2JRJA

Solution structure of the human pirh2 ring-h2 domain. northeast structural genomics consortium target ht2b
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
ENVSQQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ring finger and CHY zinc finger domain containing protein 1
publication title Molecular basis of Pirh2-mediated p53 ubiquitylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2jrjA00
3GV4A 2UZGA 3LQIA 4YAXA 2AN6A 2FUUA 3N9LA 1K2FA 5TDRA 1WGMA 5D1KB 2KE1A 2E6SA 5TRBA 2VPBA 3DPLR 2YHOA 1JOCA 4R2YA 2CSYA 1WEQA 2MT5A 2EGPA 1WIMA 1WEUA 4A49A 1MM3A 5H1VA 3M62A 4B7YC 4P5OB 5KH9A 3ZYQA 4V3KC 2K4DA 2VJFB 2MIQA 5G0FA 2CT2A 2ECTA 4W4UA 2BAYA 2PNXA 2KWKA 2YYRA 1HYJA 2Y1NA 3L11A 4YBSA 1JM7A 2ECGA 4R8PK 2YT5A 5B78A 1MM2A 4BBQA 2KGIA 4I7BA 4LK9A 2XB1A 1VD4A 4ZDTA 4GNEA 3EB5A 1WFKA 1Z6UA 3SOXA 5B79A 2CSZA 5C13A 2YURA 2KREA 4GB0A 3ZNIA 5C11A 2VJEA 2G45A 3ZPV1 2YU4A 4AYCB 3LRQA 3HCSA 2MNZA 5KH7A 2RSDA 2LGLA 3V43A 4B86C 4GNDA 4LJNA 4ZQLA 2NAAA 3EB6A 2L43A 4O64A 2QJ0A 4IC3A 4F52B 4AVXA 5H1TA 2JMDA 2L75A 3O70A 1FP0A 3C6WA 4GNFA 2L5UA 1HYIA 2VNFA 3RPGB 4MVTA 3KV5A 4AUQB 2VP7A 5TDWA 1VYXA 2KIZA 3DQVR 4ZUXU 2LQ6A 4CCGX 4YATA 2QIZA 4IC2A 5FEYA 1N87A 1U6GB 5G04B 2OXQC 4TKPB 3KV6A 2VPGA 2YQMA 2CKLB 3SOUA 2F6JA 5H1UA 5FB0A 2Y1MA 3ZTGA 3ASLA 2PUYA 3N9OA 3O35A 2K17A 3ZVZB 2LGGA 2FUIA 1X4UA 4PPEA 3U5OA 3MHHA 1WEMA 2MD7B 1LDJB 3U5NA 5TABA 4Q6FA 2JMIA 1RMDA 2QICA 4FK5A 1IYMA 4FIPA 5H9MA 2KFTA 2MA6A 5AITA 5G05B 5B76A 2ECJA 1WILA 2ECNA 5B77A 5KH3A 4NN2A 5LKZA 2K1JA 1CHCA 1X4JA 3SHBA 3FL2A 4YBTA 4X3GA 3PHDA 3T7LA 4WZ3B 4UI9B 2FSAA 3VK6A 2VJFA 2LN0A 4A4CA 1WEEA 4BHWA 1ZBDB 4YADA 4N4FA 5LKXA 1WENA 4L58A 1VFYA 2MD8C 5B8DA 2JMJA 1F62A 4PTBA 2LGKA 2F42A 2KGGA 4CA1A 3MHSA 2YHNA 2MA5A 2MNYA 4FO9A 1FBVA 3C5KA 3HCUA 5B75A 3LQHA 2YSMA 4UP5A 2YQLA 3ZVYA 5D1MB 2HYED 4WZ2A 3O7AA 2E6RA 4UP0A 3O33A 2KU3A 5EYAF 4AYCA 4N3WA 3U5MA 4AP4A 1G25A 2LRIC 1LDKC 2I50A 2L80A 5DINA 1Z60A 3N9NA 2YW8A 4WA6A 2EA6A 2G6QA 1XWHA 4QF3A 1BORA 4QF2A 1WEVA 3QZVA 4A0CD 4YABA 2D8SA 2KWNA 3O37A 2EODA 4XI1A 1JM7B 1WE9A 2MUMA 2LXPC 5TBNA 2KWJA 4I7DA 5FB1A 5D1LB 2M3HA 5LKUA 5AIUA 4WZ0A 2RI7A 4L7XA 3ZPVE 3O36A 2YSJA 1T1HA 5I3LA 4V3LC 2CKLA 4YC9A 3RPGC 3GL6A 2LDRA 3SOWA 2VPEA 3N9PA 2YUCA 4S3OB 4FJCA 3L1XA 2ECIA 2C2VS 1DVPA 2C2LA 3M63A 2VJEB 4LADB 4GNGA 4LLBA 4YBMA 2H0DB 3NG2A 3PURA 5FERA 3O34A 2HDPA 1WEWA 4A4BA 5JG6A 3RTRB 3I2DA 2ECVA 2LXHC 4LKAA 2DX8A 5LCWB 4R7EA 2M85A 1WEOA 2KWOA 2K16A 2Y43A 3LQJA 2G43A 1V87A 2ECWA 2VPDA 3N9QA 4MSXA 2KR4A 1WESA 3IHPA 3N9MA 3PUQA 4I7CA 2M6MA 5LKTA 2XEUA 2L0BA 3M99A 2H0DA 3T6RA 2LV9A 5DKAA 1X4IA 5J3XA 4S3OC 2M1RA 1Z2QA 1E4UA 2KYUA 3HCTA 2LGVA 1WEPA 2F6NA 2YREA 3HTKC 3KQIA 3KNVA 2JRJA 3L1ZB 2ZETC 3U5PA 2IDAA 4C9ZA
