5TDWA

Set3 phd finger in complex with histone h3k4me3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
GIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET domain-containing protein 3
publication title Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transcription
total genus 23
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tdwA00
1BORA 1Z2QA 2VPEA 3C5KA 4GB0A 2I50A 3EB5A 2CSYA 4R8PK 2KGIA 2D8SA 2ECGA 2YHOA 3M62A 3IHPA 4YABA 3ZPVE 4GNDA 3ZTGA 2LV9A 5TRBA 1WEWA 1FBVA 2XEUA 5AIUA 1X4UA 4N4FA 2ECNA 2F6NA 4LADB 4A4CA 2YUCA 5DKAA 2VP7A 2KGGA 2K16A 4P5OB 5KH7A 2BAYA 3GL6A 3DQVR 2EGPA 2VJFB 1RMDA 2QIZA 3ZVYA 3HCTA 1WEEA 2M3HA 1VYXA 2VPBA 5B77A 2MIQA 2RSDA 2MA6A 1JM7A 4LKAA 3U5PA 2YHNA 3O34A 3C6WA 1WEPA 4CA1A 1IYMA 3ZVZB 2LGVA 3NG2A 2L43A 1Z60A 2G43A 2YSJA 2HDPA 2H0DB 4AYCB 1U6GB 2F42A 3U5OA 3U5NA 5B76A 3N9LA 3U5MA 4YAXA 4XI1A 4R2YA 4YATA 4A4BA 2DX8A 1VFYA 4YADA 4L58A 2LXPC 2L5UA 4LLBA 4TKPB 2KYUA 2YREA 4O64A 4V3LC 2ECJA 5D1MB 3ZNIA 2CKLA 4QF3A 3KV6A 5G04B 1WFKA 3O37A 3SOWA 4MSXA 4C9ZA 2M1RA 2MA5A 2NAAA 4YBTA 5H1TA 1N87A 5TDRA 1HYJA 2YQMA 2K17A 5G05B 5C11A 1WILA 4WZ3B 2PUYA 2YT5A 3KQIA 4AVXA 5LKZA 4N3WA 3LRQA 4ZDTA 4CCGX 4UI9B 2KE1A 2HYED 2Y43A 3GV4A 2QJ0A 3N9MA 2MT5A 3O70A 4FIPA 2LQ6A 3ZPV1 3LQIA 3V43A 2JMDA 5LKTA 3M99A 1WEMA 5D1LB 4YBMA 2Y1MA 1X4IA 3SOUA 4QF2A 3LQHA 1X4JA 4IC3A 2VJEA 2E6SA 4I7BA 2KWKA 5G0FA 3O7AA 3HCSA 2LRIC 4Q6FA 5TDWA 4B7YC 4FK5A 1CHCA 1LDKC 2K4DA 1Z6UA 2M85A 2ECWA 1MM2A 3KNVA 2ECTA 2FSAA 4ZQLA 3MHSA 2RI7A 2G6QA 3PHDA 3VK6A 2L75A 3PUQA 4GNEA 2MUMA 3ZYQA 2AN6A 4I7DA 4YBSA 4WZ0A 2C2VS 1MM3A 2ECVA 4FO9A 3HTKC 3O36A 2IDAA 1VD4A 1WE9A 3FL2A 2UZGA 2VPGA 1ZBDB 3N9QA 5AITA 1WIMA 4IC2A 4BHWA 4A0CD 2EODA 2YURA 4V3KC 2LDRA 5LCWB 3L11A 2EA6A 1JM7B 3L1XA 2YQLA 5KH3A 3RTRB 3T7LA 3N9NA 5DINA 2LGGA 2JRJA 4GNFA 2OXQC 5KH9A 1WESA 2KIZA 2E6RA 4FJCA 2VJFA 5H1UA 4S3OC 4LK9A 1WEQA 2FUIA 1K2FA 4WZ2A 2LGKA 5H9MA 4MVTA 5LKUA 2KU3A 5JG6A 5TBNA 1JOCA 2ECIA 3KV5A 3O33A 4ZUXU 3LQJA 4WA6A 5FEYA 2KWJA 1HYIA 1FP0A 2CKLB 5B8DA 4L7XA 2KWNA 2LN0A 2G45A 4UP5A 1WENA 2L80A 2M6MA 3N9PA 2MNYA 2YYRA 2JMJA 5FB1A 1LDJB 3T6RA 4I7CA 1WEUA 2H0DA 3N9OA 4AYCA 1F62A 1WEOA 4F52B 5FERA 4NN2A 1WGMA 2K1JA 2KR4A 1G25A 1E4UA 5C13A 2VPDA 5H1VA 2KREA 2MD7B 4A49A 2ZETC 3SOXA 3PURA 2LGLA 3RPGC 2Y1NA 3MHHA 5TABA 2JMIA 4S3OB 2MNZA 4AUQB 5EYAF 3O35A 2FUUA 3SHBA 2XB1A 2YU4A 4PTBA 5B78A 2CT2A 2YW8A 2VJEB 1DVPA 2KWOA 4AP4A 4BBQA 2VNFA 4LJNA 5D1KB 5FB0A 3EB6A 5I3LA 5B79A 1T1HA 2C2LA 4B86C 4PPEA 3M63A 2LXHC 3ASLA 3L1ZB 1WEVA 2CSZA 3DPLR 3I2DA 2YSMA 5J3XA 2L0BA 4GNGA 2PNXA 4R7EA 3RPGB 5B75A 1V87A 2MD8C 4UP0A 5LKXA 3QZVA 2KFTA 4W4UA 2QICA 4YC9A 1XWHA 3HCUA 2F6JA 4X3GA
