4YBMA

Crystal structure of trim24 phd-bromodomain complexed with n-{6-[3-(benzyloxy)phenoxy]-1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl}-3,4-dimethoxybenzene-1-sulfonamide (7b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
177
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 52
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ybmA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ybmA01
3P1EA 5CY9A 4HXNA 2R0SA 5D3NA 4Y03A 2YU4A 5F25A 3ZVZB 5AD2A 4A9JA 4QR3A 4Z6HA 5F61A 4A9FA 5J0DA 1JM7B 3S91A 5F1LA 2FSAA 4GNDA 4R7EA 5EQ1A 2F6NA 2Y43A 5KH7A 1X0JA 3U5JA 5CUGA 5ENJA 5D3HA 5D7XA 2JRJA 4XUBA 4UYGA 5ACYA 5CGPA 5EICA 2ECVA 5I83A 2G43A 1JOCA 4CUSA 5D1LB 4A9OA 2LGKA 2E6SA 4FJCA 4MVTA 5DLZA 2M85A 5DX4A 4A9HA 5FB1A 5DKCA 4AYCB 4QSWA 5FFYA 5FE6A 5C11A 5E9LA 5CQ6A 2YSMA 4LDFA 5E74A 5A7CA 2VJFA 4NR6A 1VFYA 5I3LA 4O7EA 5F1HA 4NRBA 4NS5A 2ECNA 3HCTA 3D7CA 3K2JA 5FE4A 2OUOA 3UV2A 5A5SA 2M6MA 3EB5A 2QJ0A 5G05B 4Z1QA 4NQMA 2RSDA 3C5KA 5I1QA 5EI4A 4TT2A 4QC1A 4QF2A 4N4IA 3U5PA 3SOUA 2I7KA 5D3LA 2VPEA 2VPDA 4YH3A 5LUUA 4HXRA 4V3KC 5D1KB 4MEPA 2VP7A 5I7YA 3DPLR 3L1XA 5E9YA 4YH4A 4F3IA 5D24A 3IU6A 1WGMA 4LLBA 2F6JA 5AMEA 2C2LA 2YEMA 4QYDA 2QIZA 4L7XA 1WEPA 5HCLA 4WZ3B 4ZUXU 4UYFA 5FFWA 2H0DA 4XYAA 2PUYA 4WZ0A 5HRXA 1X4UA 4O7FA 5HQ6A 3UW9A 4YYNA 5EPBA 5HM0A 4O64A 5EWCA 1FBVA 4BBQA 4ZQLA 2L43A 5CU8A 2YURA 5ENEA 4GNEA 4MR4A 4TQNA 3SVGA 5DW2A 1E6IA 3KV6A 5DYCA 4O7AA 4TZ8A 1WEEA 4YBSA 5FE5A 3LJWA 2MA6A 2XEUA 5AD3A 2KYUA 4IR4A 1VYXA 4YYMA 4QF3A 5FDZA 2LRIC 5CUEA 1CHCA 5EWDA 4YYDA 4ALGA 2F42A 5CUAA 3AQAA 3HTKC 4LZRA 4NUDA 5TCMA 3V43A 4I7BA 4YYKA 4TTEA 5FBXA 4LC2A 4UYEA 5TB6A 4P5OB 5LVQA 2EGPA 5FH7A 1BORA 4CFLA 1Z6UA 5I88A 1WEVA 2E6RA 1N72A 4UP5A 4QC3A 5LJ0A 4N4GA 5E0RA 4AVXA 3P1DA 3U5MA 2YQDA 3I2DA 4NRAA 2QICA 4O7CA 5LCWB 3LRQA 4HXSA 5IBNA 2MD7B 5G04B 4CA1A 4WHUA 2LQ6A 4N4FA 4C67A 5H1VA 4TT6A 4IORA 2YHNA 5IG6A 5ENBA 4OGJA 5DBMA 2HYED 3M63A 3LQIA 4UP0A 4LZSA 4NN2A 3AADA 4LYIA 2YW8A 5CRMA 5HENA 4AYCA 4UIXA 3O34A 5DFCA 3MUKA 2JMJA 5BT5A 4XY8A 4NYXA 5DFDA 2KWJA 5CZGA 2LXHC 2YYRA 3N9NA 2YELA 4HBWA 5A85A 4A9EA 4IC3A 4TS8A 5CFWA 5F62A 3MULA 3M99A 5JG6A 5K29A 2RNXA 1MM2A 2KWNA 4O75A 2RS9B 4BW4A 2L85A 4NR8A 5IGLA 4HBXA 4A4BA 3JVMA 3G0LA 4BHWA 4FO9A 4CUQA 3G0JA 5HQ5A 3MQMA 4QNSA 3SVHA 5EWHA 5G0FA 4NYVA 3L1ZB 2DATA 1JSPB 4NQNA 4W4UA 3RPGB 5ENFA 5FG4A 3QZSA 5EPRA 2OXQC 2MT5A 4TU6A 2DVQA 4UIVA 5E3GA 5IGKA 3SOXA 5FG6A 2YQMA 4IR3A 4YYHA 4ALHA 5EWVA 4CL9A 2KREA 4UITA 4QSQA 2LV9A 4PY6A 4QBMA 5D0CA 4UYFB 4NR9A 5HQ7A 2PNXA 5DKDA 5F3AA 2WP1A 2G45A 1F68A 2KE1A 5B76A 4OGIA 4E96A 5HLSA 4MR6A 4UIZA 3N9LA 5DY7A 2MIQA 3HCSA 4AP4A 4FIPA 2YQLA 5CPEA 4Z93A 5C89A 4PPEA 5E9MA 3ZTGA 4MSXA 3FKMX 4AUQB 3GL6A 4UYHA 4KCXA 1JM4B 5D1MB 5FE3A 5EM3A 5F2PA 2CSZA 3GG3A 4O71A 1X4JA 5C4QA 1HYJA 2OO1A 5FB0A 2I8NA 1IYMA 4YADA 2L5UA 4QR4A 4X3GA 4MR3A 4A0CD 5FE8A 4N3WA 2GRCA 5DYAA 4Q0NA 4CUTA 2JMIA 2N9GA 4X2IA 4IR6A 4GB0A 4QZSA 4A4CA 2EA6A 2KIZA 1HYIA 5FEYA 4V3LC 4LYSA 4I7DA 3JVJA 4QEWA 4TYLA 3U5LA 5FG5A 3N9QA 4ZC9A 5EP7A 2CKLA 5EV9A 5L98A 3UVDA 5FE9A 4XUAA 3UV4A 5D3TA 2R0YA 3O7AA 4BJXA 