5TDWA

Set3 phd finger in complex with histone h3k4me3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
b'GIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLARKIQQERINVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SET domain-containing protein 3
publication title Structural Insight into Recognition of Methylated Histone H3K4 by Set3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transcription
total genus 23
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tdwA00
4P5OB 3ZVZB 1XWHA 2LRIC 2LN0A 2LQ6A 4A49A 3M99A 4LADB 2LXHC 4YADA 3V43A 5FEYA 5B77A 2HYED 4I7CA 4R8PK 4NN2A 4R7EA 2F6JA 1WFKA 3O36A 4IC2A 3SOUA 2VJEA 3KV6A 2MUMA 1WE9A 2VPEA 4F52B 2F42A 2VNFA 3O35A 2G6QA 1K2FA 1Z6UA 4X3GA 5KH3A 1X4IA 5LKTA 2ECNA 5DKAA 2Y1MA 5DINA 1WIMA 4A4BA 4UI9B 2YW8A 1HYIA 5H1TA 1V87A 2CKLA 2H0DA 2M85A 3KNVA 5B8DA 4C9ZA 1MM2A 4QF3A 1FBVA 2MA5A 2I50A 5H1VA 2ECIA 2HDPA 2JRJA 4GNDA 2YREA 2VPGA 3ASLA 2K4DA 4YAXA 4ZDTA 2YUCA 1U6GB 1E4UA 3HCSA 4AP4A 2MNYA 3FL2A 3C6WA 4UP0A 5JG6A 5FB1A 2L5UA 5H1UA 3O34A 3O7AA 2LGGA 2JMJA 1BORA 3SHBA 3LQHA 2EODA 3PURA 1ZBDB 2LGLA 2FUUA 1WEUA 2VPDA 4FIPA 3N9OA 2KIZA 2KWNA 2KR4A 3LQIA 4FK5A 2G45A 4WZ0A 4V3LC 3GL6A 3LQJA 2YU4A 3L11A 2F6NA 1DVPA 3ZYQA 3VK6A 1T1HA 2E6RA 2XEUA 4YBTA 3O33A 2ECJA 4B86C 5J3XA 4XI1A 5LCWB 5H9MA 4TKPB 4A4CA 3DQVR 1MM3A 3HCTA 2CSYA 2KWKA 3N9QA 2QIZA 1WEWA 4WZ3B 4CCGX 4LKAA 4BBQA 2M6MA 4I7DA 4IC3A 2EGPA 3ZPVE 3PUQA 2PUYA 2LGVA 3LRQA 3N9MA 4L7XA 2RI7A 1WEEA 2CSZA 4GNFA 5FB0A 1HYJA 3DPLR 2KYUA 5B76A 2YT5A 3GV4A 5KH9A 3L1XA 4AYCB 2M3HA 2VJFB 2JMIA 3T7LA 2PNXA 4YC9A 2LXPC 1F62A 4LJNA 4ZUXU 1RMDA 5D1KB 3I2DA 2ECGA 2FUIA 3HCUA 5G04B 1VFYA 3KQIA 3KV5A 4GNEA 4Q6FA 5I3LA 5FERA 1WEQA 2LGKA 3SOXA 5LKUA 2KGIA 2KWOA 2K16A 2CT2A 2AN6A 3EB5A 4ZQLA 2RSDA 3RTRB 2L43A 5G0FA 1WENA 4B7YC 2ECWA 1WESA 2KU3A 5D1MB 5LKXA 3MHHA 2NAAA 5B79A 4WZ2A 4L58A 2KFTA 3MHSA 2C2LA 3U5MA 2Y1NA 2XB1A 4I7BA 4R2YA 1G25A 4AYCA 2VJFA 1Z2QA 2QICA 2M1RA 3N9NA 3QZVA 5TABA 3N9LA 2MNZA 4N3WA 2K17A 3L1ZB 1JM7B 3SOWA 5D1LB 1N87A 4FJCA 2YQLA 2YURA 3O70A 1IYMA 2EA6A 4AUQB 2YHOA 2BAYA 3U5OA 3ZTGA 3C5KA 5KH7A 4YABA 4LK9A 4MVTA 2Y43A 1WGMA 3ZPV1 5TDWA 2ECVA 3U5PA 2D8SA 3RPGC 4GB0A 5C13A 3N9PA 1X4JA 2VP7A 5TRBA 2LDRA 2C2VS 4YBSA 1CHCA 5TBNA 2OXQC 5G05B 4O64A 5LKZA 4V3KC 2L80A 3PHDA 5C11A 4CA1A 3M63A 2UZGA 2E6SA 1JM7A 2KGGA 4YBMA 2FSAA 2MD8C 3HTKC 2JMDA 3EB6A 2YYRA 2KREA 4MSXA 5AIUA 