2XOYA

C-terminal cysteine-rich domain of human chfr bound to p(1),p(2)- diadenosine-5'-pyrophosphate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
239
structure length
212
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 65
structure length 212
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xoyA01
2XOCA 2XOZA 2XP0A 2XOYA
chains in the Genus database with same CATH superfamily
2EXUA 5H1UA 4UP5A 4OGEA 1WEOA 4PPEA 3GL6A 3ASLA 3L1XA 4I7DA 2Y43A 1IYMA 3I2DA 5DINA 5SVXA 2EODA 2QIZA 3LQHA 2VJFA 1RMDA 2LRIC 2VPDA 3L1ZB 3N9QA 1HYJA 4UI9B 4CA1A 2FSAA 1V87A 5B76A 3U5NA 1HYIA 3T7LA 2F6NA 4S3OC 4N3WA 2YU4A 2K1JA 3FANA 3Q1DA 2LN0A 3LDYA 2LXHC 2MNYA 3EB6A 2I50A 4O64A 2FFWA 1X4JA 3KV6A 1CHCA 4YAXA 2MD8C 2MNZA 3M63A 2RI7A 3JUEA 2M85A 3O47A 2AN6A 4B86C 4GNGA 1WEPA 3HCTA 4FJCA 4S3OB 1VYXA 2L5UA 1WEMA 5K3QA 2DX8A 3M99A 2XEUA 2EA6A 4L7XA 2FUUA 3NG2A 1MM2A 4B7YC 1JOCA 4R8PK 4V3KC 5LKZA 2KU3A 3PUQA 2KKXA 4MSXA 5LCWB 2MUMA 5SVIB 2D8UA 5KH3A 3IHPA 2VPEA 3HCUA 2VJEA 4QF3A 2LXPC 1WFKA 2OXQC 2JMJA 4WA6A 1X4UA 3HTKC 2LGGA 2PNXA 5SVYA 2MA5A 2VJFB 4GNDA 4BBQA 4UP0A 4TKPB 2KWNA 2YHOA 4GNEA 2K17A 5KH9A 3ZPV1 5TDRA 1LDKC 1Z60A 2XOZA 2KWKA 2M13A 3PURA 1FBVA 2ECNA 2IQJA 3GV4A 4BHWA 2YVRA 1WGMA 3PHDA 4O62A 1WEVA 5LKUA 3PLWA 2MIQA 4IC3A 3KDEC 2YYRA 3O35A 5B75A 1WILA 4F52B 2CRRA 2ZETC 3O7AA 4GB0A 2C2VS 5J3XA 3LVQE 3FM8C 3SUBA 2XB1A 3ZYQA 4A0CD 4ZDTA 2JRJA 2LGKA 5FB1A 3LQJA 3LQIA 4H9DA 2OWAA 5G04B 3V43A 3FL2A 2E61A 1JM7B 4L58A 2ECGA 1ZBDB 3E2DA 4YATA 5D1KB 3DQVR 4I7BA 4R2YA 2VJEB 2JUNA 1DCQA 2ECVA 2CKLA 2F42A 2HYED 3O34A 1WEEA 2YT5A 5EYAF 4YBTA 1MM3A 4FK5A 2MKEA 1U6GB 5AIUA 2C2LA 2ECTA 5KH7A 3ZTGA 5B79A 2QICA 2VPBA 3N9NA 4FO9A 1G25A 5I3LA 3EB5A 2LDRA 2YQLA 4C9ZA 1JM7A 4YBMA 3U5PA 2MT5A 2JM3A 4QF2A 1FP0A 2VPGA 3SOXA 2DJAA 2EGMA 1WEQA 5H1VA 4A4BA 4P5OB 1Z6UA 5JG6A 3FEHA 4AUQB 4AP4A 5C13A 5LKTA 4WZ2A 4LK9A 3ZVYA 3T6RA 3C6WA 3FAOA 1WEWA 1E4UA 4PTBA 4OGCA 4I7CA 2JMIA 4A4CA 2LGLA 2LGVA 3KNVA 2KKYA 2CT2A 2FD4A 5TBNA 2KWOA 3RPGC 2XP0A 5D1LB 3N9OA 4MVTA 4N4FA 4A49A 3MHSA 3O33A 2D8SA 3RTRB 2KR4A 2RR4A 3QZVA 2JMDA 2VP7A 5FB0A 5D1MB 4FIPA 3HCSA 4WZ3B 