chains in the Genus database with same CATH superfamily
1BORA 1Z2QA 2VPEA 2KKYA 2LAUA 3C5KA 4GB0A 2I50A 3EB5A 2CSYA 4R8PK 2KGIA 2D8SA 2ECGA 2YHOA 3FM8C 3M62A 3IHPA 4YABA 3ZPVE 2XOZA 4GNDA 3ZTGA 2M13A 3M7KA 2YVRA 4QQ4A 2LV9A 5TRBA 1WEWA 1FBVA 2XEUA 5AIUA 1X4UA 4N4FA 2ECNA 2F6NA 4F1PA 4LADB 4A4CA 2YUCA 5DKAA 2VP7A 2KGGA 2K16A 4P5OB 5KH7A 2BAYA 3GL6A 3DQVR 4H9DA 3LJUX 2EGPA 2VJFB 1RMDA 2QIZA 3ZVYA 1MBMA 3HCTA 1WEEA 2M3HA 1VYXA 2VPBA 5B77A 2MIQA 2RSDA 2MA6A 1JM7A 4LKAA 3U5PA 2YHNA 3O34A 3C6WA 1WEPA 4CA1A 1IYMA 3ZVZB 2LGVA 3NG2A 2L43A 1Z60A 2G43A 2YSJA 2HDPA 2H0DB 4AYCB 1U6GB 2F42A 3U5OA 3U5NA 5B76A 3N9LA 3U5MA 4YAXA 4XI1A 4R2YA 2B0OE 4YATA 4A4BA 2DX8A 1VFYA 2JUNA 4YADA 4L58A 2LXPC 2L5UA 2KKXA 4LLBA 4TKPB 2KYUA 2YREA 4O64A 4V3LC 2FFWA 2CONA 2ECJA 5D1MB 3ZNIA 2CKLA 4QF3A 3KV6A 1DCQA 5G04B 1WFKA 3O37A 3SOWA 4MSXA 4C9ZA 2M1RA 2MA5A 2NAAA 4YBTA 5H1TA 1N87A 5TDRA 1HYJA 3FANA 2YQMA 2K17A 5G05B 2OWAA 5C11A 1WILA 4WZ3B 2PUYA 2YT5A 3KQIA 4AVXA 5LKZA 4N3WA 3LRQA 3MDBC 4ZDTA 2CRWA 4CCGX 4UI9B 3LDYA 2KE1A 2HYED 2Y43A 3GV4A 2QJ0A 3N9MA 2MT5A 2DSMA 3O70A 4FIPA 2LQ6A 3ZPV1 4Z0OA 3LQIA 3V43A 2IQJA 2JMDA 2L7PA 2MKEA 5LKTA 3M99A 1WEMA 5D1LB 4YBMA 2Y1MA 5SVIB 1X4IA 3SOUA 4QF2A 3LQHA 1X4JA 2CRRA 4IC3A 2VJEA 2E6SA 4I7BA 4OGCA 2KWKA 5G0FA 3O7AA 3HCSA 2LRIC 4Q6FA 2E61A 5TDWA 4B7YC 4FK5A 1CHCA 1LDKC 2K4DA 1Z6UA 3LVQE 2M85A 2ECWA 1MM2A 3FEHA 4Z0RA 3KNVA 2ECTA 2FSAA 4ZQLA 3MHSA 2RI7A 2G6QA 3PHDA 3VK6A 2L75A 3E2DA 3PUQA 3JUEA 4GNEA 2EGMA 2MUMA 3ZYQA 2AN6A 4I7DA 4YBSA 4WZ0A 2C2VS 1MM3A 3LVRE 2ECVA 4FO9A 3HTKC 3O36A 2IDAA 1VD4A 1WE9A 3FL2A 2UZGA 3H7HA 2VPGA 1ZBDB 3N9QA 3FJUB 5AITA 1WIMA 4IC2A 4BHWA 4A0CD 2EODA 2YURA 4V3KC 2LDRA 2P57A 5LCWB 3L11A 2EA6A 1JM7B 3L1XA 5K3QA 2YQLA 5KH3A 3RTRB 5SVXA 3KDEC 3T7LA 3N9NA 5DINA 2LGGA 2JRJA 3DWDA 4GNFA 2OXQC 2CSVA 5KH9A 1WESA 2KIZA 2E6RA 4FJCA 2VJFA 5H1UA 4S3OC 2D8UA 4LK9A 1WEQA 4OGEA 3DDTA 2FUIA 2XP0A 1K2FA 4WZ2A 2LGKA 5H9MA 4MVTA 5LKUA 2KU3A 5JG6A 5TBNA 1JOCA 2ECIA 3KV5A 3O33A 4ZUXU 3LQJA 4WA6A 5FEYA 3PLWA 2KWJA 1HYIA 1FP0A 2CKLB 5B8DA 4L7XA 2KWNA 2LN0A 2G45A 4UP5A 2EXUA 