2JRJA

Solution structure of the human pirh2 ring-h2 domain. northeast structural genomics consortium target ht2b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Ring finger and CHY zinc finger domain containing protein 1
publication title Molecular basis of Pirh2-mediated p53 ubiquitylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jrjA00
1XWHA 4GNGA 2EA6A 3I2DA 2ECNA 3VK6A 2CKLB 4S3OB 3ZPVE 2MIQA 4S3OC 2F6NA 2EGPA 5C11A 2L75A 2LXPC 2Y1MA 1VD4A 2UZGA 3KV5A 4X3GA 2NAAA 2PNXA 4CCGX 2KWNA 2LQ6A 2KR4A 4B86C 5DINA 4LKAA 2L0BA 1WIMA 4NN2A 1MM3A 5LCWB 2VNFA 1WE9A 3SOWA 3LQJA 4V3LC 2LV9A 2MUMA 5TDWA 2KYUA 1G25A 2K4DA 4GNFA 2QICA 3GV4A 5TDRA 1JOCA 1HYJA 4AVXA 4B7YC 3U5PA 2KFTA 3LQHA 3MHHA 2QIZA 2MNYA 4YBSA 2VPEA 4PTBA 4I7CA 5B75A 2K16A 2M85A 1Z6UA 2C2LA 4R7EA 2LDRA 5FB0A 1VYXA 2CKLA 2QJ0A 4YBMA 5TRBA 2VPDA 3QZVA 4BHWA 5LKTA 1MM2A 2YU4A 3O7AA 2DX8A 4A4CA 2LGKA 3RPGC 5AIUA 4YABA 3LQIA 5LKUA 4XI1A 5AITA 2VJFA 2ECTA 3SHBA 4GNEA 3DQVR 5G0FA 3T7LA 3KQIA 2YHNA 2MA6A 4Q6FA 3V43A 2KIZA 2XB1A 4YATA 4UP5A 2D8SA 4WZ2A 2BAYA 2VJFB 3L1XA 2C2VS 4AYCA 1X4UA 2CSZA 3O70A 5B77A 2YHOA 3N9MA 2ECWA 2E6RA 4LADB 4R8PK 2M6MA 5H1UA 4AYCB 1HYIA 4FIPA 4P5OB 3M63A 2MD8C 4C9ZA 4I7BA 1X4IA 2LGGA 2YSMA 3C5KA 3L11A 5FB1A 2VP7A 2KU3A 3LRQA 2G6QA 2FUIA 2JMDA 5B78A 4ZQLA 2ECGA 4ZUXU 4PPEA 2MNZA 2H0DA 3EB5A 3O37A 1LDJB 3U5OA 2MD7B 4IC2A 2K17A 2VPGA 3O35A 3ASLA 2G45A 1FP0A 5G05B 2F42A 1WESA 3PHDA 5KH9A 4CA1A 2H0DB 4WA6A 3N9NA 4FK5A 1CHCA 3PUQA 3ZVYA 3M62A 2YSJA 2CT2A 2MT5A 2LRIC 2CSYA 5D1KB 4GB0A 2I50A 4ZDTA 1X4JA 4L58A 4V3KC 4I7DA 5TABA 3U5NA 5H1TA 2PUYA 2KGGA 5TBNA 2VJEA 2XEUA 1U6GB 4LJNA 4WZ0A 4MVTA 4LLBA 3O36A 4GNDA 1BORA 2VJEB 5KH3A 1WEQA 1WEPA 2YQLA 2RSDA 2LGVA 3T6RA 3O34A 5D1LB 2LN0A 4A49A 2ECIA 3ZNIA 2KE1A 1RMDA 4QF3A 2E6SA 3N9PA 2L43A 3ZPV1 1ZBDB 3FL2A 2ZETC 2KWJA 1Z60A 1VFYA 3N9LA 3HCTA 5FEYA 3NG2A 3HTKC 5FERA 2M3HA 2KWKA 2JMIA 3M99A 3ZVZB 2F6JA 5H9MA 3MHSA 4YBTA 1WGMA 3L1ZB 1DVPA 2KGIA 2Y1NA 5DKAA 1F62A 1WFKA 1JM7B 1WENA 2KWOA 2YQMA 5B79A 2YYRA 3GL6A 2JRJA 4L7XA 5B76A 2KREA 2IDAA 2EODA 3KV6A 5B8DA 2VPBA 2HYED 4R2YA 5C13A 4FO9A 4F52B 1WEOA 5EYAF 4WZ3B 4BBQA 1LDKC 2FSAA 2ECVA 4YADA 2M1RA 5LKZA 5D1MB 4O64A 4AP4A 4W4UA 5H1VA 3EB6A 2YREA 2G43A 1Z2QA 4LK9A 2HDPA 2ECJA 4YAXA 4IC3A 2JMJA 3SOXA 3ZYQA 2L5UA 1WEMA 5LKXA 1N87A 3SOUA 2AN6A 2LXHC 2Y43A 3KNVA 2K1JA 2MA5A 4AUQB 2L80A 1WILA 1IYMA 1WEEA 1E4UA 3N9QA 1WEVA 3PURA 4QF2A 4N3WA 4TKPB 5G04B 4MSXA 3U5MA 5JG6A 2LGLA 3DPLR 4FJCA 3IHPA 3ZTGA 1WEWA 3O33A 5KH7A 2FUUA 3RPGB 2YUCA 4A4BA 1V87A 3N9OA 5I3LA 3HCSA 1WEUA 1K2FA 5J3XA 4N4FA 4UI9B 2OXQC 1FBVA 4UP0A 2YURA 3C6WA 4YC9A 3RTRB 4A0CD 2YT5A 3HCUA 1JM7A 1T1HA 2RI7A 2YW8A