2CKLB 4LJNA 4LLBA 3O37A 5G05B 1BORA 2G6QA 4V3LC 4Q6FA 2L0BA 5FEYA 3MDBC 3LRQA 4AYCA 1N87A 4Z0RA 5TRBA 2KIZA 4YADA 1K2FA 2E6SA 2KREA 2H0DA 2NAAA 3U5OA 3SOWA 4YABA 2MA6A 2KWJA 2YHNA 2L7PA 2VNFA 4LKAA 3FJUB 1VD4A 3VK6A 1T1HA 5LKXA 2F6JA 3SHBA 4WZ0A 3KQIA 2RSDA 1WENA 4Z0OA 3MHHA 4YBSA 2LAUA 2Y1NA 4R7EA 3M7KA 2ECJA 2YUCA 3T9KA 1DVPA 1WIMA 2KYUA 2CSVA 2YSJA 1WE9A 2K16A 2PUYA 2CRWA 3LJUX 3O70A 5B78A 2BAYA 4CCGX 2CONA 4IC2A 3N9MA 4GNFA 1XWHA 3N9LA 5TABA 4ZQLA 5C11A 2B0OE 2ECWA 2XOYA 2YREA 2XOCA 5AITA 5H9MA 5B8DA 2LV9A 1LDJB 3U5MA 2FUIA 2MD7B 5DKAA 2M3HA 2E6RA 2LQ6A 1X4IA 3DPLR 2HDPA 5FERA 3M62A 3H7HA 2EGPA 2YSMA 3DWDA 1MBMA 4W4UA 2KGIA 2QJ0A 3SOUA 4AVXA 2L75A 2YURA 5B77A 2KGGA 3C5KA 2L43A 2CSZA 1WEUA 4AYCB 2YQMA 3O36A 2KFTA 2M6MA 2YW8A 4LADB 3DDTA 3KV5A 4YC9A 3N9PA 1VFYA 2H0DB 5TDWA 3ZNIA 2UZGA 3LVRE 2KE1A 2P57A 2L80A 1F62A 2IDAA 4X3GA 5G0FA 2M1RA 1WESA 2G45A 2Y1MA 2K4DA 4ZUXU 1Z2QA 2G43A 3L11A 2CSYA 4XI1A 4F1PA 4NN2A 2DSMA 3ZVZB 3ZPVE 2ECIA 5SVIA 3RPGB 5H1TA 4QQ4A
chains in the Genus database with same CATH topology
2EXUA 3MDBC 3LVRE 2P57A 2XOZA 2JUNA 2CONA 4OGEA 2KKXA 3O47A 5SVYA 2M13A 1DCQA 4Z0RA 4Z0OA 2IQJA 3H7HA 3LVQE 3FM8C 2YVRA 3DWDA 2B0OE 4OGCA 3SUBA 5SVIB 2D8UA 2RR4A 2XOYA 2LAUA 3Q1DA 3M7KA 4O62A 2KKYA 2FD4A 2YREA 2XOCA 4H9DA 3T9KA 3LDYA 2JM3A 2OWAA 5K3QA 2DJAA 4F1PA 5SVXA 2EGMA 2E61A 3PLWA 2CSVA 3KDEC 2FFWA 2MKEA 3DDTA 2XP0A 3FEHA 2CRWA 3LJUX 2L7PA 3E2DA 5SVIA 2CRRA 3FJUB 4QQ4A 3JUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOC A;  2XOZ A;  2XP0 A;  2XOY A; 
#chains in the Genus database with same CATH topology
 2EXU A;  5H1U A;  4UP5 A;  4OGE A;  1WEO A;  4PPE A;  3GL6 A;  3ASL A;  3L1X A;  4I7D A;  2Y43 A;  1IYM A;  3I2D A;  5DIN A;  5SVX A;  2EOD A;  2QIZ A;  3LQH A;  2VJF A;  1RMD A;  2LRI C;  2VPD A;  3L1Z B;  3N9Q A;  1HYJ A;  4UI9 B;  4CA1 A;  2FSA A;  1V87 A;  5B76 A;  3U5N A;  1HYI A;  3T7L A;  2F6N A;  4S3O C;  4N3W A;  2YU4 A;  2K1J A;  3FAN A;  3Q1D A;  2LN0 A;  3LDY A;  2LXH C;  2MNY A;  3EB6 A;  2I50 A;  4O64 A;  2FFW A;  1X4J A;  3KV6 A;  1CHC A;  4YAX A;  2MD8 C;  2MNZ A;  3M63 A;  2RI7 A;  3JUE