1WENA 2L80A 2JM3A 2M6MA 3N9PA 2MNYA 2YYRA 2JMJA 5FB1A 1LDJB 3T6RA 4I7CA 1WEUA 2H0DA 3N9OA 4AYCA 1F62A 1WEOA 4F52B 5FERA 4NN2A 1WGMA 2K1JA 2KR4A 1G25A 2RR4A 1E4UA 5C13A 2VPDA 5H1VA 2KREA 2MD7B 5SVYA 4A49A 2ZETC 3SOXA 3PURA 2LGLA 3RPGC 2Y1NA 3MHHA 5TABA 2JMIA 4S3OB 2MNZA 4AUQB 2DJAA 5EYAF 2XOYA 3O35A 2FUUA 3Q1DA 3SHBA 2XB1A 2YU4A 3T9KA 4PTBA 5B78A 2CT2A 2YW8A 2VJEB 1DVPA 2KWOA 4AP4A 4BBQA 2VNFA 4LJNA 5D1KB 5FB0A 3EB6A 5I3LA 5B79A 1T1HA 2C2LA 4B86C 4PPEA 3M63A 2XOCA 2LXHC 3ASLA 3L1ZB 1WEVA 2CSZA 3O47A 3DPLR 3I2DA 3SUBA 2FD4A 2YSMA 5J3XA 2L0BA 4GNGA 4O62A 2PNXA 4R7EA 3RPGB 5B75A 1V87A 2MD8C 5SVIA 4UP0A 3FAOA 5LKXA 3QZVA 2KFTA 4W4UA 2QICA 4YC9A 1XWHA 3HCUA 2F6JA 4X3GA
chains in the Genus database with same CATH topology
1BORA 1Z2QA 2VPEA 3C5KA 4GB0A 2I50A 3EB5A 2CSYA 4R8PK 2KGIA 2D8SA 2ECGA 2YHOA 3M62A 3IHPA 4YABA 3ZPVE 4GNDA 3ZTGA 2LV9A 5TRBA 1WEWA 1FBVA 2XEUA 5AIUA 1X4UA 4N4FA 2ECNA 2F6NA 4LADB 4A4CA 2YUCA 5DKAA 2VP7A 2KGGA 2K16A 4P5OB 5KH7A 2BAYA 3GL6A 3DQVR 2EGPA 2VJFB 1RMDA 2QIZA 3ZVYA 3HCTA 1WEEA 2M3HA 1VYXA 2VPBA 5B77A 2MIQA 2RSDA 2MA6A 1JM7A 4LKAA 3U5PA 2YHNA 3O34A 3C6WA 1WEPA 4CA1A 1IYMA 3ZVZB 2LGVA 3NG2A 2L43A 1Z60A 2G43A 2YSJA 2HDPA 2H0DB 4AYCB 1U6GB 2F42A 3U5OA 3U5NA 5B76A 3N9LA 3U5MA 4YAXA 4XI1A 4R2YA 4YATA 4A4BA 2DX8A 1VFYA 4YADA 4L58A 2LXPC 2L5UA 4LLBA 4TKPB 2KYUA 2YREA 4O64A 4V3LC 2ECJA 5D1MB 3ZNIA 2CKLA 4QF3A 3KV6A 5G04B 1WFKA 3O37A 3SOWA 4MSXA 4C9ZA 2M1RA 2MA5A 2NAAA 4YBTA 5H1TA 1N87A 5TDRA 1HYJA 2YQMA 2K17A 5G05B 5C11A 1WILA 4WZ3B 2PUYA 2YT5A 3KQIA 4AVXA 5LKZA 4N3WA 3LRQA 4ZDTA 4CCGX 4UI9B 2KE1A 2HYED 2Y43A 3GV4A 2QJ0A 3N9MA 2MT5A 3O70A 4FIPA 2LQ6A 3ZPV1 3LQIA 3V43A 2JMDA 5LKTA 3M99A 1WEMA 5D1LB 4YBMA 2Y1MA 1X4IA 3SOUA 4QF2A 3LQHA 1X4JA 4IC3A 2VJEA 2E6SA 4I7BA 2KWKA 5G0FA 3O7AA 3HCSA 2LRIC 4Q6FA 5TDWA 4B7YC 4FK5A 1CHCA 1LDKC 2K4DA 1Z6UA 2M85A 2ECWA 1MM2A 3KNVA 2ECTA 2FSAA 4ZQLA 3MHSA 2RI7A 2G6QA 3PHDA 3VK6A 2L75A 3PUQA 4GNEA 2MUMA 3ZYQA 2AN6A 4I7DA 4YBSA 4WZ0A 2C2VS 1MM3A 2ECVA 4FO9A 3HTKC 3O36A 2IDAA 1VD4A 1WE9A 3FL2A 2UZGA 2VPGA 1ZBDB 3N9QA 5AITA 1WIMA 4IC2A 4BHWA 4A0CD 2EODA 2YURA 4V3KC 2LDRA 5LCWB 3L11A 2EA6A 1JM7B 3L1XA 2YQLA 5KH3A 3RTRB 3T7LA 3N9NA 5DINA 2LGGA 2JRJA 4GNFA 2OXQC 5KH9A 1WESA 2KIZA 2E6RA 4FJCA 2VJFA 5H1UA 4S3OC 4LK9A 1WEQA 2FUIA 1K2FA 4WZ2A 2LGKA 5H9MA 4MVTA 5LKUA 2KU3A 5JG6A 5TBNA 1JOCA 2ECIA 3KV5A 3O33A 4ZUXU 3LQJA 4WA6A 