chains in the Genus database with same CATH superfamily
1XWHA 4GNGA 2EA6A 3I2DA 2EXUA 3LJUX 2ECNA 3VK6A 2CKLB 4S3OB 3ZPVE 4OGEA 2MIQA 4S3OC 2F6NA 4Z0OA 2EGPA 5C11A 2L75A 2LXPC 4F1PA 2Y1MA 1VD4A 2UZGA 3KV5A 4X3GA 2NAAA 2PNXA 4CCGX 2KWNA 2LQ6A 2KR4A 4B86C 5DINA 2CSVA 4LKAA 2L0BA 1WIMA 4NN2A 1MM3A 5LCWB 2VNFA 1WE9A 4O62A 3SOWA 3LQJA 4V3LC 2LV9A 2MUMA 2B0OE 5TDWA 2KYUA 1G25A 2FFWA 2K4DA 2KKXA 4GNFA 2QICA 3GV4A 2XOZA 5TDRA 1JOCA 1HYJA 4QQ4A 4AVXA 4B7YC 3U5PA 2KFTA 3LQHA 3MHHA 2QIZA 2MNYA 2XOCA 4YBSA 3H7HA 2VPEA 4PTBA 4I7CA 5B75A 2K16A 2M85A 1Z6UA 2C2LA 4R7EA 2LDRA 5FB0A 2MKEA 1VYXA 2CKLA 2QJ0A 3FJUB 3O47A 4YBMA 5TRBA 2VPDA 3QZVA 4Z0RA 4BHWA 5LKTA 1MM2A 2YU4A 3O7AA 3FANA 2DX8A 4A4CA 2LGKA 3RPGC 5AIUA 4YABA 3LQIA 5LKUA 4XI1A 5AITA 2VJFA 2ECTA 3SHBA 4GNEA 3DQVR 5G0FA 3T7LA 3KQIA 2D8UA 2MA6A 2YHNA 4Q6FA 3V43A 2KIZA 2XB1A 3KDEC 3LVQE 4YATA 4UP5A 2D8SA 4WZ2A 2BAYA 2VJFB 3L1XA 2C2VS 4AYCA 3E2DA 1X4UA 2CSZA 3O70A 5B77A 2YHOA 3N9MA 2ECWA 2E6RA 4LADB 4R8PK 2M6MA 5H1UA 5SVIB 4AYCB 1HYIA 4FIPA 3MDBC 4P5OB 3M63A 2MD8C 2CONA 4C9ZA 4I7BA 1X4IA 2LGGA 2YSMA 3C5KA 3L11A 5FB1A 2VP7A 2KU3A 3LRQA 3JUEA 2G6QA 3FEHA 2FUIA 2M13A 2JMDA 5B78A 4ZQLA 2ECGA 4ZUXU 4PPEA 2MNZA 2H0DA 3EB5A 3O37A 1LDJB 3U5OA 2MD7B 2LAUA 4IC2A 2K17A 2VPGA 3O35A 3ASLA 2G45A 1FP0A 5G05B 2F42A 3Q1DA 1WESA 2KKYA 3PHDA 5KH9A 4CA1A 2H0DB 4WA6A 5K3QA 2DJAA 2DSMA 3N9NA 5SVYA 4FK5A 1CHCA 3PUQA 3ZVYA 3M62A 2YSJA 2CT2A 2MT5A 2LRIC 2CSYA 5D1KB 4GB0A 2I50A 4ZDTA 1X4JA 3SUBA 4L58A 2RR4A 4V3KC 4I7DA 5TABA 3U5NA 5H1TA 3LVRE 2PUYA 2KGGA 5TBNA 2VJEA 2XEUA 5SVXA 1U6GB 3PLWA 4LJNA 4WZ0A 4MVTA 4H9DA 4LLBA 3O36A 4GNDA 1BORA 2VJEB 5KH3A 1WEQA 1WEPA 2YQLA 2RSDA 2LGVA 3T6RA 3O34A 5D1LB 2LN0A 4A49A 2ECIA 3ZNIA 2L7PA 2KE1A 5SVIA 2XOYA 2IQJA 1RMDA 4QF3A 2E6SA 3N9PA 2L43A 3ZPV1 1ZBDB 3FL2A 2ZETC 2KWJA 1Z60A 1VFYA 3N9LA 3HCTA 5FEYA 3NG2A 3HTKC 5FERA 2M3HA 2KWKA 2JMIA 3M99A 3ZVZB 2F6JA 2JUNA 5H9MA 3MHSA 4YBTA 1WGMA 3L1ZB 1DVPA 2KGIA 2Y1NA 2YVRA 5DKAA 3T9KA 1F62A 2E61A 1WFKA 1JM7B 1WENA 2KWOA 2YQMA 5B79A 2YYRA 3GL6A 2JRJA 4L7XA 5B76A 2KREA 2IDAA 2EODA 3KV6A 5B8DA 