2D9EA 2NAAA 4QSVA 5II2A 3ZNIA 4PS5A 2CSYA 5I89A 2EODA 4B7YC 4QSRA 1RMDA 4IOQA 2DVRA 1JM7A 5H1TA 1WEUA 2RI7A 4XY9A 4Z1SA 2DVSA 5FE2A 5EA1A 1WENA 4UIWA 1N87A 3GV4A 3PHDA 3UVYA 5CQ5A 4BW3A 2LDRA 5IGMA 2M1RA 2ECGA 5EWWA 4FK5A 3RTRB 2HDPA 5D3SA 2YDWA 2ECTA 3UV5A 5L8TA 5B77A 1WEMA 1V87A 5EISA 4YYIA 4J0RA 5HFRA 4NUCA 2ZETC 3T7LA 5E7DA 3ONIA 5E3DA 5D25A 4MEQA 4NR5A 5DYUA 3QZVA 5A5OA 2YEKA 2VJFB 3JVLA 2NXBA 5ENIA 1EQFA 5LJ2A 3MB4A 3PURA 5DKAA 5D26A 4YAXA 2VJEB 3I3JA 4WHWA 4LZ2A 5ENHA 5IIDA 2G6QA 5F63A 4C66A 5J3XA 3UVWA 1F62A 2RNWA 4QUTA 4WA6A 3O36A 4QB3A 3N9PA 5FE7A 2H60A 4LYWA 3L11A 4LKAA 5TABA 2MJVB 5G4RA 5B8DA 2K16A 5L8UA 4QSXA 4PCEA 4MR5A 4CCGX 5LKXA 3SHBA 2D82A 3TLPA 5TDRA 5FERA 5IGNA 2Y1NA 2DVVA 2YUCA 3P1FA 5B79A 4YBMA 5I29A 4HXLA 5ENCA 4DONA 3RPGC 4LADB 5A81A 5A5RA 4A9LA 4Q6FA 4PCIA 3IU5A 3DQVR 5CQ8A 4XI1A 1WFKA 2YW5A 1X4IA 5H1UA 3PUQA 4MENA 2CT2A 5DINA 1WIMA 5CS8A 4CUPA 1WILA 2RNYA 2WP2A 5E9KA 5B75A 2E7OA 2K4DA 2KWOA 2LGLA 4C9ZA 5CRZA 4NR7A 4YBTA 4OUFA 2LN0A 4IOOA 2RO1A 3O35A 4J0SA 5I86A 2OSSA 3ZYUA 5C8GA 4QEVA 4WZ2A 4L58A 4YYGA 5FE1A 3KV5A 2ECIA 5HRWA 4HXKA 2L5EA 3JVKA 2LGGA 5C13A 4CFKA 2YREA 3MHHA 4HXPA 4O77A 4O76A 3RCWA 3EB6A 3N9MA 3MXFA 4FLPA 4QSTA 4NR4A 4NRCA 2G4AA 4KV4A 2DWWA 4QR5A 5A82A 5II1A 4HXOA 2H0DB 5L97A 3N9OA 5CUBA 1VD4A 2Y1MA 2MA5A 1U6GB 5ETDA 5LKZA 5FH6A 2ECWA 4Z6IA 3O33A 4LJNA 5FFVA 3P5OA 4J1PA 5EYAF 3UVXA 4J3IA 2L80A 1Z2QA 5F36A 2DX8A 2KU3A 5KH9A 5KO4A 4IR5A 2C2VS 5HELA 4NYWA 3C6WA 5CP5A 5FE0A 4I7CA 1LDJB 1WEWA 3MB3A 4LK9A 4A9KA 3Q2FA 5EGUA 4BW1A 4RVRA 1Z60A 3T6RA 5E73A 5G4SA 1G25A 5JI8A 3ZVYA 5C7NA 2YT5A 5COIA 1MM3A 4YYJA 4YK0A 4F52B 2VJEA 5E9VA 4UI9B 4NUEA 5EVAA 5I40A 3MHSA 4QUUA 3ZPV1 2YHOA 1WE9A 5TBNA 5EK9A 5DLXA 2MNZA 4O70A 4WIVA 3SVFA 2I50A 4Q0OA 3Q2EA 4UIYA 5CUDA 4LR6A 4YY4A 1WEOA 4TKPB 4QSSA 5EU1A 3DWYA 5HFQA 5A83A 1XWHA 5I80A 5HEMA 5EPSA 3FL2A 5BT3A 2VNFA 5B78A 3NG2A 4O7BA 1FP0A 2R10A 4CURA 2XB1A 5I7XA 5DKHA 1DVPA 4R2YA 2VPGA 2E7NA 4QSPA 2KWKA 4A49A 3LQHA 3LQJA 5DFBA 3LXJA 2MNYA 5F60A 4CLBA 4O74A 2L84A 5LKUA 2KFTA 5HRVA 4UYDA 4S3OB 5ETBA 1WUMA 2KTBB 4B86C 2LGVA 5KTXA 2YYNA 4GPJA 5CQAA 5E9IA 5KU3A 5C85A 4QY4A 5H9MA 3SOWA 3S92A 5JWMA 4HXMA 2MD8C 5CTLA 3U5KA 3U5OA 3HMHA 4YATA 2FUIA 5TDWA 2K17A 3NXBA 5AITA 5CQ7A 5D3PA 3P1CA 3HMEA 4QYLA 3IHPA 3ZYQA 1WESA 3KNVA 3KQIA 4LRGA 4O72A 2E3KA 5LVRA 4HBYA 5CUCA 5H85A 5L99A 3ASLA 3DAIA 2LXPC 2RFJA 3ZPVE 3HCUA 5CQ4A 5ENGA 4PKLA 2CKLB 5KH3A 5LJ1A 2D8SA 2KR4A 5AMFA 5FH8A 5C87A 5LKTA 3U5NA 4AKNA 2UZGA 4A9MA 1WEQA 4UIUA 2M3HA 5BT4A 5F5ZA 4S3OC 3VK6A 1LDKC 4ZW1A 4A9NA 1WUGA 4QEUA 2L75A 2L0BA 4ZDTA 4YC9A 4A9IA 2KGGA 1E4UA 4TT4A 1ZBDB 4PTBA 2IDAA 5L96A 4R8PK 2DKWA 5HJCA 1ZS5A 3O37A 5KHMA 4N4HA 5KTWA 5A5QA 2ECJA 5DYXA 4MEOA 4IC2A 3HMFA 5A5PA 4TU4A 4NXJA 5KTUA 4YABA 1K2FA 2VPBA 4HBVA 2LSPB 4GNFA 3O70A 4O78A 5DW1A 3QZTA 2BAYA 5D3RA 2AN6A 2MUMA 3M62A 4YY6A 5TRBA 2KGIA 4TZ2A 2JMDA 2FUUA 2YSJA 4GNGA 5AIUA 5A5NA 2R0VA 2K1JA 4CUUA 5CQTA 1T1HA 4BW2A 5CQ3A 4KV1A 5D3JA 4QSUA
chains in the Genus database with same CATH superfamily