2YSMA 3IHPA 3O37A 5B78A 2ECTA 4WA6A 5EYAF 4UP5A 5AITA 2KWJA 2MD7B 2DX8A 2IDAA 2MA6A 1LDJB 3RPGB 3ZVYA 4LLBA 4FO9A 1JOCA 4W4UA 1WILA 2VPBA 4PPEA 2KE1A 4BHWA 3ZNIA 4QF2A 4YATA 4S3OC 4A0CD 5B75A 2LV9A 2K1JA 2YQMA 3NG2A 1WEOA 3M62A 1WEMA 2L75A 2G43A 2ZETC 2QJ0A 2VJEB 1WEVA 1VYXA 1FP0A 1Z60A 2YSJA 1X4UA 4PTBA 4AVXA 3U5NA 1VD4A 3T6RA 4S3OB 5TDRA 4N4FA 2L0BA 2YHNA 1WEPA 2CKLB 2H0DB 4GNGA 2MIQA 1LDKC 2MT5A
chains in the Genus database with same CATH superfamily
4P5OB 3ZVZB 1XWHA 4F1PA 2DJAA 2LRIC 2LN0A 2LQ6A 3H7HA 4A49A 3M99A 4LADB 2LXHC 4YADA 3V43A 5FEYA 5B77A 3LVQE 2HYED 4I7CA 4R8PK 4NN2A 4R7EA 2RR4A 2F6JA 1WFKA 3O36A 4IC2A 3SOUA 2VJEA 3KV6A 2CONA 2MUMA 1WE9A 2VPEA 4F52B 2CRRA 2E61A 2F42A 2VNFA 3O35A 2G6QA 1K2FA 1Z6UA 4X3GA 5KH3A 2MKEA 1X4IA 2XOCA 5LKTA 2ECNA 5DKAA 2Y1MA 5DINA 1WIMA 4A4BA 4UI9B 2YW8A 1HYIA 5H1TA 1V87A 2CKLA 2H0DA 2M85A 3KNVA 5B8DA 4C9ZA 1MM2A 3T9KA 4QF3A 1FBVA 2MA5A 2I50A 5H1VA 2ECIA 2HDPA 2JRJA 4GNDA 2YREA 2VPGA 3ASLA 2K4DA 4YAXA 4ZDTA 2YUCA 1U6GB 4H9DA 1E4UA 3HCSA 2EXUA 4AP4A 2MNYA 3FL2A 3C6WA 4UP0A 5JG6A 5FB1A 2L5UA 3FANA 5H1UA 3O34A 3O7AA 2LGGA 2JMJA 2FFWA 1BORA 3SHBA 3LQHA 2EODA 3PURA 1ZBDB 2L7PA 2LGLA 2FUUA 1WEUA 2VPDA 4FIPA 2DSMA 2EGMA 3N9OA 2KIZA 2KWNA 2KR4A 3LQIA 4FK5A 2G45A 4WZ0A 4V3LC 3GL6A 3LQJA 2YU4A 3L11A 2F6NA 3PLWA 3Q1DA 1DVPA 3ZYQA 3VK6A 1T1HA 2E6RA 2XEUA 4YBTA 3O33A 2ECJA 3LDYA 4B86C 2XOZA 5J3XA 4XI1A 5LCWB 5H9MA 4O62A 4TKPB 4A4CA 3DQVR 1MM3A 3HCTA 2CSYA 2KWKA 3N9QA 2XOYA 2QIZA 1WEWA 4WZ3B 4CCGX 4LKAA 4BBQA 2M6MA 5SVXA 4I7DA 3FM8C 4IC3A 2EGPA 3ZPVE 3PUQA 2PUYA 1DCQA 2LGVA 2CRWA 3LRQA 3N9MA 2OWAA 4L7XA 2RI7A 4Z0RA 1WEEA 5SVYA 2CSZA 4GNFA 2YVRA 5FB0A 1HYJA 3DPLR 2KYUA 5B76A 2B0OE 2YT5A 3GV4A 5KH9A 3FEHA 3L1XA 3FAOA 2M3HA 2VJFB 4AYCB 2JMIA 3T7LA 2PNXA 4YC9A 2LXPC 1F62A 4LJNA 4ZUXU 2IQJA 1RMDA 5D1KB 3KDEC 3I2DA 2ECGA 3M7KA 2FUIA 3HCUA 5G04B 1VFYA 3KQIA 3KV5A 4GNEA 4Q6FA 5I3LA 5FERA 1WEQA 2LGKA 3SOXA 5LKUA 2KGIA 2KKXA 2KWOA 2K16A 2CT2A 2AN6A 3EB5A 4ZQLA 2RSDA 3RTRB 2L43A 5G0FA 1WENA 4B7YC 3E2DA 2ECWA 1WESA 5K3QA 2KU3A 5D1MB 5LKXA 3MHHA 2NAAA 5B79A 4WZ2A 4L58A 2KFTA 3MHSA 2C2LA 3U5MA 2Y1NA 2KKYA 2XB1A 4I7BA 4R2YA 1G25A 4AYCA 2VJFA 1Z2QA 2QICA 2M1RA 2LAUA 3N9NA 3QZVA 5TABA 3N9LA 2MNZA 4N3WA 2K17A 3L1ZB 1JM7B 3SOWA 3O47A 5D1LB 1N87A 4FJCA 2YQLA 2YURA 3O70A 1IYMA 2EA6A 4AUQB 2YHOA 2BAYA 3U5OA 3ZTGA 2D8UA 3C5KA 5KH7A 5SVIB 4YABA 4LK9A 4MVTA 2JUNA 2Y43A 