2VPBA 2FD4A 2HYED 4R2YA 5C13A 4FO9A 4F52B 1WEOA 5EYAF 4WZ3B 4BBQA 3FAOA 1LDKC 2FSAA 2ECVA 4YADA 2M1RA 5LKZA 1MBMA 5D1MB 2CRRA 4O64A 4AP4A 4W4UA 5H1VA 3EB6A 2YREA 2G43A 1Z2QA 4LK9A 2HDPA 2ECJA 4YAXA 4IC3A 2JMJA 3SOXA 3ZYQA 2L5UA 1WEMA 5LKXA 1N87A 3SOUA 2AN6A 2LXHC 3DWDA 2Y43A 3KNVA 2K1JA 2MA5A 3DDTA 4AUQB 2L80A 1WILA 3M7KA 1IYMA 2CRWA 1WEEA 1E4UA 3N9QA 1WEVA 3PURA 2EGMA 1DCQA 4OGCA 3FM8C 4QF2A 4N3WA 4TKPB 5G04B 4MSXA 2XP0A 3U5MA 5JG6A 2LGLA 3DPLR 4FJCA 2JM3A 3IHPA 3ZTGA 1WEWA 3O33A 5KH7A 2FUUA 3RPGB 2YUCA 4A4BA 1V87A 3N9OA 5I3LA 3HCSA 1WEUA 1K2FA 5J3XA 4N4FA 4UI9B 2OXQC 1FBVA 4UP0A 2YURA 2OWAA 3C6WA 4YC9A 3RTRB 4A0CD 2YT5A 2P57A 3HCUA 1JM7A 3LDYA 1T1HA 2RI7A 2YW8A
chains in the Genus database with same CATH topology
1XWHA 4GNGA 2EA6A 3I2DA 2ECNA 3VK6A 2CKLB 4S3OB 3ZPVE 2MIQA 4S3OC 2F6NA 2EGPA 5C11A 2L75A 2LXPC 2Y1MA 1VD4A 2UZGA 3KV5A 4X3GA 2NAAA 2PNXA 4CCGX 2KWNA 2LQ6A 2KR4A 4B86C 5DINA 4LKAA 2L0BA 1WIMA 4NN2A 1MM3A 5LCWB 2VNFA 1WE9A 3SOWA 3LQJA 4V3LC 2LV9A 2MUMA 5TDWA 2KYUA 1G25A 2K4DA 4GNFA 2QICA 3GV4A 5TDRA 1JOCA 1HYJA 4AVXA 4B7YC 3U5PA 2KFTA 3LQHA 3MHHA 2QIZA 2MNYA 4YBSA 2VPEA 4PTBA 4I7CA 5B75A 2K16A 2M85A 1Z6UA 2C2LA 4R7EA 2LDRA 5FB0A 1VYXA 2CKLA 2QJ0A 4YBMA 5TRBA 2VPDA 3QZVA 4BHWA 5LKTA 1MM2A 2YU4A 3O7AA 2DX8A 4A4CA 2LGKA 3RPGC 5AIUA 4YABA 3LQIA 5LKUA 4XI1A 5AITA 2VJFA 2ECTA 3SHBA 4GNEA 3DQVR 5G0FA 3T7LA 3KQIA 2YHNA 2MA6A 4Q6FA 3V43A 2KIZA 2XB1A 4YATA 4UP5A 2D8SA 4WZ2A 2BAYA 2VJFB 3L1XA 2C2VS 4AYCA 1X4UA 2CSZA 3O70A 5B77A 2YHOA 3N9MA 2ECWA 2E6RA 4LADB 4R8PK 2M6MA 5H1UA 4AYCB 1HYIA 4FIPA 4P5OB 3M63A 2MD8C 4C9ZA 4I7BA 1X4IA 2LGGA 2YSMA 3C5KA 3L11A 5FB1A 2VP7A 2KU3A 3LRQA 2G6QA 2FUIA 2JMDA 5B78A 4ZQLA 2ECGA 4ZUXU 4PPEA 2MNZA 2H0DA 3EB5A 3O37A 1LDJB 3U5OA 2MD7B 4IC2A 2K17A 2VPGA 3O35A 3ASLA 2G45A 1FP0A 5G05B 2F42A 1WESA 3PHDA 5KH9A 4CA1A 2H0DB 4WA6A 3N9NA 4FK5A 1CHCA 3PUQA 3ZVYA 3M62A 2YSJA 2CT2A 2MT5A 2LRIC 2CSYA 5D1KB 4GB0A 2I50A 4ZDTA 1X4JA 4L58A 4V3KC 4I7DA 5TABA 3U5NA 5H1TA 2PUYA 2KGGA 5TBNA 2VJEA 2XEUA 1U6GB 4LJNA 4WZ0A 4MVTA 4LLBA 3O36A 4GNDA 1BORA 2VJEB 5KH3A 1WEQA 1WEPA 2YQLA 2RSDA 2LGVA 3T6RA 3O34A 5D1LB 2LN0A 4A49A 2ECIA 3ZNIA 2KE1A 1RMDA 4QF3A 2E6SA 3N9PA 2L43A 3ZPV1 1ZBDB 3FL2A 2ZETC 2KWJA 1Z60A 1VFYA 3N9LA 3HCTA 5FEYA 3NG2A 3HTKC 5FERA 2M3HA 2KWKA 2JMIA 3M99A 3ZVZB 2F6JA 5H9MA 3MHSA 4YBTA 1WGMA 3L1ZB 1DVPA 2KGIA 2Y1NA 5DKAA 1F62A 1WFKA 1JM7B 