3P1EA 5CY9A 4HXNA 2R0SA 5D3NA 4AKIA 4Y03A 2YU4A 5F25A 3LJUX 3ZVZB 5AD2A 4A9JA 4QR3A 4Z6HA 5F61A 4A9FA 5J0DA 1JM7B 3S91A 5F1LA 2FSAA 4GNDA 4R7EA 5EQ1A 2F6NA 2Y43A 5KH7A 1X0JA 3U5JA 5CUGA 5ENJA 5D3HA 5D7XA 2JRJA 4XUBA 2YVRA 3FJUB 4UYGA 5ACYA 5CGPA 5EICA 2ECVA 5I83A 2G43A 1JOCA 4CUSA 5D1LB 4A9OA 2LGKA 2E6SA 4FJCA 2B0OE 2JM3A 1DCQA 5DLZA 2M85A 5DX4A 4MVTA 4A9HA 5FB1A 5DKCA 4AYCB 4QSWA 5FFYA 5FE6A 5C11A 5E9LA 5CQ6A 2YSMA 4LDFA 5E74A 5A7CA 2VJFA 4NR6A 1VFYA 5I3LA 4O7EA 5F1HA 4NRBA 4NS5A 2ECNA 3HCTA 3D7CA 3K2JA 5FE4A 2OUOA 3UV2A 5A5SA 3D1BA 2M6MA 3EB5A 2QJ0A 5G05B 4Z1QA 4NQMA 2RSDA 3C5KA 5I1QA 5EI4A 4TT2A 3ERRA 4QC1A 4QF2A 4N4IA 3U5PA 3SOUA 2I7KA 5D3LA 2VPEA 2VPDA 4YH3A 5LUUA 4HXRA 4V3KC 5D1KB 4MEPA 2VP7A 5I7YA 3DPLR 3L1XA 5E9YA 4YH4A 4F3IA 5D24A 3IU6A 1WGMA 4LLBA 2F6JA 5AMEA 2C2LA 5K3QA 5SVIA 2YEMA 4QYDA 3MDBC 2QIZA 2CRWA 4L7XA 1WEPA 5HCLA 2EXUA 4WZ3B 4ZUXU 4UYFA 5FFWA 2H0DA 4XYAA 2PUYA 4WZ0A 5HRXA 1X4UA 4O7FA 5HQ6A 3UW9A 4YYNA 3VKHA 5EPBA 5HM0A 3LVQE 4O64A 5EWCA 1FBVA 4BBQA 4ZQLA 2L43A 5CU8A 2YURA 5ENEA 4GNEA 4MR4A 4TQNA 3SVGA 5DW2A 1E6IA 3KV6A 5DYCA 4O7AA 4TZ8A 1WEEA 4YBSA 5FE5A 3LJWA 2MA6A 2XEUA 5AD3A 2KYUA 4IR4A 1VYXA 4YYMA 4QF3A 5FDZA 2LRIC 5CUEA 1CHCA 5EWDA 4YYDA 4ALGA 2F42A 5CUAA 4F1PA 3AQAA 3HTKC 4LZRA 4NUDA 5TCMA 3V43A 4I7BA 4YYKA 4TTEA 5FBXA 4LC2A 4UYEA 5TB6A 4P5OB 3M7KA 5LVQA 2EGPA 5FH7A 1BORA 4CFLA 1Z6UA 5I88A 1WEVA 2E6RA 1N72A 4UP5A 5SVXA 4QC3A 5LJ0A 4N4GA 5E0RA 4H9DA 3P1DA 4AVXA 3U5MA 2YQDA 3I2DA 4NRAA 2QICA 4QQ4A 4O7CA 5LCWB 3LRQA 4HXSA 5IBNA 2MD7B 5G04B 4CA1A 4WHUA 2LQ6A 4N4FA 4C67A 5H1VA 4TT6A 4IORA 2YHNA 5IG6A 5ENBA 4OGJA 5DBMA 2HYED 3M63A 3LQIA 4UP0A 4LZSA 4NN2A 3KDEC 3AADA 4LYIA 2YW8A 5CRMA 5HENA 4AYCA 4UIXA 2EGMA 3O34A 5DFCA 3MUKA 2JMJA 5BT5A 4XY8A 4NYXA 5DFDA 2XP0A 2KWJA 5CZGA 2LXHC 2YYRA 3N9NA 2YELA 4HBWA 2M13A 5A85A 4A9EA 4IC3A 4TS8A 5CFWA 5F62A 3MULA 3M99A 5JG6A 5K29A 2RNXA 1MM2A 2KWNA 4O75A 2RS9B 4BW4A 3LVRE 2L85A 4NR8A 5IGLA 2EJNA 4HBXA 4A4BA 3JVMA 3G0LA 4BHWA 4FO9A 4CUQA 3G0JA 5HQ5A 3MQMA 4QNSA 3SVHA 5EWHA 2DJAA 5G0FA 4NYVA 3L1ZB 2DATA 1JSPB 4NQNA 4W4UA 3RPGB 5ENFA 5FG4A 3QZSA 5EPRA 2OXQC 2MT5A 4TU6A 2DVQA 4UIVA 5E3GA 5IGKA 3SOXA 5FG6A 2YQMA 4IR3A 4YYHA 4ALHA 5EWVA 4CL9A 2KREA 4UITA 4QSQA 2LV9A 4PY6A 4QBMA 5D0CA 4UYFB 4NR9A 4AI6A 5HQ7A 2PNXA 5DKDA 5F3AA 2WP1A 2G45A 1F68A 2KE1A 5B76A 4OGIA 4E96A 5HLSA 4MR6A 4UIZA 3N9LA 5DY7A 2MIQA 3HCSA 4AP4A 4FIPA 2YQLA 5CPEA 4Z93A 5C89A 4PPEA 5E9MA 3ZTGA 4MSXA 3FKMX 2KKXA 4AUQB 3GL6A 4UYHA 4KCXA 1JM4B 5D1MB 5FE3A 5EM3A 5F2PA 2CSZA 3GG3A 4O71A 1X4JA 5C4QA 1HYJA 2OO1A 5FB0A 2P57A 3JUEA 2I8NA 1IYMA 4YADA 2L5UA 3FEHA 2L7PA 4QR4A 4X3GA 4MR3A 4A0CD 5FE8A 4N3WA 2GRCA 5DYAA 4Q0NA 4CUTA 2JMIA 2N9GA 4X2IA 2E61A 4IR6A 4GB0A 4QZSA 4A4CA 5SVIB 2EA6A 2KIZA 1HYIA 5FEYA 4V3LC 4LYSA 4I7DA 3JVJA 4QEWA 4TYLA 3U5LA 5FG5A 3N9QA 4ZC9A 5EP7A 2CKLA 5EV9A 5L98A 1PUOA 3UVDA 5FE9A 4XUAA 3UV4A 5D3TA 2R0YA 3O7AA 4BJXA 2D9EA 3PLWA 2NAAA 4QSVA 5II2A 3ZNIA 4PS5A 2CSYA 5I89A 2EODA 4B7YC 4QSRA 1RMDA 4IOQA 2DVRA 1JM7A 5H1TA 1MBMA 1WEUA 2RI7A 4XY9A 4Z1SA 2DVSA 5FE2A 1ZKRA 5EA1A 2DSMA 1WENA 4UIWA 1N87A 3GV4A 3PHDA 3UVYA 5CQ5A 4BW3A 2LDRA 5IGMA 2M1RA 2ECGA 5EWWA 4FK5A 3RTRB 2HDPA 5D3SA 2YDWA 