chains in the Genus database with same CATH superfamily
3FEHA 3GV4A 2UZGA 3LQIA 4YAXA 2AN6A 2FUUA 3N9LA 2KKXA 1K2FA 5TDRA 1WGMA 5D1KB 2KE1A 2E6SA 5TRBA 2VPBA 3DPLR 2YHOA 2DSMA 1JOCA 4R2YA 2CSYA 1WEQA 2MT5A 2EGPA 1WIMA 1WEUA 4A49A 1MM3A 5SVYA 5H1VA 3M62A 2XOYA 4B7YC 4P5OB 5KH9A 3ZYQA 2XP0A 4V3KC 2K4DA 2FFWA 2P57A 2VJFB 2MIQA 5G0FA 3DDTA 2CT2A 2ECTA 4W4UA 2BAYA 2PNXA 2KWKA 2YYRA 3SUBA 1HYJA 4O62A 2Y1NA 3L11A 4YBSA 1JM7A 2ECGA 4R8PK 2YT5A 3H7HA 5B78A 1MM2A 4BBQA 2KGIA 4I7BA 4LK9A 2XB1A 1VD4A 4OGCA 3PLWA 4ZDTA 4GNEA 3EB5A 1WFKA 1Z6UA 3SOXA 4Z0OA 5B79A 2KKYA 2CSZA 2B0OE 5C13A 2RR4A 2YURA 2KREA 4GB0A 3ZNIA 5C11A 2VJEA 2G45A 2XOZA 5K3QA 3ZPV1 2YU4A 4AYCB 1DCQA 3LRQA 3FAOA 3HCSA 2MNZA 5KH7A 2RSDA 3LDYA 2LGLA 4Z0RA 3V43A 4B86C 4GNDA 4LJNA 4ZQLA 2NAAA 3EB6A 2L43A 4O64A 2QJ0A 4IC3A 4F52B 4AVXA 5H1TA 2JMDA 2L75A 3O70A 1FP0A 2DJAA 3C6WA 4GNFA 3O47A 2L5UA 1HYIA 2JM3A 2VNFA 3RPGB 3LVRE 4MVTA 3KV5A 4AUQB 2VP7A 5TDWA 1VYXA 2KIZA 3DQVR 4ZUXU 2LQ6A 4CCGX 4YATA 2QIZA 4IC2A 5FEYA 2LAUA 3FANA 1N87A 1U6GB 5G04B 2OXQC 4TKPB 3KV6A 2VPGA 2YQMA 2CKLB 3SOUA 2F6JA 2M13A 5H1UA 5FB0A 2Y1MA 3ZTGA 3ASLA 2PUYA 3N9OA 3O35A 2K17A 3ZVZB 2LGGA 2FUIA 1X4UA 4PPEA 3T9KA 3MHHA 1WEMA 3U5OA 4QQ4A 2MD7B 1LDJB 3U5NA 5TABA 4Q6FA 2JMIA 1RMDA 2IQJA 2QICA 4FK5A 1IYMA 4FIPA 5H9MA 2KFTA 2MA6A 5AITA 5G05B 5B76A 2ECJA 3DWDA 1WILA 2ECNA 5B77A 5KH3A 4NN2A 5LKZA 2K1JA 1CHCA 1X4JA 3SHBA 2D8UA 2JUNA 3FL2A 4YBTA 3LJUX 4X3GA 3PHDA 3T7LA 4WZ3B 2OWAA 2E61A 4UI9B 2FSAA 5SVIB 3VK6A 2VJFA 2LN0A 4A4CA 1WEEA 4BHWA 1ZBDB 4YADA 4N4FA 5LKXA 1WENA 4L58A 1VFYA 2MD8C 4OGEA 5B8DA 2JMJA 1F62A 4PTBA 2LGKA 2F42A 2XOCA 2KGGA 4CA1A 3MHSA 2YHNA 2CONA 2MA5A 2MNYA 4FO9A 1FBVA 3C5KA 3HCUA 5B75A 3LQHA 2YSMA 4UP5A 2YQLA 3ZVYA 5D1MB 2HYED 4WZ2A 3O7AA 2E6RA 4UP0A 3O33A 2KU3A 5EYAF 4AYCA 4N3WA 3U5MA 4AP4A 1G25A 2LRIC 1LDKC 2FD4A 2I50A 2L80A 5DINA 1Z60A 3N9NA 2YW8A 4WA6A 2EA6A 2G6QA 1MBMA 1XWHA 4QF3A 1BORA 4QF2A 1WEVA 3QZVA 4A0CD 4YABA 2D8SA 2KWNA 3O37A 2EODA 4XI1A 1JM7B 2L7PA 1WE9A 2MUMA 2LXPC 5TBNA 2KWJA 4I7DA 5FB1A 5D1LB 