A;  2M85 A;  3O47 A;  2AN6 A;  4B86 C;  4GNG A;  1WEP A;  3HCT A;  4FJC A;  4S3O B;  1VYX A;  2L5U A;  1WEM A;  5K3Q A;  2DX8 A;  3M99 A;  2XEU A;  2EA6 A;  4L7X A;  2FUU A;  3NG2 A;  1MM2 A;  4B7Y C;  1JOC A;  4R8P K;  4V3K C;  5LKZ A;  2KU3 A;  3PUQ A;  2KKX A;  4MSX A;  5LCW B;  2MUM A;  5SVI B;  2D8U A;  5KH3 A;  3IHP A;  2VPE A;  3HCU A;  2VJE A;  4QF3 A;  2LXP C;  1WFK A;  2OXQ C;  2JMJ A;  4WA6 A;  1X4U A;  3HTK C;  2LGG A;  2PNX A;  5SVY A;  2MA5 A;  2VJF B;  4GND A;  4BBQ A;  4UP0 A;  4TKP B;  2KWN A;  2YHO A;  4GNE A;  2K17 A;  5KH9 A;  3ZPV 1;  5TDR A;  1LDK C;  1Z60 A;  2XOZ A;  2KWK A;  2M13 A;  3PUR A;  1FBV A;  2ECN A;  2IQJ A;  3GV4 A;  4BHW A;  2YVR A;  1WGM A;  3PHD A;  4O62 A;  1WEV A;  5LKU A;  3PLW A;  2MIQ A;  4IC3 A;  3KDE C;  2YYR A;  3O35 A;  5B75 A;  1WIL A;  4F52 B;  2CRR A;  2ZET C;  3O7A A;  4GB0 A;  2C2V S;  5J3X A;  3LVQ E;  3FM8 C;  3SUB A;  2XB1 A;  3ZYQ A;  4A0C D;  4ZDT A;  2JRJ A;  2LGK A;  5FB1 A;  3LQJ A;  3LQI A;  4H9D A;  2OWA A;  5G04 B;  3V43 A;  3FL2 A;  2E61 A;  1JM7 B;  4L58 A;  2ECG A;  1ZBD B;  3E2D A;  4YAT A;  5D1K B;  3DQV R;  4I7B A;  4R2Y A;  2VJE B;  2JUN A;  1DCQ A;  2ECV A;  2CKL A;  2F42 A;  2HYE D;  3O34 A;  1WEE A;  2YT5 A;  5EYA F;  4YBT A;  1MM3 A;  4FK5 A;  2MKE A;  1U6G B;  5AIU A;  2C2L A;  2ECT A;  5KH7 A;  3ZTG A;  5B79 A;  2QIC A;  2VPB A;  3N9N A;  4FO9 A;  1G25 A;  5I3L A;  3EB5 A;  2LDR A;  2YQL A;  4C9Z A;  1JM7 A;  4YBM A;  3U5P A;  2MT5 A;  2JM3 A;  4QF2 A;  1FP0 A;  2VPG A;  3SOX A;  2DJA A;  2EGM A;  1WEQ A;  5H1V A;  4A4B A;  4P5O B;  1Z6U A;  5JG6 A;  3FEH A;  4AUQ B;  4AP4 A;  5C13 A;  5LKT A;  4WZ2 A;  4LK9 A;  3ZVY A;  3T6R A;  3C6W A;  3FAO A;  1WEW A;  1E4U A;  4PTB A;  4OGC A;  4I7C A;  2JMI A;  4A4C A;  2LGL A;  2LGV A;  3KNV A;  2KKY A;  2CT2 A;  2FD4 A;  5TBN A;  2KWO A;  3RPG C;  2XP0 A;  5D1L B;  3N9O A;  4MVT A;  4N4F A;  4A49 A;  3MHS A;  3O33 A;  2D8S A;  3RTR B;  2KR4 A;  2RR4 A;  3QZV A;  2JMD A;  2VP7 A;  5FB0 A;  5D1M B;  4FIP A;  3HCS A;  4WZ3 B;  2CKL B;  4LJN A;  4LLB A;  3O37 A;  5G05 B;  1BOR A;  2G6Q A;  4V3L C;  4Q6F A;  