2ECTA 3UV5A 5L8TA 5B77A 1WEMA 1V87A 5EISA 4YYIA 4J0RA 5HFRA 4NUCA 2ZETC 3T7LA 5E7DA 3ONIA 5E3DA 5D25A 4MEQA 4NR5A 5DYUA 3QZVA 5A5OA 2YEKA 2VJFB 3JVLA 2CONA 2NXBA 5ENIA 1EQFA 5LJ2A 3MB4A 3PURA 5DKAA 5D26A 4YAXA 2VJEB 3I3JA 4WHWA 4LZ2A 5ENHA 5IIDA 2G6QA 5F63A 4C66A 5J3XA 3UVWA 1F62A 2RNWA 4QUTA 4OGCA 4WA6A 3O36A 4QB3A 3N9PA 5FE7A 2H60A 4LYWA 3L11A 4LKAA 5TABA 2MJVB 5G4RA 5B8DA 2K16A 5L8UA 4QSXA 4PCEA 4MR5A 4CCGX 5LKXA 3SHBA 2D82A 3TLPA 5TDRA 3DWDA 5FERA 5IGNA 2Y1NA 2DVVA 2YUCA 3P1FA 5B79A 4YBMA 5I29A 4HXLA 5ENCA 4DONA 3RPGC 4LADB 5A81A 5A5RA 4A9LA 4Q6FA 4PCIA 3E2DA 3IU5A 3DQVR 5CQ8A 4XI1A 1WFKA 2YW5A 1X4IA 5H1UA 3PUQA 4MENA 2CT2A 5DINA 1WIMA 5CS8A 4CUPA 1WILA 2RNYA 2WP2A 5E9KA 5B75A 2E7OA 2K4DA 2KWOA 2LGLA 4C9ZA 5CRZA 3VKGA 4NR7A 3O47A 4YBTA 4OUFA 2LN0A 4IOOA 2RO1A 3O35A 4J0SA 5I86A 2OSSA 3ZYUA 5C8GA 2KKYA 3SUBA 4QEVA 4WZ2A 4L58A 4YYGA 5FE1A 3KV5A 2ECIA 5HRWA 4HXKA 2L5EA 3JVKA 2XOYA 2LGGA 5C13A 4CFKA 2YREA 3FM8C 3MHHA 4HXPA 2LAUA 4O77A 4O76A 3RCWA 3EB6A 3N9MA 3MXFA 4FLPA 4QSTA 4NR4A 4NRCA 2G4AA 4KV4A 2DWWA 4QR5A 5A82A 5II1A 4HXOA 2H0DB 5L97A 3DDTA 5CUBA 3N9OA 1VD4A 2Y1MA 2MA5A 1U6GB 5ETDA 5LKZA 5FH6A 2ECWA 3T9KA 4Z6IA 3O33A 3FANA 4LJNA 5FFVA 3P5OA 4J1PA 5EYAF 3UVXA 4J3IA 2L80A 1Z2QA 5F36A 2DX8A 2KU3A 5KH9A 5KO4A 4IR5A 2C2VS 5HELA 4NYWA 3C6WA 5SVYA 5CP5A 5FE0A 4I7CA 1LDJB 1WEWA 2JUNA 3MB3A 4AKGA 4A9KA 2IQJA 4LK9A 3Q2FA 5EGUA 4BW1A 4RVRA 1Z60A 3T6RA 5E73A 4O62A 5G4SA 1G25A 5JI8A 3ZVYA 5C7NA 2YT5A 5COIA 1MM3A 4YYJA 4YK0A 4F52B 2VJEA 5E9VA 4OGEA 4UI9B 4NUEA 5EVAA 5I40A 3MHSA 4QUUA 3ZPV1 2YHOA 1WE9A 5TBNA 5EK9A 5DLXA 2MNZA 2OWAA 4O70A 4WIVA 3SVFA 2I50A 4Q0OA 3Q2EA 4UIYA 5CUDA 4LR6A 4YY4A 1WEOA 4TKPB 4QSSA 5EU1A 3DWYA 5HFQA 5A83A 1XWHA 5I80A 5HEMA 5EPSA 3FL2A 5BT3A 2VNFA 5B78A 3NG2A 4O7BA 1FP0A 2R10A 4Z0OA 4CURA 2XB1A 5I7XA 5DKHA 1DVPA 4R2YA 2VPGA 2E7NA 4QSPA 2KWKA 2XOCA 4A49A 3LQHA 3LQJA 5DFBA 3LXJA 2CSVA 2MNYA 5F60A 4CLBA 4O74A 2L84A 5LKUA 2KFTA 5HRVA 4UYDA 4S3OB 5ETBA 1WUMA 2KTBB 3FAOA 2FFWA 4B86C 2LGVA 5KTXA 2YYNA 4GPJA 5CQAA 5E9IA 5KU3A 5C85A 4QY4A 5H9MA 3SOWA 3S92A 5JWMA 4HXMA 2MD8C 5CTLA 3U5KA 3U5OA 3HMHA 4YATA 2FUIA 5TDWA 2K17A 3NXBA 5AITA 5CQ7A 5D3PA 3P1CA 3HMEA 4QYLA 3IHPA 3ZYQA 1WESA 3KNVA 3KQIA 4LRGA 4O72A 2E3KA 5LVRA 4HBYA 3H7HA 5CUCA 5H85A 5L99A 4AKHA 3DAIA 2LXPC 3ASLA 2RFJA 3ZPVE 3HCUA 5CQ4A 5ENGA 4PKLA 2CKLB 3LDYA 5KH3A 5LJ1A 2D8SA 2KR4A 5AMFA 5FH8A 5C87A 5LKTA 3U5NA 4AKNA 2UZGA 4A9MA 1WEQA 2MKEA 4UIUA 2M3HA 5BT4A 5F5ZA 4S3OC 3VK6A 1LDKC 4ZW1A 4A9NA 1WUGA 4QEUA 2L75A 2CRRA 2L0BA 4YC9A 4ZDTA 4A9IA 2KGGA 1E4UA 4TT4A 1ZBDB 4PTBA 2IDAA 2XOZA 5L96A 4R8PK 2DKWA 5HJCA 1ZS5A 3O37A 5KHMA 4N4HA 5KTWA 5A5QA 2ECJA 5DYXA 4MEOA 4IC2A 3HMFA 5A5PA 4TU4A 4NXJA 5KTUA 4YABA 1K2FA 2VPBA 4HBVA 2LSPB 4GNFA 3O70A 4Z0RA 4O78A 5DW1A 3QZTA 2BAYA 5D3RA 2D8UA 2AN6A 2MUMA 3M62A 3D1DA 4YY6A 5TRBA 2KGIA 4TZ2A 2JMDA 2FUUA 2YSJA 4GNGA 5AIUA 5A5NA 2R0VA 2K1JA 4CUUA 2FD4A 5CQTA 1T1HA 4BW2A 2RR4A 5CQ3A 4KV1A 3Q1DA 5D3JA 4QSUA
chains in the Genus database with same CATH topology