2M3HA 5LKUA 5AIUA 4WZ0A 2RI7A 4L7XA 3Q1DA 3ZPVE 2MKEA 3O36A 2YSJA 1T1HA 5I3LA 4V3LC 2CKLA 4YC9A 3RPGC 3GL6A 2LDRA 3SOWA 2VPEA 3N9PA 2YUCA 4S3OB 4FJCA 2YVRA 3L1XA 2EGMA 2ECIA 2C2VS 1DVPA 2C2LA 3M63A 2CRRA 2VJEB 4LADB 4GNGA 4LLBA 4YBMA 2H0DB 3E2DA 3NG2A 3PURA 3MDBC 5FERA 3KDEC 2EXUA 3O34A 2CSVA 2HDPA 3LVQE 1WEWA 4A4BA 5JG6A 3RTRB 3I2DA 2ECVA 2LXHC 4LKAA 2DX8A 5LCWB 4R7EA 2M85A 1WEOA 2KWOA 2K16A 2Y43A 3LQJA 2G43A 1V87A 2ECWA 2VPDA 3N9QA 4H9DA 4MSXA 2KR4A 3FM8C 1WESA 4F1PA 3IHPA 3N9MA 3PUQA 4I7CA 2M6MA 5LKTA 2XEUA 2L0BA 5SVIA 3M99A 2H0DA 3T6RA 3JUEA 2LV9A 5DKAA 1X4IA 5J3XA 4S3OC 5SVXA 2M1RA 1Z2QA 2CRWA 3M7KA 1E4UA 2KYUA 3HCTA 2LGVA 1WEPA 2F6NA 3FJUB 2YREA 3HTKC 3KQIA 3KNVA 2JRJA 3L1ZB 2ZETC 3U5PA 2IDAA 4C9ZA
chains in the Genus database with same CATH topology
3GV4A 2UZGA 3LQIA 4YAXA 2AN6A 2FUUA 3N9LA 1K2FA 5TDRA 1WGMA 5D1KB 2KE1A 2E6SA 5TRBA 2VPBA 3DPLR 2YHOA 1JOCA 4R2YA 2CSYA 1WEQA 2MT5A 2EGPA 1WIMA 1WEUA 4A49A 1MM3A 5H1VA 3M62A 4B7YC 4P5OB 5KH9A 3ZYQA 4V3KC 2K4DA 2VJFB 2MIQA 5G0FA 2CT2A 2ECTA 4W4UA 2BAYA 2PNXA 2KWKA 2YYRA 1HYJA 2Y1NA 3L11A 4YBSA 1JM7A 2ECGA 4R8PK 2YT5A 5B78A 1MM2A 4BBQA 2KGIA 4I7BA 4LK9A 2XB1A 1VD4A 4ZDTA 4GNEA 3EB5A 1WFKA 1Z6UA 3SOXA 5B79A 2CSZA 5C13A 2YURA 2KREA 4GB0A 3ZNIA 5C11A 2VJEA 2G45A 3ZPV1 2YU4A 4AYCB 3LRQA 3HCSA 2MNZA 5KH7A 2RSDA 2LGLA 3V43A 4B86C 4GNDA 4LJNA 4ZQLA 2NAAA 3EB6A 2L43A 4O64A 2QJ0A 4IC3A 4F52B 4AVXA 5H1TA 2JMDA 2L75A 3O70A 1FP0A 3C6WA 4GNFA 2L5UA 1HYIA 2VNFA 3RPGB 4MVTA 3KV5A 4AUQB 2VP7A 5TDWA 1VYXA 2KIZA 3DQVR 4ZUXU 2LQ6A 4CCGX 4YATA 2QIZA 4IC2A 5FEYA 1N87A 1U6GB 5G04B 2OXQC 4TKPB 3KV6A 2VPGA 2YQMA 2CKLB 3SOUA 2F6JA 5H1UA 5FB0A 2Y1MA 3ZTGA 3ASLA 2PUYA 3N9OA 3O35A 2K17A 3ZVZB 2LGGA 2FUIA 1X4UA 4PPEA 3U5OA 3MHHA 1WEMA 2MD7B 1LDJB 3U5NA 5TABA 4Q6FA 2JMIA 1RMDA 2QICA 4FK5A 1IYMA 4FIPA 5H9MA 2KFTA 2MA6A 5AITA 5G05B 5B76A 2ECJA 1WILA 2ECNA 5B77A 5KH3A 4NN2A 5LKZA 2K1JA 1CHCA 1X4JA 3SHBA 3FL2A 4YBTA 4X3GA 3PHDA 3T7LA 4WZ3B 4UI9B 2FSAA 3VK6A 2VJFA 2LN0A 4A4CA 1WEEA 4BHWA 1ZBDB 4YADA 4N4FA 5LKXA 1WENA 4L58A 1VFYA 2MD8C 5B8DA 2JMJA 1F62A 4PTBA 2LGKA 2F42A 2KGGA 4CA1A 3MHSA 2YHNA 2MA5A 2MNYA 4FO9A 1FBVA 3C5KA 3HCUA 5B75A 3LQHA 2YSMA 4UP5A 2YQLA 3ZVYA 5D1MB 2HYED 4WZ2A 3O7AA 2E6RA 4UP0A 3O33A 2KU3A 5EYAF 4AYCA 4N3WA 3U5MA 4AP4A 1G25A 2LRIC 1LDKC 2I50A 2L80A 5DINA 1Z60A 3N9NA 2YW8A 4WA6A 2EA6A 2G6QA 1XWHA 4QF3A 1BORA 4QF2A 1WEVA 3QZVA 