5FEYA 2KWJA 1HYIA 1FP0A 2CKLB 5B8DA 4L7XA 2KWNA 2LN0A 2G45A 4UP5A 1WENA 2L80A 2M6MA 3N9PA 2MNYA 2YYRA 2JMJA 5FB1A 1LDJB 3T6RA 4I7CA 1WEUA 2H0DA 3N9OA 4AYCA 1F62A 1WEOA 4F52B 5FERA 4NN2A 1WGMA 2K1JA 2KR4A 1G25A 1E4UA 5C13A 2VPDA 5H1VA 2KREA 2MD7B 4A49A 2ZETC 3SOXA 3PURA 2LGLA 3RPGC 2Y1NA 3MHHA 5TABA 2JMIA 4S3OB 2MNZA 4AUQB 5EYAF 3O35A 2FUUA 3SHBA 2XB1A 2YU4A 4PTBA 5B78A 2CT2A 2YW8A 2VJEB 1DVPA 2KWOA 4AP4A 4BBQA 2VNFA 4LJNA 5D1KB 5FB0A 3EB6A 5I3LA 5B79A 1T1HA 2C2LA 4B86C 4PPEA 3M63A 2LXHC 3ASLA 3L1ZB 1WEVA 2CSZA 3DPLR 3I2DA 2YSMA 5J3XA 2L0BA 4GNGA 2PNXA 4R7EA 3RPGB 5B75A 1V87A 2MD8C 4UP0A 5LKXA 3QZVA 2KFTA 4W4UA 2QICA 4YC9A 1XWHA 3HCUA 2F6JA 4X3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOR A;  1Z2Q A;  2VPE A;  3C5K A;  4GB0 A;  2I50 A;  3EB5 A;  2CSY A;  4R8P K;  2KGI A;  2D8S A;  2ECG A;  2YHO A;  3M62 A;  3IHP A;  4YAB A;  3ZPV E;  4GND A;  3ZTG A;  2LV9 A;  5TRB A;  1WEW A;  1FBV A;  2XEU A;  5AIU A;  1X4U A;  4N4F A;  2ECN A;  2F6N A;  4LAD B;  4A4C A;  2YUC A;  5DKA A;  2VP7 A;  2KGG A;  2K16 A;  4P5O B;  5KH7 A;  2BAY A;  3GL6 A;  3DQV R;  2EGP A;  2VJF B;  1RMD A;  2QIZ A;  3ZVY A;  3HCT A;  1WEE A;  2M3H A;  1VYX A;  2VPB A;  5B77 A;  2MIQ A;  2RSD A;  2MA6 A;  1JM7 A;  4LKA A;  3U5P A;  2YHN A;  3O34 A;  3C6W A;  1WEP A;  4CA1 A;  1IYM A;  3ZVZ B;  2LGV A;  3NG2 A;  2L43 A;  1Z60 A;  2G43 A;  2YSJ A;  2HDP A;  2H0D B;  4AYC B;  1U6G B;  2F42 A;  3U5O A;  3U5N A;  5B76 A;  3N9L A;  3U5M A;  4YAX A;  4XI1 A;  4R2Y A;  4YAT A;  4A4B A;  2DX8 A;  1VFY A;  4YAD A;  4L58 A;  2LXP C;  2L5U A;  4LLB A;  4TKP B;  2KYU A;  2YRE A;  4O64 A;  4V3L C;  2ECJ A;  5D1M B;  3ZNI A;  2CKL A;  4QF3 A;  3KV6 A;  5G04 B;  1WFK A;  3O37 A;  3SOW A;  4MSX A;  4C9Z A;  2M1R A;  2MA5 A;  2NAA A;  4YBT A;  5H1T A;  1N87 A;  5TDR A;  1HYJ A;  2YQM A;  2K17 A;  5G05 B;  5C11 A;  1WIL A;  4WZ3 B;  2PUY A;  2YT5 A;  3KQI A;  4AVX A;  5LKZ A;  4N3W A;  3LRQ A;  4ZDT A;  4CCG X;  4UI9 B;  2KE1 A;  2HYE D;  2Y43 A;  3GV4 A;  2QJ0 A;  3N9M A;  2MT5 A;  3O70 A;  4FIP A;  2LQ6 A;  3ZPV 1;  3LQI A;  3V43 A;  2JMD A;  5LKT A;  3M99 A;  1WEM A;  5D1L B;  4YBM A;  2Y1M A;  1X4I A;  3SOU A;  4QF2 A;  3LQH A;  1X4J A;  4IC3 A;  2VJE A;  2E6S A;  4I7B A;  2KWK A;  5G0F A;  3O7A A;  3HCS A;  2LRI C;  4Q6F A;  5TDW A;  4B7Y C;  4FK5 A;  1CHC A;  1LDK C;  2K4D A;  1Z6U A;  2M85 A;  