1WENA 2KWOA 2YQMA 5B79A 2YYRA 3GL6A 2JRJA 4L7XA 5B76A 2KREA 2IDAA 2EODA 3KV6A 5B8DA 2VPBA 2HYED 4R2YA 5C13A 4FO9A 4F52B 1WEOA 5EYAF 4WZ3B 4BBQA 1LDKC 2FSAA 2ECVA 4YADA 2M1RA 5LKZA 5D1MB 4O64A 4AP4A 4W4UA 5H1VA 3EB6A 2YREA 2G43A 1Z2QA 4LK9A 2HDPA 2ECJA 4YAXA 4IC3A 2JMJA 3SOXA 3ZYQA 2L5UA 1WEMA 5LKXA 1N87A 3SOUA 2AN6A 2LXHC 2Y43A 3KNVA 2K1JA 2MA5A 4AUQB 2L80A 1WILA 1IYMA 1WEEA 1E4UA 3N9QA 1WEVA 3PURA 4QF2A 4N3WA 4TKPB 5G04B 4MSXA 3U5MA 5JG6A 2LGLA 3DPLR 4FJCA 3IHPA 3ZTGA 1WEWA 3O33A 5KH7A 2FUUA 3RPGB 2YUCA 4A4BA 1V87A 3N9OA 5I3LA 3HCSA 1WEUA 1K2FA 5J3XA 4N4FA 4UI9B 2OXQC 1FBVA 4UP0A 2YURA 3C6WA 4YC9A 3RTRB 4A0CD 2YT5A 3HCUA 1JM7A 1T1HA 2RI7A 2YW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWH A;  4GNG A;  2EA6 A;  3I2D A;  2ECN A;  3VK6 A;  2CKL B;  4S3O B;  3ZPV E;  2MIQ A;  4S3O C;  2F6N A;  2EGP A;  5C11 A;  2L75 A;  2LXP C;  2Y1M A;  1VD4 A;  2UZG A;  3KV5 A;  4X3G A;  2NAA A;  2PNX A;  4CCG X;  2KWN A;  2LQ6 A;  2KR4 A;  4B86 C;  5DIN A;  4LKA A;  2L0B A;  1WIM A;  4NN2 A;  1MM3 A;  5LCW B;  2VNF A;  1WE9 A;  3SOW A;  3LQJ A;  4V3L C;  2LV9 A;  2MUM A;  5TDW A;  2KYU A;  1G25 A;  2K4D A;  4GNF A;  2QIC A;  3GV4 A;  5TDR A;  1JOC A;  1HYJ A;  4AVX A;  4B7Y C;  3U5P A;  2KFT A;  3LQH A;  3MHH A;  2QIZ A;  2MNY A;  4YBS A;  2VPE A;  4PTB A;  4I7C A;  5B75 A;  2K16 A;  2M85 A;  1Z6U A;  2C2L A;  4R7E A;  2LDR A;  5FB0 A;  1VYX A;  2CKL A;  2QJ0 A;  4YBM A;  5TRB A;  2VPD A;  3QZV A;  4BHW A;  5LKT A;  1MM2 A;  2YU4 A;  3O7A A;  2DX8 A;  4A4C A;  2LGK A;  3RPG C;  5AIU A;  4YAB A;  3LQI A;  5LKU A;  4XI1 A;  5AIT A;  2VJF A;  2ECT A;  3SHB A;  4GNE A;  3DQV R;  5G0F A;  3T7L A;  3KQI A;  2YHN A;  2MA6 A;  4Q6F A;  3V43 A;  2KIZ A;  2XB1 A;  4YAT A;  4UP5 A;  2D8S A;  4WZ2 A;  2BAY A;  2VJF B;  3L1X A;  2C2V S;  4AYC A;  1X4U A;  2CSZ A;  3O70 A;  5B77 A;  2YHO A;  3N9M A;  2ECW A;  2E6R A;  4LAD B;  4R8P K;  2M6M A;  5H1U A;  4AYC B;  1HYI A;  4FIP A;  4P5O B;  3M63 A;  2MD8 C;  4C9Z A;  4I7B A;  1X4I A;  2LGG A;  2YSM A;  3C5K A;  3L11 A;  5FB1 A;  2VP7 A;  2KU3 A;  3LRQ A;  2G6Q A;  2FUI A;  2JMD A;  5B78 A;  4ZQL A;  2ECG A;  4ZUX U;  4PPE A;  2MNZ A;  2H0D A;  3EB5 A;  3O37 A;  1LDJ B;  3U5O A;  2MD7 B;  4IC2 A;  2K17 A;  2VPG A;  3O35 A;  3ASL A;  2G45 A;  1FP0 A;  5G05 B;  2F42 A;  1WES A;  3PHD A;  5KH9 A;  4CA1 A;  2H0D B;  4WA6 A;  3N9N A;  4FK5 