4A0CD 4YABA 2D8SA 2KWNA 3O37A 2EODA 4XI1A 1JM7B 1WE9A 2MUMA 2LXPC 5TBNA 2KWJA 4I7DA 5FB1A 5D1LB 2M3HA 5LKUA 5AIUA 4WZ0A 2RI7A 4L7XA 3ZPVE 3O36A 2YSJA 1T1HA 5I3LA 4V3LC 2CKLA 4YC9A 3RPGC 3GL6A 2LDRA 3SOWA 2VPEA 3N9PA 2YUCA 4S3OB 4FJCA 3L1XA 2ECIA 2C2VS 1DVPA 2C2LA 3M63A 2VJEB 4LADB 4GNGA 4LLBA 4YBMA 2H0DB 3NG2A 3PURA 5FERA 3O34A 2HDPA 1WEWA 4A4BA 5JG6A 3RTRB 3I2DA 2ECVA 2LXHC 4LKAA 2DX8A 5LCWB 4R7EA 2M85A 1WEOA 2KWOA 2K16A 2Y43A 3LQJA 2G43A 1V87A 2ECWA 2VPDA 3N9QA 4MSXA 2KR4A 1WESA 3IHPA 3N9MA 3PUQA 4I7CA 2M6MA 5LKTA 2XEUA 2L0BA 3M99A 2H0DA 3T6RA 2LV9A 5DKAA 1X4IA 5J3XA 4S3OC 2M1RA 1Z2QA 1E4UA 2KYUA 3HCTA 2LGVA 1WEPA 2F6NA 2YREA 3HTKC 3KQIA 3KNVA 2JRJA 3L1ZB 2ZETC 3U5PA 2IDAA 4C9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV4 A;  2UZG A;  3LQI A;  4YAX A;  2AN6 A;  2FUU A;  3N9L A;  1K2F A;  5TDR A;  1WGM A;  5D1K B;  2KE1 A;  2E6S A;  5TRB A;  2VPB A;  3DPL R;  2YHO A;  1JOC A;  4R2Y A;  2CSY A;  1WEQ A;  2MT5 A;  2EGP A;  1WIM A;  1WEU A;  4A49 A;  1MM3 A;  5H1V A;  3M62 A;  4B7Y C;  4P5O B;  5KH9 A;  3ZYQ A;  4V3K C;  2K4D A;  2VJF B;  2MIQ A;  5G0F A;  2CT2 A;  2ECT A;  4W4U A;  2BAY A;  2PNX A;  2KWK A;  2YYR A;  1HYJ A;  2Y1N A;  3L11 A;  4YBS A;  1JM7 A;  2ECG A;  4R8P K;  2YT5 A;  5B78 A;  1MM2 A;  4BBQ A;  2KGI A;  4I7B A;  4LK9 A;  2XB1 A;  1VD4 A;  4ZDT A;  4GNE A;  3EB5 A;  1WFK A;  1Z6U A;  3SOX A;  5B79 A;  2CSZ A;  5C13 A;  2YUR A;  2KRE A;  4GB0 A;  3ZNI A;  5C11 A;  2VJE A;  2G45 A;  3ZPV 1;  2YU4 A;  4AYC B;  3LRQ A;  3HCS A;  2MNZ A;  5KH7 A;  2RSD A;  2LGL A;  3V43 A;  4B86 C;  4GND A;  4LJN A;  4ZQL A;  2NAA A;  3EB6 A;  2L43 A;  4O64 A;  2QJ0 A;  4IC3 A;  4F52 B;  4AVX A;  5H1T A;  2JMD A;  2L75 A;  3O70 A;  1FP0 A;  3C6W A;  4GNF A;  2L5U A;  1HYI A;  2VNF A;  3RPG B;  4MVT A;  3KV5 A;  4AUQ B;  2VP7 A;  5TDW A;  1VYX A;  2KIZ A;  3DQV R;  4ZUX U;  2LQ6 A;  4CCG X;  4YAT A;  2QIZ A;  4IC2 A;  5FEY A;  1N87 A;  1U6G B;  5G04 B;  2OXQ C;  4TKP B;  3KV6 A;  2VPG A;  2YQM A;  2CKL B;  3SOU A;  2F6J A;  5H1U A;  5FB0 A;  2Y1M A;  3ZTG A;  3ASL A;  2PUY A;  3N9O A;  3O35 A;  2K17 A;  3ZVZ B;  2LGG A;  2FUI A;  1X4U A;  4PPE A;  3U5O A;  3MHH A;  1WEM A;  2MD7 B;  1LDJ B;  3U5N A;  5TAB A;  4Q6F A;  2JMI A;  1RMD A;  2QIC A;  4FK5 A;  1IYM A;  4FIP A;  5H9M A;  2KFT A;  2MA6 A;  5AIT A;  5G05 B;  5B76 A;  2ECJ A;  1WIL A;  2ECN A;  5B77 A;  