3P1EA 5CY9A 4HXNA 2R0SA 5D3NA 4Y03A 2YU4A 5F25A 3ZVZB 5AD2A 4A9JA 4QR3A 4Z6HA 5F61A 4A9FA 5J0DA 1JM7B 3S91A 5F1LA 2FSAA 4GNDA 4R7EA 5EQ1A 2F6NA 2Y43A 5KH7A 1X0JA 3U5JA 5CUGA 5ENJA 5D3HA 5D7XA 2JRJA 4XUBA 4UYGA 5ACYA 5CGPA 5EICA 2ECVA 5I83A 2G43A 1JOCA 4CUSA 5D1LB 4A9OA 2LGKA 2E6SA 4FJCA 4MVTA 5DLZA 2M85A 5DX4A 4A9HA 5FB1A 5DKCA 4AYCB 4QSWA 5FFYA 5FE6A 5C11A 5E9LA 5CQ6A 2YSMA 4LDFA 5E74A 5A7CA 2VJFA 4NR6A 1VFYA 5I3LA 4O7EA 5F1HA 4NRBA 4NS5A 2ECNA 3HCTA 3D7CA 3K2JA 5FE4A 2OUOA 3UV2A 5A5SA 2M6MA 3EB5A 2QJ0A 5G05B 4Z1QA 4NQMA 2RSDA 3C5KA 5I1QA 5EI4A 4TT2A 4QC1A 4QF2A 4N4IA 3U5PA 3SOUA 2I7KA 5D3LA 2VPEA 2VPDA 4YH3A 5LUUA 4HXRA 4V3KC 5D1KB 4MEPA 2VP7A 5I7YA 3DPLR 3L1XA 5E9YA 4YH4A 4F3IA 5D24A 3IU6A 1WGMA 4LLBA 2F6JA 5AMEA 2C2LA 2YEMA 4QYDA 2QIZA 4L7XA 1WEPA 5HCLA 4WZ3B 4ZUXU 4UYFA 5FFWA 2H0DA 4XYAA 2PUYA 4WZ0A 5HRXA 1X4UA 4O7FA 5HQ6A 3UW9A 4YYNA 5EPBA 5HM0A 4O64A 5EWCA 1FBVA 4BBQA 4ZQLA 2L43A 5CU8A 2YURA 5ENEA 4GNEA 4MR4A 4TQNA 3SVGA 5DW2A 1E6IA 3KV6A 5DYCA 4O7AA 4TZ8A 1WEEA 4YBSA 5FE5A 3LJWA 2MA6A 2XEUA 5AD3A 2KYUA 4IR4A 1VYXA 4YYMA 4QF3A 5FDZA 2LRIC 5CUEA 1CHCA 5EWDA 4YYDA 4ALGA 2F42A 5CUAA 3AQAA 3HTKC 4LZRA 4NUDA 5TCMA 3V43A 4I7BA 4YYKA 4TTEA 5FBXA 4LC2A 4UYEA 5TB6A 4P5OB 5LVQA 2EGPA 5FH7A 1BORA 4CFLA 1Z6UA 5I88A 1WEVA 2E6RA 1N72A 4UP5A 4QC3A 5LJ0A 4N4GA 5E0RA 4AVXA 3P1DA 3U5MA 2YQDA 3I2DA 4NRAA 2QICA 4O7CA 5LCWB 3LRQA 4HXSA 5IBNA 2MD7B 5G04B 4CA1A 4WHUA 2LQ6A 4N4FA 4C67A 5H1VA 4TT6A 4IORA 2YHNA 5IG6A 5ENBA 4OGJA 5DBMA 2HYED 3M63A 3LQIA 4UP0A 4LZSA 4NN2A 3AADA 4LYIA 2YW8A 5CRMA 5HENA 4AYCA 4UIXA 3O34A 5DFCA 3MUKA 2JMJA 5BT5A 4XY8A 4NYXA 5DFDA 2KWJA 5CZGA 2LXHC 2YYRA 3N9NA 2YELA 4HBWA 5A85A 4A9EA 4IC3A 4TS8A 5CFWA 5F62A 3MULA 3M99A 5JG6A 5K29A 2RNXA 1MM2A 2KWNA 4O75A 2RS9B 4BW4A 2L85A 4NR8A 5IGLA 4HBXA 4A4BA 3JVMA 3G0LA 4BHWA 4FO9A 4CUQA 3G0JA 5HQ5A 3MQMA 4QNSA 3SVHA 5EWHA 5G0FA 4NYVA 3L1ZB 2DATA 1JSPB 4NQNA 4W4UA 3RPGB 5ENFA 5FG4A 3QZSA 5EPRA 2OXQC 2MT5A 4TU6A 2DVQA 4UIVA 5E3GA 5IGKA 3SOXA 5FG6A 2YQMA 4IR3A 4YYHA 4ALHA 5EWVA 4CL9A 2KREA 4UITA 4QSQA 2LV9A 4PY6A 4QBMA 5D0CA 4UYFB 4NR9A 5HQ7A 2PNXA 5DKDA 5F3AA 2WP1A 2G45A 1F68A 2KE1A 5B76A 4OGIA 4E96A 5HLSA 4MR6A 4UIZA 3N9LA 5DY7A 2MIQA 3HCSA 4AP4A 4FIPA 2YQLA 5CPEA 4Z93A 5C89A 4PPEA 5E9MA 3ZTGA 4MSXA 3FKMX 4AUQB 3GL6A 4UYHA 4KCXA 1JM4B 5D1MB 5FE3A 5EM3A 5F2PA 2CSZA 3GG3A 4O71A 1X4JA 5C4QA 1HYJA 2OO1A 5FB0A 2I8NA 1IYMA 4YADA 2L5UA 4QR4A 4X3GA 4MR3A 4A0CD 5FE8A 4N3WA 2GRCA 5DYAA 4Q0NA 4CUTA 2JMIA 2N9GA 4X2IA 4IR6A 4GB0A 4QZSA 4A4CA 2EA6A 2KIZA 1HYIA 5FEYA 4V3LC 4LYSA 4I7DA 3JVJA 4QEWA 4TYLA 3U5LA 5FG5A 3N9QA 4ZC9A 5EP7A 2CKLA 5EV9A 5L98A 3UVDA 5FE9A 4XUAA 3UV4A 5D3TA 2R0YA 3O7AA 4BJXA 2D9EA 2NAAA 4QSVA 5II2A 3ZNIA 4PS5A 2CSYA 5I89A 2EODA 4B7YC 4QSRA 1RMDA 4IOQA 2DVRA 1JM7A 5H1TA 1WEUA 2RI7A 4XY9A 4Z1SA 2DVSA 5FE2A 5EA1A 1WENA 4UIWA 1N87A 3GV4A 3PHDA 3UVYA 5CQ5A 4BW3A 2LDRA 5IGMA 2M1RA 2ECGA 5EWWA 4FK5A 3RTRB 2HDPA 5D3SA 2YDWA 2ECTA 3UV5A 5L8TA 5B77A 1WEMA 1V87A 5EISA 4YYIA 4J0RA 5HFRA 4NUCA 2ZETC 3T7LA 5E7DA 3ONIA 5E3DA 5D25A 4MEQA 4NR5A 5DYUA 3QZVA 5A5OA 2YEKA 2VJFB 3JVLA 2NXBA 5ENIA 1EQFA 5LJ2A 3MB4A 3PURA 5DKAA 5D26A 4YAXA 2VJEB 3I3JA 4WHWA 4LZ2A 5ENHA 5IIDA 2G6QA 5F63A 4C66A 5J3XA 3UVWA 