2L0B A;  5FEY A;  3MDB C;  3LRQ A;  4AYC A;  1N87 A;  4Z0R A;  5TRB A;  2KIZ A;  4YAD A;  1K2F A;  2E6S A;  2KRE A;  2H0D A;  2NAA A;  3U5O A;  3SOW A;  4YAB A;  2MA6 A;  2KWJ A;  2YHN A;  2L7P A;  2VNF A;  4LKA A;  3FJU B;  1VD4 A;  3VK6 A;  1T1H A;  5LKX A;  2F6J A;  3SHB A;  4WZ0 A;  3KQI A;  2RSD A;  1WEN A;  4Z0O A;  3MHH A;  4YBS A;  2LAU A;  2Y1N A;  4R7E A;  3M7K A;  2ECJ A;  2YUC A;  3T9K A;  1DVP A;  1WIM A;  2KYU A;  2CSV A;  2YSJ A;  1WE9 A;  2K16 A;  2PUY A;  2CRW A;  3LJU X;  3O70 A;  5B78 A;  2BAY A;  4CCG X;  2CON A;  4IC2 A;  3N9M A;  4GNF A;  1XWH A;  3N9L A;  5TAB A;  4ZQL A;  5C11 A;  2B0O E;  2ECW A;  2XOY A;  2YRE A;  2XOC A;  5AIT A;  5H9M A;  5B8D A;  2LV9 A;  1LDJ B;  3U5M A;  2FUI A;  2MD7 B;  5DKA A;  2M3H A;  2E6R A;  2LQ6 A;  1X4I A;  3DPL R;  2HDP A;  5FER A;  3M62 A;  3H7H A;  2EGP A;  2YSM A;  3DWD A;  1MBM A;  4W4U A;  2KGI A;  2QJ0 A;  3SOU A;  4AVX A;  2L75 A;  2YUR A;  5B77 A;  2KGG A;  3C5K A;  2L43 A;  2CSZ A;  1WEU A;  4AYC B;  2YQM A;  3O36 A;  2KFT A;  2M6M A;  2YW8 A;  4LAD B;  3DDT A;  3KV5 A;  4YC9 A;  3N9P A;  1VFY A;  2H0D B;  5TDW A;  3ZNI A;  2UZG A;  3LVR E;  2KE1 A;  2P57 A;  2L80 A;  1F62 A;  2IDA A;  4X3G A;  5G0F A;  2M1R A;  1WES A;  2G45 A;  2Y1M A;  2K4D A;  4ZUX U;  1Z2Q A;  2G43 A;  3L11 A;  2CSY A;  4XI1 A;  4F1P A;  4NN2 A;  2DSM A;  3ZVZ B;  3ZPV E;  2ECI A;  5SVI A;  3RPG B;  5H1T A;  4QQ4 A; 
#chains in the Genus database with same CATH homology
 2EXU A;  3MDB C;  3LVR E;  2P57 A;  2XOZ A;  2JUN A;  2CON A;  4OGE A;  2KKX A;  3O47 A;  5SVY A;  2M13 A;  1DCQ A;  4Z0R A;  4Z0O A;  2IQJ A;  3H7H A;  3LVQ E;  3FM8 C;  2YVR A;  3DWD A;  2B0O E;  4OGC A;  3SUB A;  5SVI B;  2D8U A;  2RR4 A;  2XOY A;  2LAU A;  3Q1D A;  3M7K A;  4O62 A;  2KKY A;  2FD4 A;  2YRE A;  2XOC A;  4H9D A;  3T9K A;  3LDY A;  2JM3 A;  2OWA A;  5K3Q A;  2DJA A;  4F1P A;  5SVX A;  2EGM A;  2E61 A;  3PLW A;  2CSV A;  3KDE C;  2FFW A;  2MKE A;  3DDT A;  2XP0 A;  3FEH A;  2CRW A;  3LJU X;  2L7P A;  3E2D A;  5SVI A;  2CRR A;  3FJU B;  4QQ4 A;  3JUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...