1WGMA 2JM3A 3ZPV1 3DWDA 5TDWA 2ECVA 3U5PA 2D8SA 3RPGC 4GB0A 3JUEA 5C13A 3N9PA 1X4JA 2VP7A 5TRBA 2LDRA 2C2VS 4YBSA 1CHCA 5TBNA 2OXQC 5G05B 4O64A 5LKZA 4V3KC 2L80A 3PHDA 4OGEA 5C11A 4CA1A 3M63A 4Z0OA 2UZGA 2E6SA 1JM7A 2KGGA 4YBMA 2FSAA 2MD8C 3HTKC 2JMDA 1MBMA 3EB6A 2YYRA 4QQ4A 2KREA 4MSXA 5AIUA 2YSMA 3IHPA 3O37A 5B78A 2ECTA 4WA6A 5EYAF 4UP5A 5AITA 2KWJA 2MD7B 2DX8A 3FJUB 2IDAA 2MA6A 1LDJB 3RPGB 3ZVYA 4LLBA 4FO9A 1JOCA 4W4UA 1WILA 2VPBA 4PPEA 2KE1A 4OGCA 4BHWA 3ZNIA 5SVIA 4QF2A 4YATA 4S3OC 2M13A 4A0CD 5B75A 2LV9A 2K1JA 2YQMA 3NG2A 1WEOA 3M62A 1WEMA 2L75A 3LVRE 2G43A 2ZETC 2CSVA 2QJ0A 2FD4A 2VJEB 1WEVA 1VYXA 1FP0A 3MDBC 1Z60A 2YSJA 1X4UA 4PTBA 4AVXA 3U5NA 3LJUX 3SUBA 1VD4A 3DDTA 3T6RA 4S3OB 5TDRA 4N4FA 2L0BA 2XP0A 2YHNA 1WEPA 2CKLB 2H0DB 4GNGA 2MIQA 1LDKC 2P57A 2MT5A
chains in the Genus database with same CATH topology
4P5OB 3ZVZB 1XWHA 2LRIC 2LN0A 2LQ6A 4A49A 3M99A 4LADB 2LXHC 4YADA 3V43A 5FEYA 5B77A 2HYED 4I7CA 4R8PK 4NN2A 4R7EA 2F6JA 1WFKA 3O36A 4IC2A 3SOUA 2VJEA 3KV6A 2MUMA 1WE9A 2VPEA 4F52B 2F42A 2VNFA 3O35A 2G6QA 1K2FA 1Z6UA 4X3GA 5KH3A 1X4IA 5LKTA 2ECNA 5DKAA 2Y1MA 5DINA 1WIMA 4A4BA 4UI9B 2YW8A 1HYIA 5H1TA 1V87A 2CKLA 2H0DA 2M85A 3KNVA 5B8DA 4C9ZA 1MM2A 4QF3A 1FBVA 2MA5A 2I50A 5H1VA 2ECIA 2HDPA 2JRJA 4GNDA 2YREA 2VPGA 3ASLA 2K4DA 4YAXA 4ZDTA 2YUCA 1U6GB 1E4UA 3HCSA 4AP4A 2MNYA 3FL2A 3C6WA 4UP0A 5JG6A 5FB1A 2L5UA 5H1UA 3O34A 3O7AA 2LGGA 2JMJA 1BORA 3SHBA 3LQHA 2EODA 3PURA 1ZBDB 2LGLA 2FUUA 1WEUA 2VPDA 4FIPA 3N9OA 2KIZA 2KWNA 2KR4A 3LQIA 4FK5A 2G45A 4WZ0A 4V3LC 3GL6A 3LQJA 2YU4A 3L11A 2F6NA 1DVPA 3ZYQA 3VK6A 1T1HA 2E6RA 2XEUA 4YBTA 3O33A 2ECJA 4B86C 5J3XA 4XI1A 5LCWB 5H9MA 4TKPB 4A4CA 3DQVR 1MM3A 3HCTA 2CSYA 2KWKA 3N9QA 2QIZA 1WEWA 4WZ3B 4CCGX 4LKAA 4BBQA 2M6MA 4I7DA 4IC3A 2EGPA 3ZPVE 3PUQA 2PUYA 2LGVA 3LRQA 3N9MA 4L7XA 2RI7A 1WEEA 2CSZA 4GNFA 5FB0A 1HYJA 3DPLR 2KYUA 5B76A 2YT5A 3GV4A 5KH9A 3L1XA 4AYCB 2M3HA 2VJFB 2JMIA 3T7LA 2PNXA 4YC9A 2LXPC 1F62A 4LJNA 4ZUXU 1RMDA 5D1KB 3I2DA 2ECGA 2FUIA 3HCUA 5G04B 1VFYA 3KQIA 3KV5A 4GNEA 4Q6FA 5I3LA 5FERA 1WEQA 2LGKA 3SOXA 5LKUA 2KGIA 2KWOA 2K16A 2CT2A 2AN6A 3EB5A 4ZQLA 2RSDA 3RTRB 2L43A 5G0FA 1WENA 4B7YC 2ECWA 1WESA 2KU3A 5D1MB 5LKXA 3MHHA 2NAAA 5B79A 4WZ2A 4L58A 2KFTA 3MHSA 2C2LA 3U5MA 2Y1NA 2XB1A 4I7BA 4R2YA 1G25A 4AYCA 2VJFA 1Z2QA 2QICA 2M1RA 3N9NA 3QZVA 5TABA 3N9LA 2MNZA 4N3WA 2K17A 3L1ZB 1JM7B 3SOWA 5D1LB 1N87A 4FJCA 2YQLA 2YURA 