2ECW A;  1MM2 A;  3KNV A;  2ECT A;  2FSA A;  4ZQL A;  3MHS A;  2RI7 A;  2G6Q A;  3PHD A;  3VK6 A;  2L75 A;  3PUQ A;  4GNE A;  2MUM A;  3ZYQ A;  2AN6 A;  4I7D A;  4YBS A;  4WZ0 A;  2C2V S;  1MM3 A;  2ECV A;  4FO9 A;  3HTK C;  3O36 A;  2IDA A;  1VD4 A;  1WE9 A;  3FL2 A;  2UZG A;  2VPG A;  1ZBD B;  3N9Q A;  5AIT A;  1WIM A;  4IC2 A;  4BHW A;  4A0C D;  2EOD A;  2YUR A;  4V3K C;  2LDR A;  5LCW B;  3L11 A;  2EA6 A;  1JM7 B;  3L1X A;  2YQL A;  5KH3 A;  3RTR B;  3T7L A;  3N9N A;  5DIN A;  2LGG A;  2JRJ A;  4GNF A;  2OXQ C;  5KH9 A;  1WES A;  2KIZ A;  2E6R A;  4FJC A;  2VJF A;  5H1U A;  4S3O C;  4LK9 A;  1WEQ A;  2FUI A;  1K2F A;  4WZ2 A;  2LGK A;  5H9M A;  4MVT A;  5LKU A;  2KU3 A;  5JG6 A;  5TBN A;  1JOC A;  2ECI A;  3KV5 A;  3O33 A;  4ZUX U;  3LQJ A;  4WA6 A;  5FEY A;  2KWJ A;  1HYI A;  1FP0 A;  2CKL B;  5B8D A;  4L7X A;  2KWN A;  2LN0 A;  2G45 A;  4UP5 A;  1WEN A;  2L80 A;  2M6M A;  3N9P A;  2MNY A;  2YYR A;  2JMJ A;  5FB1 A;  1LDJ B;  3T6R A;  4I7C A;  1WEU A;  2H0D A;  3N9O A;  4AYC A;  1F62 A;  1WEO A;  4F52 B;  5FER A;  4NN2 A;  1WGM A;  2K1J A;  2KR4 A;  1G25 A;  1E4U A;  5C13 A;  2VPD A;  5H1V A;  2KRE A;  2MD7 B;  4A49 A;  2ZET C;  3SOX A;  3PUR A;  2LGL A;  3RPG C;  2Y1N A;  3MHH A;  5TAB A;  2JMI A;  4S3O B;  2MNZ A;  4AUQ B;  5EYA F;  3O35 A;  2FUU A;  3SHB A;  2XB1 A;  2YU4 A;  4PTB A;  5B78 A;  2CT2 A;  2YW8 A;  2VJE B;  1DVP A;  2KWO A;  4AP4 A;  4BBQ A;  2VNF A;  4LJN A;  5D1K B;  5FB0 A;  3EB6 A;  5I3L A;  5B79 A;  1T1H A;  2C2L A;  4B86 C;  4PPE A;  3M63 A;  2LXH C;  3ASL A;  3L1Z B;  1WEV A;  2CSZ A;  3DPL R;  3I2D A;  2YSM A;  5J3X A;  2L0B A;  4GNG A;  2PNX A;  4R7E A;  3RPG B;  5B75 A;  1V87 A;  2MD8 C;  4UP0 A;  5LKX A;  3QZV A;  2KFT A;  4W4U A;  2QIC A;  4YC9 A;  1XWH A;  3HCU A;  2F6J A;  4X3G A; 
#chains in the Genus database with same CATH topology
 1BOR A;  1Z2Q A;  2VPE A;  2KKY A;  2LAU A;  3C5K A;  4GB0 A;  2I50 A;  3EB5 A;  2CSY A;  4R8P K;  2KGI A;  2D8S A;  2ECG A;  2YHO A;  3FM8 C;  3M62 A;  3IHP A;  4YAB A;  3ZPV E;  2XOZ A;  4GND A;  3ZTG A;  2M13 A;  3M7K A;  2YVR A;  4QQ4 A;  2LV9 A;  5TRB A;  1WEW A;  1FBV A;  2XEU A;  5AIU A;  1X4U A;  4N4F A;  2ECN A;  2F6N A;  4F1P A;  4LAD B;  4A4C A;  2YUC A;  5DKA A;  2VP7 A;  2KGG A;  2K16 A;  4P5O B;  5KH7 A;  2BAY A;  3GL6 A;  3DQV R;  4H9D A;  3LJU X;  2EGP A;  2VJF B;  1RMD A;  