;  2JMD A;  2MT5 A;  2QIC A;  4CA1 A;  2EGP A;  3U5P A;  1U6G B;  2IDA A;  4LJN A;  4C9Z A;  2LXP C;  5TBN A;  5DKA A;  1MM3 A;  2L0B A;  4FJC A;  3N9N A;  3EB6 A;  2ECG A;  5H1T A;  4S3O B;  5TRB A;  4YAX A;  4LK9 A;  4LLB A;  2YQL A;  2M6M A;  3L1Z B;  5EYA F;  5G05 B;  1X4U A;  4MSX A;  1WFK A;  3RTR B;  3N9L A;  1V87 A;  2KU3 A;  1WEO A;  1E4U A;  3I2D A;  3GV4 A;  1X4J A;  5B75 A;  5G04 B;  4BHW A;  3RPG B;  2G45 A;  4PTB A;  2F6N A;  3O36 A;  3QZV A;  5KH7 A;  2F6J A;  2KYU A;  2YUC A;  4UI9 B;  1ZBD B;  1HYJ A;  2VJE B;  3SOW A;  4B86 C;  1T1H A;  4A0C D;  2F42 A;  2ZET C;  2KGG A;  3N9P A;  2LRI C;  2FUU A;  2HDP A;  2MUM A;  5H9M A;  2KFT A;  3EB5 A;  2MA5 A;  2KIZ A;  3N9O A;  1CHC A;  2YT5 A;  4B7Y C;  2VJF A;  1X4I A;  4PPE A;  4R7E A;  5B8D A;  1LDJ B;  2VNF A;  5TDR A;  5D1K B;  3ZNI A;  3O7A A;  4NN2 A;  3KV5 A;  3L1X A;  1VYX A;  2YYR A;  5B79 A;  2YW8 A;  3LRQ A;  3PUR A;  4L58 A;  1N87 A;  2YSM A;  3O35 A;  2KE1 A;  1JM7 A;  2XB1 A;  5FER A;  4YC9 A;  2LGL A;  2G6Q A;  2MD7 B;  2LDR A;  3U5O A;  2CSY A;  2Y1M A;  4ZUX U;  1Z60 A;  2QIZ A;  4WA6 A;  4I7D A;  5LKZ A;  5LKX A;  5B77 A;  5AIU A;  3HTK C;  1FP0 A;  2MA6 A;  3ZVZ B;  2L5U A;  5J3X A;  5JG6 A;  2Y43 A;  2FUI A;  2VPB A;  4GNE A;  1VFY A;  3HCS A;  2Y1N A;  2LQ6 A;  4QF2 A;  4FK5 A;  4V3L C;  3O37 A;  2VJF B;  3C5K A;  4O64 A;  4S3O C;  4A4B A;  2M3H A;  4A49 A;  1G25 A;  1WEP A;  2RI7 A;  5FB0 A;  3T7L A;  2VPG A;  2M1R A;  2H0D A;  2CKL A;  3U5N A;  5AIT A;  1BOR A;  2LGG A;  1WE9 A;  3VK6 A;  5KH3 A;  2LN0 A;  2K1J A;  2CSZ A;  1JM7 B;  2YHN A;  4AVX A;  4WZ2 A;  2XEU A;  1K2F A;  4YBS A;  2DX8 A;  2KWJ A;  3FL2 A;  3RPG C;  2KWN A;  2PUY A;  4YAB A;  2PNX A;  2JMI A;  5DIN A;  4CCG X;  3PUQ A;  3N9Q A;  4LAD B;  2VPD A;  3ZVY A;  4WZ3 B;  2KRE A;  3O33 A;  4MVT A;  4BBQ A;  2ECW A;  2CT2 A;  4GB0 A;  5C11 A;  5KH9 A;  2CKL B;  2H0D B;  2ECN A;  2LXH C;  4FO9 A;  2NAA A;  3M63 A;  2AN6 A;  4GNG A;  1VD4 A;  5H1V A;  1WGM A;  4YAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...