3O70A 1IYMA 2EA6A 4AUQB 2YHOA 2BAYA 3U5OA 3ZTGA 3C5KA 5KH7A 4YABA 4LK9A 4MVTA 2Y43A 1WGMA 3ZPV1 5TDWA 2ECVA 3U5PA 2D8SA 3RPGC 4GB0A 5C13A 3N9PA 1X4JA 2VP7A 5TRBA 2LDRA 2C2VS 4YBSA 1CHCA 5TBNA 2OXQC 5G05B 4O64A 5LKZA 4V3KC 2L80A 3PHDA 5C11A 4CA1A 3M63A 2UZGA 2E6SA 1JM7A 2KGGA 4YBMA 2FSAA 2MD8C 3HTKC 2JMDA 3EB6A 2YYRA 2KREA 4MSXA 5AIUA 2YSMA 3IHPA 3O37A 5B78A 2ECTA 4WA6A 5EYAF 4UP5A 5AITA 2KWJA 2MD7B 2DX8A 2IDAA 2MA6A 1LDJB 3RPGB 3ZVYA 4LLBA 4FO9A 1JOCA 4W4UA 1WILA 2VPBA 4PPEA 2KE1A 4BHWA 3ZNIA 4QF2A 4YATA 4S3OC 4A0CD 5B75A 2LV9A 2K1JA 2YQMA 3NG2A 1WEOA 3M62A 1WEMA 2L75A 2G43A 2ZETC 2QJ0A 2VJEB 1WEVA 1VYXA 1FP0A 1Z60A 2YSJA 1X4UA 4PTBA 4AVXA 3U5NA 1VD4A 3T6RA 4S3OB 5TDRA 4N4FA 2L0BA 2YHNA 1WEPA 2CKLB 2H0DB 4GNGA 2MIQA 1LDKC 2MT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O B;  3ZVZ B;  1XWH A;  2LRI C;  2LN0 A;  2LQ6 A;  4A49 A;  3M99 A;  4LAD B;  2LXH C;  4YAD A;  3V43 A;  5FEY A;  5B77 A;  2HYE D;  4I7C A;  4R8P K;  4NN2 A;  4R7E A;  2F6J A;  1WFK A;  3O36 A;  4IC2 A;  3SOU A;  2VJE A;  3KV6 A;  2MUM A;  1WE9 A;  2VPE A;  4F52 B;  2F42 A;  2VNF A;  3O35 A;  2G6Q A;  1K2F A;  1Z6U A;  4X3G A;  5KH3 A;  1X4I A;  5LKT A;  2ECN A;  5DKA A;  2Y1M A;  5DIN A;  1WIM A;  4A4B A;  4UI9 B;  2YW8 A;  1HYI A;  5H1T A;  1V87 A;  2CKL A;  2H0D A;  2M85 A;  3KNV A;  5B8D A;  4C9Z A;  1MM2 A;  4QF3 A;  1FBV A;  2MA5 A;  2I50 A;  5H1V A;  2ECI A;  2HDP A;  2JRJ A;  4GND A;  2YRE A;  2VPG A;  3ASL A;  2K4D A;  4YAX A;  4ZDT A;  2YUC A;  1U6G B;  1E4U A;  3HCS A;  4AP4 A;  2MNY A;  3FL2 A;  3C6W A;  4UP0 A;  5JG6 A;  5FB1 A;  2L5U A;  5H1U A;  3O34 A;  3O7A A;  2LGG A;  2JMJ A;  1BOR A;  3SHB A;  3LQH A;  2EOD A;  3PUR A;  1ZBD B;  2LGL A;  2FUU A;  1WEU A;  2VPD A;  4FIP A;  3N9O A;  2KIZ A;  2KWN A;  2KR4 A;  3LQI A;  4FK5 A;  2G45 A;  4WZ0 A;  4V3L C;  3GL6 A;  3LQJ A;  2YU4 A;  3L11 A;  2F6N A;  1DVP A;  3ZYQ A;  3VK6 A;  1T1H A;  2E6R A;  2XEU A;  4YBT A;  3O33 A;  2ECJ A;  4B86 C;  5J3X A;  4XI1 A;  5LCW B;  5H9M A;  4TKP B;  4A4C A;  3DQV R;  1MM3 A;  3HCT A;  2CSY A;  2KWK A;  3N9Q A;  2QIZ A;  1WEW A;  4WZ3 B;  4CCG X;  4LKA A;  4BBQ A;  2M6M A;  4I7D A;  4IC3 A;  2EGP A;  3ZPV E;  3PUQ A;  2PUY A;  2LGV A;  3LRQ A;  3N9M A;  4L7X A;  2RI7 A;  1WEE A;  2CSZ A;  4GNF A;  5FB0 A;  1HYJ A;  3DPL R;  2KYU A;  5B76 A;  2YT5 A;  3GV4 A;  5KH9 A;  3L1X A;  4AYC B;  2M3H A;  2VJF