A;  1CHC A;  3PUQ A;  3ZVY A;  3M62 A;  2YSJ A;  2CT2 A;  2MT5 A;  2LRI C;  2CSY A;  5D1K B;  4GB0 A;  2I50 A;  4ZDT A;  1X4J A;  4L58 A;  4V3K C;  4I7D A;  5TAB A;  3U5N A;  5H1T A;  2PUY A;  2KGG A;  5TBN A;  2VJE A;  2XEU A;  1U6G B;  4LJN A;  4WZ0 A;  4MVT A;  4LLB A;  3O36 A;  4GND A;  1BOR A;  2VJE B;  5KH3 A;  1WEQ A;  1WEP A;  2YQL A;  2RSD A;  2LGV A;  3T6R A;  3O34 A;  5D1L B;  2LN0 A;  4A49 A;  2ECI A;  3ZNI A;  2KE1 A;  1RMD A;  4QF3 A;  2E6S A;  3N9P A;  2L43 A;  3ZPV 1;  1ZBD B;  3FL2 A;  2ZET C;  2KWJ A;  1Z60 A;  1VFY A;  3N9L A;  3HCT A;  5FEY A;  3NG2 A;  3HTK C;  5FER A;  2M3H A;  2KWK A;  2JMI A;  3M99 A;  3ZVZ B;  2F6J A;  5H9M A;  3MHS A;  4YBT A;  1WGM A;  3L1Z B;  1DVP A;  2KGI A;  2Y1N A;  5DKA A;  1F62 A;  1WFK A;  1JM7 B;  1WEN A;  2KWO A;  2YQM A;  5B79 A;  2YYR A;  3GL6 A;  2JRJ A;  4L7X A;  5B76 A;  2KRE A;  2IDA A;  2EOD A;  3KV6 A;  5B8D A;  2VPB A;  2HYE D;  4R2Y A;  5C13 A;  4FO9 A;  4F52 B;  1WEO A;  5EYA F;  4WZ3 B;  4BBQ A;  1LDK C;  2FSA A;  2ECV A;  4YAD A;  2M1R A;  5LKZ A;  5D1M B;  4O64 A;  4AP4 A;  4W4U A;  5H1V A;  3EB6 A;  2YRE A;  2G43 A;  1Z2Q A;  4LK9 A;  2HDP A;  2ECJ A;  4YAX A;  4IC3 A;  2JMJ A;  3SOX A;  3ZYQ A;  2L5U A;  1WEM A;  5LKX A;  1N87 A;  3SOU A;  2AN6 A;  2LXH C;  2Y43 A;  3KNV A;  2K1J A;  2MA5 A;  4AUQ B;  2L80 A;  1WIL A;  1IYM A;  1WEE A;  1E4U A;  3N9Q A;  1WEV A;  3PUR A;  4QF2 A;  4N3W A;  4TKP B;  5G04 B;  4MSX A;  3U5M A;  5JG6 A;  2LGL A;  3DPL R;  4FJC A;  3IHP A;  3ZTG A;  1WEW A;  3O33 A;  5KH7 A;  2FUU A;  3RPG B;  2YUC A;  4A4B A;  1V87 A;  3N9O A;  5I3L A;  3HCS A;  1WEU A;  1K2F A;  5J3X A;  4N4F A;  4UI9 B;  2OXQ C;  1FBV A;  4UP0 A;  2YUR A;  3C6W A;  4YC9 A;  3RTR B;  4A0C D;  2YT5 A;  3HCU A;  1JM7 A;  1T1H A;  2RI7 A;  2YW8 A; 
#chains in the Genus database with same CATH topology
 1XWH A;  4GNG A;  2EA6 A;  3I2D A;  2EXU A;  3LJU X;  2ECN A;  3VK6 A;  2CKL B;  4S3O B;  3ZPV E;  4OGE A;  2MIQ A;  4S3O C;  2F6N A;  4Z0O A;  2EGP A;  5C11 A;  2L75 A;  2LXP C;  4F1P A;  2Y1M A;  1VD4 A;  2UZG A;  3KV5 A;  4X3G A;  2NAA A;  2PNX A;  4CCG X;  2KWN A;  2LQ6 A;  2KR4 A;  4B86 C;  5DIN A;  2CSV A;  4LKA A;  2L0B A;  1WIM A;  4NN2 A;  1MM3 A;  5LCW B;  2VNF A;  1WE9 A;  4O62 A;  3SOW A;  3LQJ A;  4V3L C;  2LV9 A;  2MUM A;  2B0O E;  5TDW A;  2KYU A;  1G25 A;  2FFW A;  2K4D A;  2KKX