5KH3 A;  4NN2 A;  5LKZ A;  2K1J A;  1CHC A;  1X4J A;  3SHB A;  3FL2 A;  4YBT A;  4X3G A;  3PHD A;  3T7L A;  4WZ3 B;  4UI9 B;  2FSA A;  3VK6 A;  2VJF A;  2LN0 A;  4A4C A;  1WEE A;  4BHW A;  1ZBD B;  4YAD A;  4N4F A;  5LKX A;  1WEN A;  4L58 A;  1VFY A;  2MD8 C;  5B8D A;  2JMJ A;  1F62 A;  4PTB A;  2LGK A;  2F42 A;  2KGG A;  4CA1 A;  3MHS A;  2YHN A;  2MA5 A;  2MNY A;  4FO9 A;  1FBV A;  3C5K A;  3HCU A;  5B75 A;  3LQH A;  2YSM A;  4UP5 A;  2YQL A;  3ZVY A;  5D1M B;  2HYE D;  4WZ2 A;  3O7A A;  2E6R A;  4UP0 A;  3O33 A;  2KU3 A;  5EYA F;  4AYC A;  4N3W A;  3U5M A;  4AP4 A;  1G25 A;  2LRI C;  1LDK C;  2I50 A;  2L80 A;  5DIN A;  1Z60 A;  3N9N A;  2YW8 A;  4WA6 A;  2EA6 A;  2G6Q A;  1XWH A;  4QF3 A;  1BOR A;  4QF2 A;  1WEV A;  3QZV A;  4A0C D;  4YAB A;  2D8S A;  2KWN A;  3O37 A;  2EOD A;  4XI1 A;  1JM7 B;  1WE9 A;  2MUM A;  2LXP C;  5TBN A;  2KWJ A;  4I7D A;  5FB1 A;  5D1L B;  2M3H A;  5LKU A;  5AIU A;  4WZ0 A;  2RI7 A;  4L7X A;  3ZPV E;  3O36 A;  2YSJ A;  1T1H A;  5I3L A;  4V3L C;  2CKL A;  4YC9 A;  3RPG C;  3GL6 A;  2LDR A;  3SOW A;  2VPE A;  3N9P A;  2YUC A;  4S3O B;  4FJC A;  3L1X A;  2ECI A;  2C2V S;  1DVP A;  2C2L A;  3M63 A;  2VJE B;  4LAD B;  4GNG A;  4LLB A;  4YBM A;  2H0D B;  3NG2 A;  3PUR A;  5FER A;  3O34 A;  2HDP A;  1WEW A;  4A4B A;  5JG6 A;  3RTR B;  3I2D A;  2ECV A;  2LXH C;  4LKA A;  2DX8 A;  5LCW B;  4R7E A;  2M85 A;  1WEO A;  2KWO A;  2K16 A;  2Y43 A;  3LQJ A;  2G43 A;  1V87 A;  2ECW A;  2VPD A;  3N9Q A;  4MSX A;  2KR4 A;  1WES A;  3IHP A;  3N9M A;  3PUQ A;  4I7C A;  2M6M A;  5LKT A;  2XEU A;  2L0B A;  3M99 A;  2H0D A;  3T6R A;  2LV9 A;  5DKA A;  1X4I A;  5J3X A;  4S3O C;  2M1R A;  1Z2Q A;  1E4U A;  2KYU A;  3HCT A;  2LGV A;  1WEP A;  2F6N A;  2YRE A;  3HTK C;  3KQI A;  3KNV A;  2JRJ A;  3L1Z B;  2ZET C;  3U5P A;  2IDA A;  4C9Z A; 
#chains in the Genus database with same CATH topology
 3FEH A;  3GV4 A;  2UZG A;  3LQI A;  4YAX A;  2AN6 A;  2FUU A;  3N9L A;  2KKX A;  1K2F A;  5TDR A;  1WGM A;  5D1K B;  2KE1 A;  2E6S A;  5TRB A;  2VPB A;  3DPL R;  2YHO A;  2DSM A;  1JOC A;  4R2Y A;  2CSY A;  1WEQ A;  2MT5 A;  2EGP A;  1WIM A;  1WEU A;  4A49 A;  1MM3 A;  5SVY A;  5H1V A;  3M62 A;  2XOY A;  4B7Y C;  4P5O B;  5KH9 A;  3ZYQ A;  2XP0 A;  4V3K C;  2K4D A;  2FFW A;  2P57 A;  2VJF B;  2MIQ A;  5G0F A;  3DDT A;  2CT2 A;  2ECT A;  4W4U A;  2BAY A;  2PNX A;  2KWK