B;  2JMI A;  3T7L A;  2PNX A;  4YC9 A;  2LXP C;  1F62 A;  4LJN A;  4ZUX U;  1RMD A;  5D1K B;  3I2D A;  2ECG A;  2FUI A;  3HCU A;  5G04 B;  1VFY A;  3KQI A;  3KV5 A;  4GNE A;  4Q6F A;  5I3L A;  5FER A;  1WEQ A;  2LGK A;  3SOX A;  5LKU A;  2KGI A;  2KWO A;  2K16 A;  2CT2 A;  2AN6 A;  3EB5 A;  4ZQL A;  2RSD A;  3RTR B;  2L43 A;  5G0F A;  1WEN A;  4B7Y C;  2ECW A;  1WES A;  2KU3 A;  5D1M B;  5LKX A;  3MHH A;  2NAA A;  5B79 A;  4WZ2 A;  4L58 A;  2KFT A;  3MHS A;  2C2L A;  3U5M A;  2Y1N A;  2XB1 A;  4I7B A;  4R2Y A;  1G25 A;  4AYC A;  2VJF A;  1Z2Q A;  2QIC A;  2M1R A;  3N9N A;  3QZV A;  5TAB A;  3N9L A;  2MNZ A;  4N3W A;  2K17 A;  3L1Z B;  1JM7 B;  3SOW A;  5D1L B;  1N87 A;  4FJC A;  2YQL A;  2YUR A;  3O70 A;  1IYM A;  2EA6 A;  4AUQ B;  2YHO A;  2BAY A;  3U5O A;  3ZTG A;  3C5K A;  5KH7 A;  4YAB A;  4LK9 A;  4MVT A;  2Y43 A;  1WGM A;  3ZPV 1;  5TDW A;  2ECV A;  3U5P A;  2D8S A;  3RPG C;  4GB0 A;  5C13 A;  3N9P A;  1X4J A;  2VP7 A;  5TRB A;  2LDR A;  2C2V S;  4YBS A;  1CHC A;  5TBN A;  2OXQ C;  5G05 B;  4O64 A;  5LKZ A;  4V3K C;  2L80 A;  3PHD A;  5C11 A;  4CA1 A;  3M63 A;  2UZG A;  2E6S A;  1JM7 A;  2KGG A;  4YBM A;  2FSA A;  2MD8 C;  3HTK C;  2JMD A;  3EB6 A;  2YYR A;  2KRE A;  4MSX A;  5AIU A;  2YSM A;  3IHP A;  3O37 A;  5B78 A;  2ECT A;  4WA6 A;  5EYA F;  4UP5 A;  5AIT A;  2KWJ A;  2MD7 B;  2DX8 A;  2IDA A;  2MA6 A;  1LDJ B;  3RPG B;  3ZVY A;  4LLB A;  4FO9 A;  1JOC A;  4W4U A;  1WIL A;  2VPB A;  4PPE A;  2KE1 A;  4BHW A;  3ZNI A;  4QF2 A;  4YAT A;  4S3O C;  4A0C D;  5B75 A;  2LV9 A;  2K1J A;  2YQM A;  3NG2 A;  1WEO A;  3M62 A;  1WEM A;  2L75 A;  2G43 A;  2ZET C;  2QJ0 A;  2VJE B;  1WEV A;  1VYX A;  1FP0 A;  1Z60 A;  2YSJ A;  1X4U A;  4PTB A;  4AVX A;  3U5N A;  1VD4 A;  3T6R A;  4S3O B;  5TDR A;  4N4F A;  2L0B A;  2YHN A;  1WEP A;  2CKL B;  2H0D B;  4GNG A;  2MIQ A;  1LDK C;  2MT5 A; 
#chains in the Genus database with same CATH topology
 4P5O B;  3ZVZ B;  1XWH A;  4F1P A;  2DJA A;  2LRI C;  2LN0 A;  2LQ6 A;  3H7H A;  4A49 A;  3M99 A;  4LAD B;  2LXH C;  4YAD A;  3V43 A;  5FEY A;  5B77 A;  3LVQ E;  2HYE D;  4I7C A;  4R8P K;  4NN2 A;  4R7E A;  2RR4 A;  2F6J A;  1WFK A;  3O36 A;  4IC2 A;  3SOU A;  2VJE A;  3KV6 A;  2CON A;  2MUM A;  1WE9 A;  2VPE A;  4F52 B;  2CRR A;  2E61 A;  2F42 A;  2VNF A;  3O35 A;  2G6Q A;  1K2F A;  1Z6U A;  4X3G A;  5KH3 A;  2MKE A;  1X4I A;  2XOC A;  5LKT