2QIZ A;  3ZVY A;  1MBM A;  3HCT A;  1WEE A;  2M3H A;  1VYX A;  2VPB A;  5B77 A;  2MIQ A;  2RSD A;  2MA6 A;  1JM7 A;  4LKA A;  3U5P A;  2YHN A;  3O34 A;  3C6W A;  1WEP A;  4CA1 A;  1IYM A;  3ZVZ B;  2LGV A;  3NG2 A;  2L43 A;  1Z60 A;  2G43 A;  2YSJ A;  2HDP A;  2H0D B;  4AYC B;  1U6G B;  2F42 A;  3U5O A;  3U5N A;  5B76 A;  3N9L A;  3U5M A;  4YAX A;  4XI1 A;  4R2Y A;  2B0O E;  4YAT A;  4A4B A;  2DX8 A;  1VFY A;  2JUN A;  4YAD A;  4L58 A;  2LXP C;  2L5U A;  2KKX A;  4LLB A;  4TKP B;  2KYU A;  2YRE A;  4O64 A;  4V3L C;  2FFW A;  2CON A;  2ECJ A;  5D1M B;  3ZNI A;  2CKL A;  4QF3 A;  3KV6 A;  1DCQ A;  5G04 B;  1WFK A;  3O37 A;  3SOW A;  4MSX A;  4C9Z A;  2M1R A;  2MA5 A;  2NAA A;  4YBT A;  5H1T A;  1N87 A;  5TDR A;  1HYJ A;  3FAN A;  2YQM A;  2K17 A;  5G05 B;  2OWA A;  5C11 A;  1WIL A;  4WZ3 B;  2PUY A;  2YT5 A;  3KQI A;  4AVX A;  5LKZ A;  4N3W A;  3LRQ A;  3MDB C;  4ZDT A;  2CRW A;  4CCG X;  4UI9 B;  3LDY A;  2KE1 A;  2HYE D;  2Y43 A;  3GV4 A;  2QJ0 A;  3N9M A;  2MT5 A;  2DSM A;  3O70 A;  4FIP A;  2LQ6 A;  3ZPV 1;  4Z0O A;  3LQI A;  3V43 A;  2IQJ A;  2JMD A;  2L7P A;  2MKE A;  5LKT A;  3M99 A;  1WEM A;  5D1L B;  4YBM A;  2Y1M A;  5SVI B;  1X4I A;  3SOU A;  4QF2 A;  3LQH A;  1X4J A;  2CRR A;  4IC3 A;  2VJE A;  2E6S A;  4I7B A;  4OGC A;  2KWK A;  5G0F A;  3O7A A;  3HCS A;  2LRI C;  4Q6F A;  2E61 A;  5TDW A;  4B7Y C;  4FK5 A;  1CHC A;  1LDK C;  2K4D A;  1Z6U A;  3LVQ E;  2M85 A;  2ECW A;  1MM2 A;  3FEH A;  4Z0R A;  3KNV A;  2ECT A;  2FSA A;  4ZQL A;  3MHS A;  2RI7 A;  2G6Q A;  3PHD A;  3VK6 A;  2L75 A;  3E2D A;  3PUQ A;  3JUE A;  4GNE A;  2EGM A;  2MUM A;  3ZYQ A;  2AN6 A;  4I7D A;  4YBS A;  4WZ0 A;  2C2V S;  1MM3 A;  3LVR E;  2ECV A;  4FO9 A;  3HTK C;  3O36 A;  2IDA A;  1VD4 A;  1WE9 A;  3FL2 A;  2UZG A;  3H7H A;  2VPG A;  1ZBD B;  3N9Q A;  3FJU B;  5AIT A;  1WIM A;  4IC2 A;  4BHW A;  4A0C D;  2EOD A;  2YUR A;  4V3K C;  2LDR A;  2P57 A;  5LCW B;  3L11 A;  2EA6 A;  1JM7 B;  3L1X A;  5K3Q A;  2YQL A;  5KH3 A;  3RTR B;  5SVX A;  3KDE C;  3T7L A;  3N9N A;  5DIN A;  2LGG A;  2JRJ A;  3DWD A;  4GNF A;  2OXQ C;  2CSV A;  5KH9 A;  1WES A;  2KIZ A;  2E6R A;  4FJC A;  2VJF A;  5H1U A;  4S3O C;  2D8U A;  4LK9 A;  1WEQ A;  4OGE A;  3DDT A;  2FUI A;  2XP0 A;  1K2F A;  4WZ2 A;  2LGK A;  5H9M A;  4MVT A;  5LKU A;  2KU3 A;  5JG6 A;  5TBN A;  1JOC A;  2ECI A;  3KV5 A;  3O33 A;  4ZUX