1F62A 2RNWA 4QUTA 4WA6A 3O36A 4QB3A 3N9PA 5FE7A 2H60A 4LYWA 3L11A 4LKAA 5TABA 2MJVB 5G4RA 5B8DA 2K16A 5L8UA 4QSXA 4PCEA 4MR5A 4CCGX 5LKXA 3SHBA 2D82A 3TLPA 5TDRA 5FERA 5IGNA 2Y1NA 2DVVA 2YUCA 3P1FA 5B79A 4YBMA 5I29A 4HXLA 5ENCA 4DONA 3RPGC 4LADB 5A81A 5A5RA 4A9LA 4Q6FA 4PCIA 3IU5A 3DQVR 5CQ8A 4XI1A 1WFKA 2YW5A 1X4IA 5H1UA 3PUQA 4MENA 2CT2A 5DINA 1WIMA 5CS8A 4CUPA 1WILA 2RNYA 2WP2A 5E9KA 5B75A 2E7OA 2K4DA 2KWOA 2LGLA 4C9ZA 5CRZA 4NR7A 4YBTA 4OUFA 2LN0A 4IOOA 2RO1A 3O35A 4J0SA 5I86A 2OSSA 3ZYUA 5C8GA 4QEVA 4WZ2A 4L58A 4YYGA 5FE1A 3KV5A 2ECIA 5HRWA 4HXKA 2L5EA 3JVKA 2LGGA 5C13A 4CFKA 2YREA 3MHHA 4HXPA 4O77A 4O76A 3RCWA 3EB6A 3N9MA 3MXFA 4FLPA 4QSTA 4NR4A 4NRCA 2G4AA 4KV4A 2DWWA 4QR5A 5A82A 5II1A 4HXOA 2H0DB 5L97A 3N9OA 5CUBA 1VD4A 2Y1MA 2MA5A 1U6GB 5ETDA 5LKZA 5FH6A 2ECWA 4Z6IA 3O33A 4LJNA 5FFVA 3P5OA 4J1PA 5EYAF 3UVXA 4J3IA 2L80A 1Z2QA 5F36A 2DX8A 2KU3A 5KH9A 5KO4A 4IR5A 2C2VS 5HELA 4NYWA 3C6WA 5CP5A 5FE0A 4I7CA 1LDJB 1WEWA 3MB3A 4LK9A 4A9KA 3Q2FA 5EGUA 4BW1A 4RVRA 1Z60A 3T6RA 5E73A 5G4SA 1G25A 5JI8A 3ZVYA 5C7NA 2YT5A 5COIA 1MM3A 4YYJA 4YK0A 4F52B 2VJEA 5E9VA 4UI9B 4NUEA 5EVAA 5I40A 3MHSA 4QUUA 3ZPV1 2YHOA 1WE9A 5TBNA 5EK9A 5DLXA 2MNZA 4O70A 4WIVA 3SVFA 2I50A 4Q0OA 3Q2EA 4UIYA 5CUDA 4LR6A 4YY4A 1WEOA 4TKPB 4QSSA 5EU1A 3DWYA 5HFQA 5A83A 1XWHA 5I80A 5HEMA 5EPSA 3FL2A 5BT3A 2VNFA 5B78A 3NG2A 4O7BA 1FP0A 2R10A 4CURA 2XB1A 5I7XA 5DKHA 1DVPA 4R2YA 2VPGA 2E7NA 4QSPA 2KWKA 4A49A 3LQHA 3LQJA 5DFBA 3LXJA 2MNYA 5F60A 4CLBA 4O74A 2L84A 5LKUA 2KFTA 5HRVA 4UYDA 4S3OB 5ETBA 1WUMA 2KTBB 4B86C 2LGVA 5KTXA 2YYNA 4GPJA 5CQAA 5E9IA 5KU3A 5C85A 4QY4A 5H9MA 3SOWA 3S92A 5JWMA 4HXMA 2MD8C 5CTLA 3U5KA 3U5OA 3HMHA 4YATA 2FUIA 5TDWA 2K17A 3NXBA 5AITA 5CQ7A 5D3PA 3P1CA 3HMEA 4QYLA 3IHPA 3ZYQA 1WESA 3KNVA 3KQIA 4LRGA 4O72A 2E3KA 5LVRA 4HBYA 5CUCA 5H85A 5L99A 3ASLA 3DAIA 2LXPC 2RFJA 3ZPVE 3HCUA 5CQ4A 5ENGA 4PKLA 2CKLB 5KH3A 5LJ1A 2D8SA 2KR4A 5AMFA 5FH8A 5C87A 5LKTA 3U5NA 4AKNA 2UZGA 4A9MA 1WEQA 4UIUA 2M3HA 5BT4A 5F5ZA 4S3OC 3VK6A 1LDKC 4ZW1A 4A9NA 1WUGA 4QEUA 2L75A 2L0BA 4ZDTA 4YC9A 4A9IA 2KGGA 1E4UA 4TT4A 1ZBDB 4PTBA 2IDAA 5L96A 4R8PK 2DKWA 5HJCA 1ZS5A 3O37A 5KHMA 4N4HA 5KTWA 5A5QA 2ECJA 5DYXA 4MEOA 4IC2A 3HMFA 5A5PA 4TU4A 4NXJA 5KTUA 4YABA 1K2FA 2VPBA 4HBVA 2LSPB 4GNFA 3O70A 4O78A 5DW1A 3QZTA 2BAYA 5D3RA 2AN6A 2MUMA 3M62A 4YY6A 5TRBA 2KGIA 4TZ2A 2JMDA 2FUUA 2YSJA 4GNGA 5AIUA 5A5NA 2R0VA 2K1JA 4CUUA 5CQTA 1T1HA 4BW2A 5CQ3A 4KV1A 5D3JA 4QSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1E A;  5CY9 A;  4HXN A;  2R0S A;  5D3N A;  4Y03 A;  2YU4 A;  5F25 A;  3ZVZ B;  5AD2 A;  4A9J A;  4QR3 A;  4Z6H A;  5F61 A;  4A9F A;  5J0D A;  1JM7 B;  3S91 A;  5F1L A;  2FSA A;  4GND A;  4R7E A;  5EQ1 A;  2F6N A;  2Y43 A;  5KH7 A;  1X0J A;  3U5J A;  5CUG A;  5ENJ A;  5D3H A;  5D7X A;  2JRJ A;  4XUB A;  4UYG A;  5ACY A;  5CGP A;  5EIC A;  2ECV A;  5I83 A;  2G43 A;  1JOC A;  4CUS A;  5D1L B;  4A9O A;  2LGK A;  2E6S A;  4FJC A;  4MVT A;  5DLZ A;  2M85 A;  5DX4 A;  4A9H A;  5FB1 A;  5DKC A;  4AYC B;  4QSW A;  5FFY A;  5FE6 A;  5C11 A;  5E9L A;  5CQ6 A;  2YSM A;  4LDF A;  5E74 A;  5A7C A;  