A;  2ECN A;  5DKA A;  2Y1M A;  5DIN A;  1WIM A;  4A4B A;  4UI9 B;  2YW8 A;  1HYI A;  5H1T A;  1V87 A;  2CKL A;  2H0D A;  2M85 A;  3KNV A;  5B8D A;  4C9Z A;  1MM2 A;  3T9K A;  4QF3 A;  1FBV A;  2MA5 A;  2I50 A;  5H1V A;  2ECI A;  2HDP A;  2JRJ A;  4GND A;  2YRE A;  2VPG A;  3ASL A;  2K4D A;  4YAX A;  4ZDT A;  2YUC A;  1U6G B;  4H9D A;  1E4U A;  3HCS A;  2EXU A;  4AP4 A;  2MNY A;  3FL2 A;  3C6W A;  4UP0 A;  5JG6 A;  5FB1 A;  2L5U A;  3FAN A;  5H1U A;  3O34 A;  3O7A A;  2LGG A;  2JMJ A;  2FFW A;  1BOR A;  3SHB A;  3LQH A;  2EOD A;  3PUR A;  1ZBD B;  2L7P A;  2LGL A;  2FUU A;  1WEU A;  2VPD A;  4FIP A;  2DSM A;  2EGM A;  3N9O A;  2KIZ A;  2KWN A;  2KR4 A;  3LQI A;  4FK5 A;  2G45 A;  4WZ0 A;  4V3L C;  3GL6 A;  3LQJ A;  2YU4 A;  3L11 A;  2F6N A;  3PLW A;  3Q1D A;  1DVP A;  3ZYQ A;  3VK6 A;  1T1H A;  2E6R A;  2XEU A;  4YBT A;  3O33 A;  2ECJ A;  3LDY A;  4B86 C;  2XOZ A;  5J3X A;  4XI1 A;  5LCW B;  5H9M A;  4O62 A;  4TKP B;  4A4C A;  3DQV R;  1MM3 A;  3HCT A;  2CSY A;  2KWK A;  3N9Q A;  2XOY A;  2QIZ A;  1WEW A;  4WZ3 B;  4CCG X;  4LKA A;  4BBQ A;  2M6M A;  5SVX A;  4I7D A;  3FM8 C;  4IC3 A;  2EGP A;  3ZPV E;  3PUQ A;  2PUY A;  1DCQ A;  2LGV A;  2CRW A;  3LRQ A;  3N9M A;  2OWA A;  4L7X A;  2RI7 A;  4Z0R A;  1WEE A;  5SVY A;  2CSZ A;  4GNF A;  2YVR A;  5FB0 A;  1HYJ A;  3DPL R;  2KYU A;  5B76 A;  2B0O E;  2YT5 A;  3GV4 A;  5KH9 A;  3FEH A;  3L1X A;  3FAO A;  2M3H A;  2VJF B;  4AYC B;  2JMI A;  3T7L A;  2PNX A;  4YC9 A;  2LXP C;  1F62 A;  4LJN A;  4ZUX U;  2IQJ A;  1RMD A;  5D1K B;  3KDE C;  3I2D A;  2ECG A;  3M7K A;  2FUI A;  3HCU A;  5G04 B;  1VFY A;  3KQI A;  3KV5 A;  4GNE A;  4Q6F A;  5I3L A;  5FER A;  1WEQ A;  2LGK A;  3SOX A;  5LKU A;  2KGI A;  2KKX A;  2KWO A;  2K16 A;  2CT2 A;  2AN6 A;  3EB5 A;  4ZQL A;  2RSD A;  3RTR B;  2L43 A;  5G0F A;  1WEN A;  4B7Y C;  3E2D A;  2ECW A;  1WES A;  5K3Q A;  2KU3 A;  5D1M B;  5LKX A;  3MHH A;  2NAA A;  5B79 A;  4WZ2 A;  4L58 A;  2KFT A;  3MHS A;  2C2L A;  3U5M A;  2Y1N A;  2KKY A;  2XB1 A;  4I7B A;  4R2Y A;  1G25 A;  4AYC A;  2VJF A;  1Z2Q A;  2QIC A;  2M1R A;  2LAU A;  3N9N A;  3QZV A;  5TAB A;  3N9L A;  2MNZ A;  4N3W A;  2K17 A;  3L1Z B;  1JM7 B;  3SOW A;  3O47 A;  5D1L B;  1N87 A;  4FJC A;  2YQL A;  2YUR A;  3O70 A;  1IYM A;  2EA6 A;  4AUQ B;  2YHO A;  2BAY A;  3U5O A;  3ZTG A;  2D8U A;  3C5K A;  5KH7 A;  5SVI B;  4YAB A;  4LK9 A;  4MVT