A;  2YYR A;  3SUB A;  1HYJ A;  4O62 A;  2Y1N A;  3L11 A;  4YBS A;  1JM7 A;  2ECG A;  4R8P K;  2YT5 A;  3H7H A;  5B78 A;  1MM2 A;  4BBQ A;  2KGI A;  4I7B A;  4LK9 A;  2XB1 A;  1VD4 A;  4OGC A;  3PLW A;  4ZDT A;  4GNE A;  3EB5 A;  1WFK A;  1Z6U A;  3SOX A;  4Z0O A;  5B79 A;  2KKY A;  2CSZ A;  2B0O E;  5C13 A;  2RR4 A;  2YUR A;  2KRE A;  4GB0 A;  3ZNI A;  5C11 A;  2VJE A;  2G45 A;  2XOZ A;  5K3Q A;  3ZPV 1;  2YU4 A;  4AYC B;  1DCQ A;  3LRQ A;  3FAO A;  3HCS A;  2MNZ A;  5KH7 A;  2RSD A;  3LDY A;  2LGL A;  4Z0R A;  3V43 A;  4B86 C;  4GND A;  4LJN A;  4ZQL A;  2NAA A;  3EB6 A;  2L43 A;  4O64 A;  2QJ0 A;  4IC3 A;  4F52 B;  4AVX A;  5H1T A;  2JMD A;  2L75 A;  3O70 A;  1FP0 A;  2DJA A;  3C6W A;  4GNF A;  3O47 A;  2L5U A;  1HYI A;  2JM3 A;  2VNF A;  3RPG B;  3LVR E;  4MVT A;  3KV5 A;  4AUQ B;  2VP7 A;  5TDW A;  1VYX A;  2KIZ A;  3DQV R;  4ZUX U;  2LQ6 A;  4CCG X;  4YAT A;  2QIZ A;  4IC2 A;  5FEY A;  2LAU A;  3FAN A;  1N87 A;  1U6G B;  5G04 B;  2OXQ C;  4TKP B;  3KV6 A;  2VPG A;  2YQM A;  2CKL B;  3SOU A;  2F6J A;  2M13 A;  5H1U A;  5FB0 A;  2Y1M A;  3ZTG A;  3ASL A;  2PUY A;  3N9O A;  3O35 A;  2K17 A;  3ZVZ B;  2LGG A;  2FUI A;  1X4U A;  4PPE A;  3T9K A;  3MHH A;  1WEM A;  3U5O A;  4QQ4 A;  2MD7 B;  1LDJ B;  3U5N A;  5TAB A;  4Q6F A;  2JMI A;  1RMD A;  2IQJ A;  2QIC A;  4FK5 A;  1IYM A;  4FIP A;  5H9M A;  2KFT A;  2MA6 A;  5AIT A;  5G05 B;  5B76 A;  2ECJ A;  3DWD A;  1WIL A;  2ECN A;  5B77 A;  5KH3 A;  4NN2 A;  5LKZ A;  2K1J A;  1CHC A;  1X4J A;  3SHB A;  2D8U A;  2JUN A;  3FL2 A;  4YBT A;  3LJU X;  4X3G A;  3PHD A;  3T7L A;  4WZ3 B;  2OWA A;  2E61 A;  4UI9 B;  2FSA A;  5SVI B;  3VK6 A;  2VJF A;  2LN0 A;  4A4C A;  1WEE A;  4BHW A;  1ZBD B;  4YAD A;  4N4F A;  5LKX A;  1WEN A;  4L58 A;  1VFY A;  2MD8 C;  4OGE A;  5B8D A;  2JMJ A;  1F62 A;  4PTB A;  2LGK A;  2F42 A;  2XOC A;  2KGG A;  4CA1 A;  3MHS A;  2YHN A;  2CON A;  2MA5 A;  2MNY A;  4FO9 A;  1FBV A;  3C5K A;  3HCU A;  5B75 A;  3LQH A;  2YSM A;  4UP5 A;  2YQL A;  3ZVY A;  5D1M B;  2HYE D;  4WZ2 A;  3O7A A;  2E6R A;  4UP0 A;  3O33 A;  2KU3 A;  5EYA F;  4AYC A;  4N3W A;  3U5M A;  4AP4 A;  1G25 A;  2LRI C;  1LDK C;  2FD4 A;  2I50 A;  2L80 A;  5DIN A;  1Z60 A;  3N9N A;  2YW8 A;  4WA6 A;  2EA6 A;  2G6Q A;  1MBM A;  1XWH A;  4QF3 A;  1BOR A;  4QF2 A;  1WEV A;  3QZV A;  4A0C D;  4YAB A;  2D8S A;  2KWN A;  3O37 A;  2EOD A;  4XI1 