2VJF A;  4NR6 A;  1VFY A;  5I3L A;  4O7E A;  5F1H A;  4NRB A;  4NS5 A;  2ECN A;  3HCT A;  3D7C A;  3K2J A;  5FE4 A;  2OUO A;  3UV2 A;  5A5S A;  2M6M A;  3EB5 A;  2QJ0 A;  5G05 B;  4Z1Q A;  4NQM A;  2RSD A;  3C5K A;  5I1Q A;  5EI4 A;  4TT2 A;  4QC1 A;  4QF2 A;  4N4I A;  3U5P A;  3SOU A;  2I7K A;  5D3L A;  2VPE A;  2VPD A;  4YH3 A;  5LUU A;  4HXR A;  4V3K C;  5D1K B;  4MEP A;  2VP7 A;  5I7Y A;  3DPL R;  3L1X A;  5E9Y A;  4YH4 A;  4F3I A;  5D24 A;  3IU6 A;  1WGM A;  4LLB A;  2F6J A;  5AME A;  2C2L A;  2YEM A;  4QYD A;  2QIZ A;  4L7X A;  1WEP A;  5HCL A;  4WZ3 B;  4ZUX U;  4UYF A;  5FFW A;  2H0D A;  4XYA A;  2PUY A;  4WZ0 A;  5HRX A;  1X4U A;  4O7F A;  5HQ6 A;  3UW9 A;  4YYN A;  5EPB A;  5HM0 A;  4O64 A;  5EWC A;  1FBV A;  4BBQ A;  4ZQL A;  2L43 A;  5CU8 A;  2YUR A;  5ENE A;  4GNE A;  4MR4 A;  4TQN A;  3SVG A;  5DW2 A;  1E6I A;  3KV6 A;  5DYC A;  4O7A A;  4TZ8 A;  1WEE A;  4YBS A;  5FE5 A;  3LJW A;  2MA6 A;  2XEU A;  5AD3 A;  2KYU A;  4IR4 A;  1VYX A;  4YYM A;  4QF3 A;  5FDZ A;  2LRI C;  5CUE A;  1CHC A;  5EWD A;  4YYD A;  4ALG A;  2F42 A;  5CUA A;  3AQA A;  3HTK C;  4LZR A;  4NUD A;  5TCM A;  3V43 A;  4I7B A;  4YYK A;  4TTE A;  5FBX A;  4LC2 A;  4UYE A;  5TB6 A;  4P5O B;  5LVQ A;  2EGP A;  5FH7 A;  1BOR A;  4CFL A;  1Z6U A;  5I88 A;  1WEV A;  2E6R A;  1N72 A;  4UP5 A;  4QC3 A;  5LJ0 A;  4N4G A;  5E0R A;  4AVX A;  3P1D A;  3U5M A;  2YQD A;  3I2D A;  4NRA A;  2QIC A;  4O7C A;  5LCW B;  3LRQ A;  4HXS A;  5IBN A;  2MD7 B;  5G04 B;  4CA1 A;  4WHU A;  2LQ6 A;  4N4F A;  4C67 A;  5H1V A;  4TT6 A;  4IOR A;  2YHN A;  5IG6 A;  5ENB A;  4OGJ A;  5DBM A;  2HYE D;  3M63 A;  3LQI A;  4UP0 A;  4LZS A;  4NN2 A;  3AAD A;  4LYI A;  2YW8 A;  5CRM A;  5HEN A;  4AYC A;  4UIX A;  3O34 A;  5DFC A;  3MUK A;  2JMJ A;  5BT5 A;  4XY8 A;  4NYX A;  5DFD A;  2KWJ A;  5CZG A;  2LXH C;  2YYR A;  3N9N A;  2YEL A;  4HBW A;  5A85 A;  4A9E A;  4IC3 A;  4TS8 A;  5CFW A;  5F62 A;  3MUL A;  3M99 A;  5JG6 A;  5K29 A;  2RNX A;  1MM2 A;  2KWN A;  4O75 A;  2RS9 B;  4BW4 A;  2L85 A;  4NR8 A;  5IGL A;  4HBX A;  4A4B A;  3JVM A;  3G0L A;  4BHW A;  4FO9 A;  4CUQ A;  3G0J A;  5HQ5 A;  3MQM A;  4QNS A;  3SVH A;  5EWH A;  5G0F A;  4NYV A;  3L1Z B;  2DAT A;  1JSP B;  4NQN A;  4W4U A;  3RPG B;  5ENF A;  5FG4 A;  3QZS A;  5EPR A;  2OXQ C;  2MT5 A;  4TU6 A;  2DVQ A;  4UIV A;  5E3G A;  5IGK A;  3SOX A;  5FG6 A;  2YQM A;  4IR3 A;  4YYH A;  4ALH A;  5EWV A;  4CL9 A;  2KRE A;  4UIT A;  4QSQ A;  2LV9 A;  4PY6 A;  4QBM A;  5D0C A;  4UYF B;  4NR9 A;  5HQ7 A;  2PNX A;  5DKD A;  5F3A A;  2WP1 A;  2G45 A;  1F68 A;  2KE1 A;  5B76 A;  4OGI A;  4E96 A;  5HLS A;  4MR6 A;  4UIZ A;  3N9L A;  5DY7 A;  2MIQ A;  3HCS A;  4AP4 A;  4FIP A;  2YQL A;  5CPE A;  4Z93 A;  5C89 A;  4PPE A;  5E9M A;  3ZTG A;  4MSX A;  3FKM X;  4AUQ B;  3GL6 A;  4UYH A;  4KCX A;  1JM4 B;  5D1M B;  5FE3 A;  5EM3 A;  5F2P A;  2CSZ A;  3GG3 A;  4O71 A;  1X4J A;  5C4Q A;  1HYJ A;  2OO1 A;  5FB0 A;  2I8N A;  1IYM A;  4YAD A;  2L5U A;  4QR4 A;  4X3G A;  4MR3 A;  4A0C D;  5FE8 A;  4N3W A;  2GRC A;  5DYA A;  4Q0N A;  4CUT A;  2JMI A;  2N9G A;  4X2I A;  