A;  2JUN A;  2Y43 A;  1WGM A;  2JM3 A;  3ZPV 1;  3DWD A;  5TDW A;  2ECV A;  3U5P A;  2D8S A;  3RPG C;  4GB0 A;  3JUE A;  5C13 A;  3N9P A;  1X4J A;  2VP7 A;  5TRB A;  2LDR A;  2C2V S;  4YBS A;  1CHC A;  5TBN A;  2OXQ C;  5G05 B;  4O64 A;  5LKZ A;  4V3K C;  2L80 A;  3PHD A;  4OGE A;  5C11 A;  4CA1 A;  3M63 A;  4Z0O A;  2UZG A;  2E6S A;  1JM7 A;  2KGG A;  4YBM A;  2FSA A;  2MD8 C;  3HTK C;  2JMD A;  1MBM A;  3EB6 A;  2YYR A;  4QQ4 A;  2KRE A;  4MSX A;  5AIU A;  2YSM A;  3IHP A;  3O37 A;  5B78 A;  2ECT A;  4WA6 A;  5EYA F;  4UP5 A;  5AIT A;  2KWJ A;  2MD7 B;  2DX8 A;  3FJU B;  2IDA A;  2MA6 A;  1LDJ B;  3RPG B;  3ZVY A;  4LLB A;  4FO9 A;  1JOC A;  4W4U A;  1WIL A;  2VPB A;  4PPE A;  2KE1 A;  4OGC A;  4BHW A;  3ZNI A;  5SVI A;  4QF2 A;  4YAT A;  4S3O C;  2M13 A;  4A0C D;  5B75 A;  2LV9 A;  2K1J A;  2YQM A;  3NG2 A;  1WEO A;  3M62 A;  1WEM A;  2L75 A;  3LVR E;  2G43 A;  2ZET C;  2CSV A;  2QJ0 A;  2FD4 A;  2VJE B;  1WEV A;  1VYX A;  1FP0 A;  3MDB C;  1Z60 A;  2YSJ A;  1X4U A;  4PTB A;  4AVX A;  3U5N A;  3LJU X;  3SUB A;  1VD4 A;  3DDT A;  3T6R A;  4S3O B;  5TDR A;  4N4F A;  2L0B A;  2XP0 A;  2YHN A;  1WEP A;  2CKL B;  2H0D B;  4GNG A;  2MIQ A;  1LDK C;  2P57 A;  2MT5 A; 
#chains in the Genus database with same CATH homology
 4P5O B;  3ZVZ B;  1XWH A;  2LRI C;  2LN0 A;  2LQ6 A;  4A49 A;  3M99 A;  4LAD B;  2LXH C;  4YAD A;  3V43 A;  5FEY A;  5B77 A;  2HYE D;  4I7C A;  4R8P K;  4NN2 A;  4R7E A;  2F6J A;  1WFK A;  3O36 A;  4IC2 A;  3SOU A;  2VJE A;  3KV6 A;  2MUM A;  1WE9 A;  2VPE A;  4F52 B;  2F42 A;  2VNF A;  3O35 A;  2G6Q A;  1K2F A;  1Z6U A;  4X3G A;  5KH3 A;  1X4I A;  5LKT A;  2ECN A;  5DKA A;  2Y1M A;  5DIN A;  1WIM A;  4A4B A;  4UI9 B;  2YW8 A;  1HYI A;  5H1T A;  1V87 A;  2CKL A;  2H0D A;  2M85 A;  3KNV A;  5B8D A;  4C9Z A;  1MM2 A;  4QF3 A;  1FBV A;  2MA5 A;  2I50 A;  5H1V A;  2ECI A;  2HDP A;  2JRJ A;  4GND A;  2YRE A;  2VPG A;  3ASL A;  2K4D A;  4YAX A;  4ZDT A;  2YUC A;  1U6G B;  1E4U A;  3HCS A;  4AP4 A;  2MNY A;  3FL2 A;  3C6W A;  4UP0 A;  5JG6 A;  5FB1 A;  2L5U A;  5H1U A;  3O34 A;  3O7A A;  2LGG A;  2JMJ A;  1BOR A;  3SHB A;  3LQH A;  2EOD A;  3PUR A;  1ZBD B;  2LGL A;  2FUU A;  1WEU A;  2VPD A;  4FIP A;  3N9O A;  2KIZ A;  2KWN A;  2KR4 A;  3LQI A;  4FK5 A;  2G45 A;  4WZ0 A;  4V3L C;  3GL6 A;  3LQJ A;  2YU4 A;  3L11 A;  2F6N A;  1DVP A;  3ZYQ A;  3VK6 A;  1T1H A;  2E6R