A;  1JM7 B;  2L7P A;  1WE9 A;  2MUM A;  2LXP C;  5TBN A;  2KWJ A;  4I7D A;  5FB1 A;  5D1L B;  2M3H A;  5LKU A;  5AIU A;  4WZ0 A;  2RI7 A;  4L7X A;  3Q1D A;  3ZPV E;  2MKE A;  3O36 A;  2YSJ A;  1T1H A;  5I3L A;  4V3L C;  2CKL A;  4YC9 A;  3RPG C;  3GL6 A;  2LDR A;  3SOW A;  2VPE A;  3N9P A;  2YUC A;  4S3O B;  4FJC A;  2YVR A;  3L1X A;  2EGM A;  2ECI A;  2C2V S;  1DVP A;  2C2L A;  3M63 A;  2CRR A;  2VJE B;  4LAD B;  4GNG A;  4LLB A;  4YBM A;  2H0D B;  3E2D A;  3NG2 A;  3PUR A;  3MDB C;  5FER A;  3KDE C;  2EXU A;  3O34 A;  2CSV A;  2HDP A;  3LVQ E;  1WEW A;  4A4B A;  5JG6 A;  3RTR B;  3I2D A;  2ECV A;  2LXH C;  4LKA A;  2DX8 A;  5LCW B;  4R7E A;  2M85 A;  1WEO A;  2KWO A;  2K16 A;  2Y43 A;  3LQJ A;  2G43 A;  1V87 A;  2ECW A;  2VPD A;  3N9Q A;  4H9D A;  4MSX A;  2KR4 A;  3FM8 C;  1WES A;  4F1P A;  3IHP A;  3N9M A;  3PUQ A;  4I7C A;  2M6M A;  5LKT A;  2XEU A;  2L0B A;  5SVI A;  3M99 A;  2H0D A;  3T6R A;  3JUE A;  2LV9 A;  5DKA A;  1X4I A;  5J3X A;  4S3O C;  5SVX A;  2M1R A;  1Z2Q A;  2CRW A;  3M7K A;  1E4U A;  2KYU A;  3HCT A;  2LGV A;  1WEP A;  2F6N A;  3FJU B;  2YRE A;  3HTK C;  3KQI A;  3KNV A;  2JRJ A;  3L1Z B;  2ZET C;  3U5P A;  2IDA A;  4C9Z A; 
#chains in the Genus database with same CATH homology
 3GV4 A;  2UZG A;  3LQI A;  4YAX A;  2AN6 A;  2FUU A;  3N9L A;  1K2F A;  5TDR A;  1WGM A;  5D1K B;  2KE1 A;  2E6S A;  5TRB A;  2VPB A;  3DPL R;  2YHO A;  1JOC A;  4R2Y A;  2CSY A;  1WEQ A;  2MT5 A;  2EGP A;  1WIM A;  1WEU A;  4A49 A;  1MM3 A;  5H1V A;  3M62 A;  4B7Y C;  4P5O B;  5KH9 A;  3ZYQ A;  4V3K C;  2K4D A;  2VJF B;  2MIQ A;  5G0F A;  2CT2 A;  2ECT A;  4W4U A;  2BAY A;  2PNX A;  2KWK A;  2YYR A;  1HYJ A;  2Y1N A;  3L11 A;  4YBS A;  1JM7 A;  2ECG A;  4R8P K;  2YT5 A;  5B78 A;  1MM2 A;  4BBQ A;  2KGI A;  4I7B A;  4LK9 A;  2XB1 A;  1VD4 A;  4ZDT A;  4GNE A;  3EB5 A;  1WFK A;  1Z6U A;  3SOX A;  5B79 A;  2CSZ A;  5C13 A;  2YUR A;  2KRE A;  4GB0 A;  3ZNI A;  5C11 A;  2VJE A;  2G45 A;  3ZPV 1;  2YU4 A;  4AYC B;  3LRQ A;  3HCS A;  2MNZ A;  5KH7 A;  2RSD A;  2LGL A;  3V43 A;  4B86 C;  4GND A;  4LJN A;  4ZQL A;  2NAA A;  3EB6 A;  2L43 A;  4O64 A;  2QJ0 A;  4IC3 A;  4F52 B;  4AVX A;  5H1T A;  2JMD A;  2L75 A;  3O70 A;  1FP0 A;  3C6W A;  4GNF A;  2L5U A;  1HYI A;  2VNF A;  3RPG B;  4MVT A;  3KV5 A;  4AUQ B;  2VP7 A;  5TDW A;  1VYX A;  2KIZ A;  3DQV R;  4ZUX U;  2LQ6 A;  4CCG