U;  3LQJ A;  4WA6 A;  5FEY A;  3PLW A;  2KWJ A;  1HYI A;  1FP0 A;  2CKL B;  5B8D A;  4L7X A;  2KWN A;  2LN0 A;  2G45 A;  4UP5 A;  2EXU A;  1WEN A;  2L80 A;  2JM3 A;  2M6M A;  3N9P A;  2MNY A;  2YYR A;  2JMJ A;  5FB1 A;  1LDJ B;  3T6R A;  4I7C A;  1WEU A;  2H0D A;  3N9O A;  4AYC A;  1F62 A;  1WEO A;  4F52 B;  5FER A;  4NN2 A;  1WGM A;  2K1J A;  2KR4 A;  1G25 A;  2RR4 A;  1E4U A;  5C13 A;  2VPD A;  5H1V A;  2KRE A;  2MD7 B;  5SVY A;  4A49 A;  2ZET C;  3SOX A;  3PUR A;  2LGL A;  3RPG C;  2Y1N A;  3MHH A;  5TAB A;  2JMI A;  4S3O B;  2MNZ A;  4AUQ B;  2DJA A;  5EYA F;  2XOY A;  3O35 A;  2FUU A;  3Q1D A;  3SHB A;  2XB1 A;  2YU4 A;  3T9K A;  4PTB A;  5B78 A;  2CT2 A;  2YW8 A;  2VJE B;  1DVP A;  2KWO A;  4AP4 A;  4BBQ A;  2VNF A;  4LJN A;  5D1K B;  5FB0 A;  3EB6 A;  5I3L A;  5B79 A;  1T1H A;  2C2L A;  4B86 C;  4PPE A;  3M63 A;  2XOC A;  2LXH C;  3ASL A;  3L1Z B;  1WEV A;  2CSZ A;  3O47 A;  3DPL R;  3I2D A;  3SUB A;  2FD4 A;  2YSM A;  5J3X A;  2L0B A;  4GNG A;  4O62 A;  2PNX A;  4R7E A;  3RPG B;  5B75 A;  1V87 A;  2MD8 C;  5SVI A;  4UP0 A;  3FAO A;  5LKX A;  3QZV A;  2KFT A;  4W4U A;  2QIC A;  4YC9 A;  1XWH A;  3HCU A;  2F6J A;  4X3G A; 
#chains in the Genus database with same CATH homology
 1BOR A;  1Z2Q A;  2VPE A;  3C5K A;  4GB0 A;  2I50 A;  3EB5 A;  2CSY A;  4R8P K;  2KGI A;  2D8S A;  2ECG A;  2YHO A;  3M62 A;  3IHP A;  4YAB A;  3ZPV E;  4GND A;  3ZTG A;  2LV9 A;  5TRB A;  1WEW A;  1FBV A;  2XEU A;  5AIU A;  1X4U A;  4N4F A;  2ECN A;  2F6N A;  4LAD B;  4A4C A;  2YUC A;  5DKA A;  2VP7 A;  2KGG A;  2K16 A;  4P5O B;  5KH7 A;  2BAY A;  3GL6 A;  3DQV R;  2EGP A;  2VJF B;  1RMD A;  2QIZ A;  3ZVY A;  3HCT A;  1WEE A;  2M3H A;  1VYX A;  2VPB A;  5B77 A;  2MIQ A;  2RSD A;  2MA6 A;  1JM7 A;  4LKA A;  3U5P A;  2YHN A;  3O34 A;  3C6W A;  1WEP A;  4CA1 A;  1IYM A;  3ZVZ B;  2LGV A;  3NG2 A;  2L43 A;  1Z60 A;  2G43 A;  2YSJ A;  2HDP A;  2H0D B;  4AYC B;  1U6G B;  2F42 A;  3U5O A;  3U5N A;  5B76 A;  3N9L A;  3U5M A;  4YAX A;  4XI1 A;  4R2Y A;  4YAT A;  4A4B A;  2DX8 A;  1VFY A;  4YAD A;  4L58 A;  2LXP C;  2L5U A;  4LLB A;  4TKP B;  2KYU A;  2YRE A;  4O64 A;  4V3L C;  2ECJ A;  5D1M B;  3ZNI A;  2CKL A;  4QF3 A;  3KV6 A;  5G04 B;  1WFK A;  3O37 A;  3SOW A;  4MSX A;  4C9Z A;  2M1R A;  2MA5 A;  2NAA A;  4YBT A;  5H1T A;  1N87 A;  5TDR A;  1HYJ A;  2YQM A;  2K17 A;  5G05 B;  5C11 