A;  2XEU A;  4YBT A;  3O33 A;  2ECJ A;  4B86 C;  5J3X A;  4XI1 A;  5LCW B;  5H9M A;  4TKP B;  4A4C A;  3DQV R;  1MM3 A;  3HCT A;  2CSY A;  2KWK A;  3N9Q A;  2QIZ A;  1WEW A;  4WZ3 B;  4CCG X;  4LKA A;  4BBQ A;  2M6M A;  4I7D A;  4IC3 A;  2EGP A;  3ZPV E;  3PUQ A;  2PUY A;  2LGV A;  3LRQ A;  3N9M A;  4L7X A;  2RI7 A;  1WEE A;  2CSZ A;  4GNF A;  5FB0 A;  1HYJ A;  3DPL R;  2KYU A;  5B76 A;  2YT5 A;  3GV4 A;  5KH9 A;  3L1X A;  4AYC B;  2M3H A;  2VJF B;  2JMI A;  3T7L A;  2PNX A;  4YC9 A;  2LXP C;  1F62 A;  4LJN A;  4ZUX U;  1RMD A;  5D1K B;  3I2D A;  2ECG A;  2FUI A;  3HCU A;  5G04 B;  1VFY A;  3KQI A;  3KV5 A;  4GNE A;  4Q6F A;  5I3L A;  5FER A;  1WEQ A;  2LGK A;  3SOX A;  5LKU A;  2KGI A;  2KWO A;  2K16 A;  2CT2 A;  2AN6 A;  3EB5 A;  4ZQL A;  2RSD A;  3RTR B;  2L43 A;  5G0F A;  1WEN A;  4B7Y C;  2ECW A;  1WES A;  2KU3 A;  5D1M B;  5LKX A;  3MHH A;  2NAA A;  5B79 A;  4WZ2 A;  4L58 A;  2KFT A;  3MHS A;  2C2L A;  3U5M A;  2Y1N A;  2XB1 A;  4I7B A;  4R2Y A;  1G25 A;  4AYC A;  2VJF A;  1Z2Q A;  2QIC A;  2M1R A;  3N9N A;  3QZV A;  5TAB A;  3N9L A;  2MNZ A;  4N3W A;  2K17 A;  3L1Z B;  1JM7 B;  3SOW A;  5D1L B;  1N87 A;  4FJC A;  2YQL A;  2YUR A;  3O70 A;  1IYM A;  2EA6 A;  4AUQ B;  2YHO A;  2BAY A;  3U5O A;  3ZTG A;  3C5K A;  5KH7 A;  4YAB A;  4LK9 A;  4MVT A;  2Y43 A;  1WGM A;  3ZPV 1;  5TDW A;  2ECV A;  3U5P A;  2D8S A;  3RPG C;  4GB0 A;  5C13 A;  3N9P A;  1X4J A;  2VP7 A;  5TRB A;  2LDR A;  2C2V S;  4YBS A;  1CHC A;  5TBN A;  2OXQ C;  5G05 B;  4O64 A;  5LKZ A;  4V3K C;  2L80 A;  3PHD A;  5C11 A;  4CA1 A;  3M63 A;  2UZG A;  2E6S A;  1JM7 A;  2KGG A;  4YBM A;  2FSA A;  2MD8 C;  3HTK C;  2JMD A;  3EB6 A;  2YYR A;  2KRE A;  4MSX A;  5AIU A;  2YSM A;  3IHP A;  3O37 A;  5B78 A;  2ECT A;  4WA6 A;  5EYA F;  4UP5 A;  5AIT A;  2KWJ A;  2MD7 B;  2DX8 A;  2IDA A;  2MA6 A;  1LDJ B;  3RPG B;  3ZVY A;  4LLB A;  4FO9 A;  1JOC A;  4W4U A;  1WIL A;  2VPB A;  4PPE A;  2KE1 A;  4BHW A;  3ZNI A;  4QF2 A;  4YAT A;  4S3O C;  4A0C D;  5B75 A;  2LV9 A;  2K1J A;  2YQM A;  3NG2 A;  1WEO A;  3M62 A;  1WEM A;  2L75 A;  2G43 A;  2ZET C;  2QJ0 A;  2VJE B;  1WEV A;  1VYX A;  1FP0 A;  1Z60 A;  2YSJ A;  1X4U A;  4PTB A;  4AVX A;  3U5N A;  1VD4 A;  3T6R A;  4S3O B;  5TDR A;  4N4F A;  2L0B A;  2YHN A;  1WEP A;  2CKL B;  2H0D B;  4GNG A;  2MIQ A;  1LDK C;  2MT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...