A;  4GNF A;  2QIC A;  3GV4 A;  2XOZ A;  5TDR A;  1JOC A;  1HYJ A;  4QQ4 A;  4AVX A;  4B7Y C;  3U5P A;  2KFT A;  3LQH A;  3MHH A;  2QIZ A;  2MNY A;  2XOC A;  4YBS A;  3H7H A;  2VPE A;  4PTB A;  4I7C A;  5B75 A;  2K16 A;  2M85 A;  1Z6U A;  2C2L A;  4R7E A;  2LDR A;  5FB0 A;  2MKE A;  1VYX A;  2CKL A;  2QJ0 A;  3FJU B;  3O47 A;  4YBM A;  5TRB A;  2VPD A;  3QZV A;  4Z0R A;  4BHW A;  5LKT A;  1MM2 A;  2YU4 A;  3O7A A;  3FAN A;  2DX8 A;  4A4C A;  2LGK A;  3RPG C;  5AIU A;  4YAB A;  3LQI A;  5LKU A;  4XI1 A;  5AIT A;  2VJF A;  2ECT A;  3SHB A;  4GNE A;  3DQV R;  5G0F A;  3T7L A;  3KQI A;  2D8U A;  2MA6 A;  2YHN A;  4Q6F A;  3V43 A;  2KIZ A;  2XB1 A;  3KDE C;  3LVQ E;  4YAT A;  4UP5 A;  2D8S A;  4WZ2 A;  2BAY A;  2VJF B;  3L1X A;  2C2V S;  4AYC A;  3E2D A;  1X4U A;  2CSZ A;  3O70 A;  5B77 A;  2YHO A;  3N9M A;  2ECW A;  2E6R A;  4LAD B;  4R8P K;  2M6M A;  5H1U A;  5SVI B;  4AYC B;  1HYI A;  4FIP A;  3MDB C;  4P5O B;  3M63 A;  2MD8 C;  2CON A;  4C9Z A;  4I7B A;  1X4I A;  2LGG A;  2YSM A;  3C5K A;  3L11 A;  5FB1 A;  2VP7 A;  2KU3 A;  3LRQ A;  3JUE A;  2G6Q A;  3FEH A;  2FUI A;  2M13 A;  2JMD A;  5B78 A;  4ZQL A;  2ECG A;  4ZUX U;  4PPE A;  2MNZ A;  2H0D A;  3EB5 A;  3O37 A;  1LDJ B;  3U5O A;  2MD7 B;  2LAU A;  4IC2 A;  2K17 A;  2VPG A;  3O35 A;  3ASL A;  2G45 A;  1FP0 A;  5G05 B;  2F42 A;  3Q1D A;  1WES A;  2KKY A;  3PHD A;  5KH9 A;  4CA1 A;  2H0D B;  4WA6 A;  5K3Q A;  2DJA A;  2DSM A;  3N9N A;  5SVY A;  4FK5 A;  1CHC A;  3PUQ A;  3ZVY A;  3M62 A;  2YSJ A;  2CT2 A;  2MT5 A;  2LRI C;  2CSY A;  5D1K B;  4GB0 A;  2I50 A;  4ZDT A;  1X4J A;  3SUB A;  4L58 A;  2RR4 A;  4V3K C;  4I7D A;  5TAB A;  3U5N A;  5H1T A;  3LVR E;  2PUY A;  2KGG A;  5TBN A;  2VJE A;  2XEU A;  5SVX A;  1U6G B;  3PLW A;  4LJN A;  4WZ0 A;  4MVT A;  4H9D A;  4LLB A;  3O36 A;  4GND A;  1BOR A;  2VJE B;  5KH3 A;  1WEQ A;  1WEP A;  2YQL A;  2RSD A;  2LGV A;  3T6R A;  3O34 A;  5D1L B;  2LN0 A;  4A49 A;  2ECI A;  3ZNI A;  2L7P A;  2KE1 A;  5SVI A;  2XOY A;  2IQJ A;  1RMD A;  4QF3 A;  2E6S A;  3N9P A;  2L43 A;  3ZPV 1;  1ZBD B;  3FL2 A;  2ZET C;  2KWJ A;  1Z60 A;  1VFY A;  3N9L A;  3HCT A;  5FEY A;  3NG2 A;  3HTK C;  5FER A;  2M3H A;  2KWK A;  2JMI A;  3M99 A;  3ZVZ B;  2F6J A;  2JUN A;  5H9M A;  3MHS A;  4YBT A;  1WGM A;  3L1Z B;  1DVP A;  2KGI A;  2Y1N A;  2YVR A;  5DKA A;  3T9K A;  1F62 A;  2E61 A;  1WFK