X;  4YAT A;  2QIZ A;  4IC2 A;  5FEY A;  1N87 A;  1U6G B;  5G04 B;  2OXQ C;  4TKP B;  3KV6 A;  2VPG A;  2YQM A;  2CKL B;  3SOU A;  2F6J A;  5H1U A;  5FB0 A;  2Y1M A;  3ZTG A;  3ASL A;  2PUY A;  3N9O A;  3O35 A;  2K17 A;  3ZVZ B;  2LGG A;  2FUI A;  1X4U A;  4PPE A;  3U5O A;  3MHH A;  1WEM A;  2MD7 B;  1LDJ B;  3U5N A;  5TAB A;  4Q6F A;  2JMI A;  1RMD A;  2QIC A;  4FK5 A;  1IYM A;  4FIP A;  5H9M A;  2KFT A;  2MA6 A;  5AIT A;  5G05 B;  5B76 A;  2ECJ A;  1WIL A;  2ECN A;  5B77 A;  5KH3 A;  4NN2 A;  5LKZ A;  2K1J A;  1CHC A;  1X4J A;  3SHB A;  3FL2 A;  4YBT A;  4X3G A;  3PHD A;  3T7L A;  4WZ3 B;  4UI9 B;  2FSA A;  3VK6 A;  2VJF A;  2LN0 A;  4A4C A;  1WEE A;  4BHW A;  1ZBD B;  4YAD A;  4N4F A;  5LKX A;  1WEN A;  4L58 A;  1VFY A;  2MD8 C;  5B8D A;  2JMJ A;  1F62 A;  4PTB A;  2LGK A;  2F42 A;  2KGG A;  4CA1 A;  3MHS A;  2YHN A;  2MA5 A;  2MNY A;  4FO9 A;  1FBV A;  3C5K A;  3HCU A;  5B75 A;  3LQH A;  2YSM A;  4UP5 A;  2YQL A;  3ZVY A;  5D1M B;  2HYE D;  4WZ2 A;  3O7A A;  2E6R A;  4UP0 A;  3O33 A;  2KU3 A;  5EYA F;  4AYC A;  4N3W A;  3U5M A;  4AP4 A;  1G25 A;  2LRI C;  1LDK C;  2I50 A;  2L80 A;  5DIN A;  1Z60 A;  3N9N A;  2YW8 A;  4WA6 A;  2EA6 A;  2G6Q A;  1XWH A;  4QF3 A;  1BOR A;  4QF2 A;  1WEV A;  3QZV A;  4A0C D;  4YAB A;  2D8S A;  2KWN A;  3O37 A;  2EOD A;  4XI1 A;  1JM7 B;  1WE9 A;  2MUM A;  2LXP C;  5TBN A;  2KWJ A;  4I7D A;  5FB1 A;  5D1L B;  2M3H A;  5LKU A;  5AIU A;  4WZ0 A;  2RI7 A;  4L7X A;  3ZPV E;  3O36 A;  2YSJ A;  1T1H A;  5I3L A;  4V3L C;  2CKL A;  4YC9 A;  3RPG C;  3GL6 A;  2LDR A;  3SOW A;  2VPE A;  3N9P A;  2YUC A;  4S3O B;  4FJC A;  3L1X A;  2ECI A;  2C2V S;  1DVP A;  2C2L A;  3M63 A;  2VJE B;  4LAD B;  4GNG A;  4LLB A;  4YBM A;  2H0D B;  3NG2 A;  3PUR A;  5FER A;  3O34 A;  2HDP A;  1WEW A;  4A4B A;  5JG6 A;  3RTR B;  3I2D A;  2ECV A;  2LXH C;  4LKA A;  2DX8 A;  5LCW B;  4R7E A;  2M85 A;  1WEO A;  2KWO A;  2K16 A;  2Y43 A;  3LQJ A;  2G43 A;  1V87 A;  2ECW A;  2VPD A;  3N9Q A;  4MSX A;  2KR4 A;  1WES A;  3IHP A;  3N9M A;  3PUQ A;  4I7C A;  2M6M A;  5LKT A;  2XEU A;  2L0B A;  3M99 A;  2H0D A;  3T6R A;  2LV9 A;  5DKA A;  1X4I A;  5J3X A;  4S3O C;  2M1R A;  1Z2Q A;  1E4U A;  2KYU A;  3HCT A;  2LGV A;  1WEP A;  2F6N A;  2YRE A;  3HTK C;  3KQI A;  3KNV A;  2JRJ A;  3L1Z B;  2ZET C;  3U5P A;  2IDA A;  4C9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...