A;  1WIL A;  4WZ3 B;  2PUY A;  2YT5 A;  3KQI A;  4AVX A;  5LKZ A;  4N3W A;  3LRQ A;  4ZDT A;  4CCG X;  4UI9 B;  2KE1 A;  2HYE D;  2Y43 A;  3GV4 A;  2QJ0 A;  3N9M A;  2MT5 A;  3O70 A;  4FIP A;  2LQ6 A;  3ZPV 1;  3LQI A;  3V43 A;  2JMD A;  5LKT A;  3M99 A;  1WEM A;  5D1L B;  4YBM A;  2Y1M A;  1X4I A;  3SOU A;  4QF2 A;  3LQH A;  1X4J A;  4IC3 A;  2VJE A;  2E6S A;  4I7B A;  2KWK A;  5G0F A;  3O7A A;  3HCS A;  2LRI C;  4Q6F A;  5TDW A;  4B7Y C;  4FK5 A;  1CHC A;  1LDK C;  2K4D A;  1Z6U A;  2M85 A;  2ECW A;  1MM2 A;  3KNV A;  2ECT A;  2FSA A;  4ZQL A;  3MHS A;  2RI7 A;  2G6Q A;  3PHD A;  3VK6 A;  2L75 A;  3PUQ A;  4GNE A;  2MUM A;  3ZYQ A;  2AN6 A;  4I7D A;  4YBS A;  4WZ0 A;  2C2V S;  1MM3 A;  2ECV A;  4FO9 A;  3HTK C;  3O36 A;  2IDA A;  1VD4 A;  1WE9 A;  3FL2 A;  2UZG A;  2VPG A;  1ZBD B;  3N9Q A;  5AIT A;  1WIM A;  4IC2 A;  4BHW A;  4A0C D;  2EOD A;  2YUR A;  4V3K C;  2LDR A;  5LCW B;  3L11 A;  2EA6 A;  1JM7 B;  3L1X A;  2YQL A;  5KH3 A;  3RTR B;  3T7L A;  3N9N A;  5DIN A;  2LGG A;  2JRJ A;  4GNF A;  2OXQ C;  5KH9 A;  1WES A;  2KIZ A;  2E6R A;  4FJC A;  2VJF A;  5H1U A;  4S3O C;  4LK9 A;  1WEQ A;  2FUI A;  1K2F A;  4WZ2 A;  2LGK A;  5H9M A;  4MVT A;  5LKU A;  2KU3 A;  5JG6 A;  5TBN A;  1JOC A;  2ECI A;  3KV5 A;  3O33 A;  4ZUX U;  3LQJ A;  4WA6 A;  5FEY A;  2KWJ A;  1HYI A;  1FP0 A;  2CKL B;  5B8D A;  4L7X A;  2KWN A;  2LN0 A;  2G45 A;  4UP5 A;  1WEN A;  2L80 A;  2M6M A;  3N9P A;  2MNY A;  2YYR A;  2JMJ A;  5FB1 A;  1LDJ B;  3T6R A;  4I7C A;  1WEU A;  2H0D A;  3N9O A;  4AYC A;  1F62 A;  1WEO A;  4F52 B;  5FER A;  4NN2 A;  1WGM A;  2K1J A;  2KR4 A;  1G25 A;  1E4U A;  5C13 A;  2VPD A;  5H1V A;  2KRE A;  2MD7 B;  4A49 A;  2ZET C;  3SOX A;  3PUR A;  2LGL A;  3RPG C;  2Y1N A;  3MHH A;  5TAB A;  2JMI A;  4S3O B;  2MNZ A;  4AUQ B;  5EYA F;  3O35 A;  2FUU A;  3SHB A;  2XB1 A;  2YU4 A;  4PTB A;  5B78 A;  2CT2 A;  2YW8 A;  2VJE B;  1DVP A;  2KWO A;  4AP4 A;  4BBQ A;  2VNF A;  4LJN A;  5D1K B;  5FB0 A;  3EB6 A;  5I3L A;  5B79 A;  1T1H A;  2C2L A;  4B86 C;  4PPE A;  3M63 A;  2LXH C;  3ASL A;  3L1Z B;  1WEV A;  2CSZ A;  3DPL R;  3I2D A;  2YSM A;  5J3X A;  2L0B A;  4GNG A;  2PNX A;  4R7E A;  3RPG B;  5B75 A;  1V87 A;  2MD8 C;  4UP0 A;  5LKX A;  3QZV A;  2KFT A;  4W4U A;  2QIC A;  4YC9 A;  1XWH A;  3HCU A;  2F6J A;  4X3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...