A;  1JM7 B;  1WEN A;  2KWO A;  2YQM A;  5B79 A;  2YYR A;  3GL6 A;  2JRJ A;  4L7X A;  5B76 A;  2KRE A;  2IDA A;  2EOD A;  3KV6 A;  5B8D A;  2VPB A;  2FD4 A;  2HYE D;  4R2Y A;  5C13 A;  4FO9 A;  4F52 B;  1WEO A;  5EYA F;  4WZ3 B;  4BBQ A;  3FAO A;  1LDK C;  2FSA A;  2ECV A;  4YAD A;  2M1R A;  5LKZ A;  1MBM A;  5D1M B;  2CRR A;  4O64 A;  4AP4 A;  4W4U A;  5H1V A;  3EB6 A;  2YRE A;  2G43 A;  1Z2Q A;  4LK9 A;  2HDP A;  2ECJ A;  4YAX A;  4IC3 A;  2JMJ A;  3SOX A;  3ZYQ A;  2L5U A;  1WEM A;  5LKX A;  1N87 A;  3SOU A;  2AN6 A;  2LXH C;  3DWD A;  2Y43 A;  3KNV A;  2K1J A;  2MA5 A;  3DDT A;  4AUQ B;  2L80 A;  1WIL A;  3M7K A;  1IYM A;  2CRW A;  1WEE A;  1E4U A;  3N9Q A;  1WEV A;  3PUR A;  2EGM A;  1DCQ A;  4OGC A;  3FM8 C;  4QF2 A;  4N3W A;  4TKP B;  5G04 B;  4MSX A;  2XP0 A;  3U5M A;  5JG6 A;  2LGL A;  3DPL R;  4FJC A;  2JM3 A;  3IHP A;  3ZTG A;  1WEW A;  3O33 A;  5KH7 A;  2FUU A;  3RPG B;  2YUC A;  4A4B A;  1V87 A;  3N9O A;  5I3L A;  3HCS A;  1WEU A;  1K2F A;  5J3X A;  4N4F A;  4UI9 B;  2OXQ C;  1FBV A;  4UP0 A;  2YUR A;  2OWA A;  3C6W A;  4YC9 A;  3RTR B;  4A0C D;  2YT5 A;  2P57 A;  3HCU A;  1JM7 A;  3LDY A;  1T1H A;  2RI7 A;  2YW8 A; 
#chains in the Genus database with same CATH homology
 1XWH A;  4GNG A;  2EA6 A;  3I2D A;  2ECN A;  3VK6 A;  2CKL B;  4S3O B;  3ZPV E;  2MIQ A;  4S3O C;  2F6N A;  2EGP A;  5C11 A;  2L75 A;  2LXP C;  2Y1M A;  1VD4 A;  2UZG A;  3KV5 A;  4X3G A;  2NAA A;  2PNX A;  4CCG X;  2KWN A;  2LQ6 A;  2KR4 A;  4B86 C;  5DIN A;  4LKA A;  2L0B A;  1WIM A;  4NN2 A;  1MM3 A;  5LCW B;  2VNF A;  1WE9 A;  3SOW A;  3LQJ A;  4V3L C;  2LV9 A;  2MUM A;  5TDW A;  2KYU A;  1G25 A;  2K4D A;  4GNF A;  2QIC A;  3GV4 A;  5TDR A;  1JOC A;  1HYJ A;  4AVX A;  4B7Y C;  3U5P A;  2KFT A;  3LQH A;  3MHH A;  2QIZ A;  2MNY A;  4YBS A;  2VPE A;  4PTB A;  4I7C A;  5B75 A;  2K16 A;  2M85 A;  1Z6U A;  2C2L A;  4R7E A;  2LDR A;  5FB0 A;  1VYX A;  2CKL A;  2QJ0 A;  4YBM A;  5TRB A;  2VPD A;  3QZV A;  4BHW A;  5LKT A;  1MM2 A;  2YU4 A;  3O7A A;  2DX8 A;  4A4C A;  2LGK A;  3RPG C;  5AIU A;  4YAB A;  3LQI A;  5LKU A;  4XI1 A;  5AIT A;  2VJF A;  2ECT A;  3SHB A;  4GNE A;  3DQV R;  5G0F A;  3T7L A;  3KQI A;  2YHN A;  2MA6 A;  4Q6F A;  3V43 A;  2KIZ A;  2XB1 A;  4YAT A;  4UP5 A;  2D8S A;  4WZ2 A;  2BAY A;  2VJF B;  3L1X A;  2C2V S;  4AYC A;  1X4U A;  2CSZ A;  3O70 A;  5B77 A;  2YHO A;  3N9M A;  2ECW A;  2E6R A;  4LAD B;  4R8P K;  2M6M A;  5H1U A;  4AYC B;  1HYI A;  4FIP A;  4P5O B;  3M63 A;  2MD8 C;  4C9Z A;  4I7B A;  1X4I A;  2LGG A;  2YSM A;  3C5K A;  3L11 A;  5FB1 A;  2VP7 A;  2KU3 A;  3LRQ A;  2G6Q A;  2FUI A;  2JMD A;  5B78 A;  4ZQL A;  2ECG A;  4ZUX U;  4PPE A;  2MNZ A;  2H0D A;  3EB5 A;  3O37 A;  1LDJ B;  3U5O A;  2MD7 B;  4IC2 A;  2K17 A;  2VPG A;  3O35 A;  3ASL A;  2G45 A;  1FP0 A;  5G05 B;  2F42 A;  1WES A;  3PHD A;  5KH9 A;  4CA1 A;  2H0D B;  4WA6 A;  3N9N A;  4FK5 A;  1CHC A;  3PUQ A;  3ZVY A;  3M62 A;  2YSJ A;  2CT2 A;  2MT5 A;  2LRI C;  2CSY A;  5D1K B;  4GB0 A;  2I50 A;  4ZDT A;  1X4J A;  4L58 A;  4V3K C;  4I7D A;  5TAB A;  3U5N A;  5H1T A;  2PUY A;  2KGG A;  5TBN A;  2VJE A;  2XEU A;  1U6G B;  4LJN A;  4WZ0 A;  4MVT A;  4LLB A;  3O36 A;  4GND A;  1BOR A;  2VJE B;  5KH3 A;  1WEQ A;  1WEP A;  2YQL A;  2RSD A;  2LGV A;  3T6R A;  3O34 A;  5D1L B;  2LN0 A;  4A49 A;  2ECI A;  3ZNI A;  2KE1 A;  1RMD A;  4QF3 A;  2E6S A;  3N9P A;  2L43 A;  3ZPV 1;  1ZBD B;  3FL2 A;  2ZET C;  2KWJ A;  1Z60 A;  1VFY A;  3N9L A;  3HCT A;  5FEY A;  3NG2 A;  3HTK C;  5FER A;  2M3H A;  2KWK A;  2JMI A;  3M99 A;  3ZVZ B;  2F6J A;  5H9M A;  3MHS A;  4YBT A;  1WGM A;  3L1Z B;  1DVP A;  2KGI A;  2Y1N A;  5DKA A;  1F62 A;  1WFK A;  1JM7 B;  1WEN A;  2KWO A;  2YQM A;  5B79 A;  2YYR A;  3GL6 A;  2JRJ A;  4L7X A;  5B76 A;  2KRE A;  2IDA A;  2EOD A;  3KV6 A;  5B8D A;  2VPB A;  2HYE D;  4R2Y A;  5C13 A;  4FO9 A;  4F52 B;  1WEO A;  5EYA F;  4WZ3 B;  4BBQ A;  1LDK C;  2FSA A;  2ECV A;  4YAD A;  2M1R A;  5LKZ A;  5D1M B;  4O64 A;  4AP4 A;  4W4U A;  5H1V A;  3EB6 A;  2YRE A;  2G43 A;  1Z2Q A;  4LK9 A;  2HDP A;  2ECJ A;  4YAX A;  4IC3 A;  2JMJ A;  3SOX A;  3ZYQ A;  2L5U A;  1WEM A;  5LKX A;  1N87 A;  3SOU A;  2AN6 A;  2LXH C;  2Y43 A;  3KNV A;  2K1J A;  2MA5 A;  4AUQ B;  2L80 A;  1WIL A;  1IYM A;  1WEE A;  1E4U A;  3N9Q A;  1WEV A;  3PUR A;  4QF2 A;  4N3W A;  4TKP B;  5G04 B;  4MSX A;  3U5M A;  5JG6 A;  2LGL A;  3DPL R;  4FJC A;  3IHP A;  3ZTG A;  1WEW A;  3O33 A;  5KH7 A;  2FUU A;  3RPG B;  2YUC A;  4A4B A;  1V87 A;  3N9O A;  5I3L A;  3HCS A;  1WEU A;  1K2F A;  5J3X A;  4N4F A;  4UI9 B;  2OXQ C;  1FBV A;  4UP0 A;  2YUR A;  3C6W A;  4YC9 A;  3RTR B;  4A0C D;  2YT5 A;  3HCU A;  1JM7 A;  1T1H A;  2RI7 A;  2YW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...