4IR6 A;  4GB0 A;  4QZS A;  4A4C A;  2EA6 A;  2KIZ A;  1HYI A;  5FEY A;  4V3L C;  4LYS A;  4I7D A;  3JVJ A;  4QEW A;  4TYL A;  3U5L A;  5FG5 A;  3N9Q A;  4ZC9 A;  5EP7 A;  2CKL A;  5EV9 A;  5L98 A;  3UVD A;  5FE9 A;  4XUA A;  3UV4 A;  5D3T A;  2R0Y A;  3O7A A;  4BJX A;  2D9E A;  2NAA A;  4QSV A;  5II2 A;  3ZNI A;  4PS5 A;  2CSY A;  5I89 A;  2EOD A;  4B7Y C;  4QSR A;  1RMD A;  4IOQ A;  2DVR A;  1JM7 A;  5H1T A;  1WEU A;  2RI7 A;  4XY9 A;  4Z1S A;  2DVS A;  5FE2 A;  5EA1 A;  1WEN A;  4UIW A;  1N87 A;  3GV4 A;  3PHD A;  3UVY A;  5CQ5 A;  4BW3 A;  2LDR A;  5IGM A;  2M1R A;  2ECG A;  5EWW A;  4FK5 A;  3RTR B;  2HDP A;  5D3S A;  2YDW A;  2ECT A;  3UV5 A;  5L8T A;  5B77 A;  1WEM A;  1V87 A;  5EIS A;  4YYI A;  4J0R A;  5HFR A;  4NUC A;  2ZET C;  3T7L A;  5E7D A;  3ONI A;  5E3D A;  5D25 A;  4MEQ A;  4NR5 A;  5DYU A;  3QZV A;  5A5O A;  2YEK A;  2VJF B;  3JVL A;  2NXB A;  5ENI A;  1EQF A;  5LJ2 A;  3MB4 A;  3PUR A;  5DKA A;  5D26 A;  4YAX A;  2VJE B;  3I3J A;  4WHW A;  4LZ2 A;  5ENH A;  5IID A;  2G6Q A;  5F63 A;  4C66 A;  5J3X A;  3UVW A;  1F62 A;  2RNW A;  4QUT A;  4WA6 A;  3O36 A;  4QB3 A;  3N9P A;  5FE7 A;  2H60 A;  4LYW A;  3L11 A;  4LKA A;  5TAB A;  2MJV B;  5G4R A;  5B8D A;  2K16 A;  5L8U A;  4QSX A;  4PCE A;  4MR5 A;  4CCG X;  5LKX A;  3SHB A;  2D82 A;  3TLP A;  5TDR A;  5FER A;  5IGN A;  2Y1N A;  2DVV A;  2YUC A;  3P1F A;  5B79 A;  4YBM A;  5I29 A;  4HXL A;  5ENC A;  4DON A;  3RPG C;  4LAD B;  5A81 A;  5A5R A;  4A9L A;  4Q6F A;  4PCI A;  3IU5 A;  3DQV R;  5CQ8 A;  4XI1 A;  1WFK A;  2YW5 A;  1X4I A;  5H1U A;  3PUQ A;  4MEN A;  2CT2 A;  5DIN A;  1WIM A;  5CS8 A;  4CUP A;  1WIL A;  2RNY A;  2WP2 A;  5E9K A;  5B75 A;  2E7O A;  2K4D A;  2KWO A;  2LGL A;  4C9Z A;  5CRZ A;  4NR7 A;  4YBT A;  4OUF A;  2LN0 A;  4IOO A;  2RO1 A;  3O35 A;  4J0S A;  5I86 A;  2OSS A;  3ZYU A;  5C8G A;  4QEV A;  4WZ2 A;  4L58 A;  4YYG A;  5FE1 A;  3KV5 A;  2ECI A;  5HRW A;  4HXK A;  2L5E A;  3JVK A;  2LGG A;  5C13 A;  4CFK A;  2YRE A;  3MHH A;  4HXP A;  4O77 A;  4O76 A;  3RCW A;  3EB6 A;  3N9M A;  3MXF A;  4FLP A;  4QST A;  4NR4 A;  4NRC A;  2G4A A;  4KV4 A;  2DWW A;  4QR5 A;  5A82 A;  5II1 A;  4HXO A;  2H0D B;  5L97 A;  3N9O A;  5CUB A;  1VD4 A;  2Y1M A;  2MA5 A;  1U6G B;  5ETD A;  5LKZ A;  5FH6 A;  2ECW A;  4Z6I A;  3O33 A;  4LJN A;  5FFV A;  3P5O A;  4J1P A;  5EYA F;  3UVX A;  4J3I A;  2L80 A;  1Z2Q A;  5F36 A;  2DX8 A;  2KU3 A;  5KH9 A;  5KO4 A;  4IR5 A;  2C2V S;  5HEL A;  4NYW A;  3C6W A;  5CP5 A;  5FE0 A;  4I7C A;  1LDJ B;  1WEW A;  3MB3 A;  4LK9 A;  4A9K A;  3Q2F A;  5EGU A;  4BW1 A;  4RVR A;  1Z60 A;  3T6R A;  5E73 A;  5G4S A;  1G25 A;  5JI8 A;  3ZVY A;  5C7N A;  2YT5 A;  5COI A;  1MM3 A;  4YYJ A;  4YK0 A;  4F52 B;  2VJE A;  5E9V A;  4UI9 B;  4NUE A;  5EVA A;  5I40 A;  3MHS A;  4QUU A;  3ZPV 1;  2YHO A;  1WE9 A;  5TBN A;  5EK9 A;  5DLX A;  2MNZ A;  4O70 A;  4WIV A;  3SVF A;  2I50 A;  4Q0O A;  3Q2E A;  4UIY A;  5CUD A;  4LR6 A;  4YY4 A;  1WEO A;  4TKP B;  4QSS A;  5EU1 A;  3DWY A;  5HFQ A;  5A83 A;  1XWH A;  5I80 A;  5HEM A;  5EPS A;  3FL2 A;  5BT3 A;  2VNF A;  5B78 A;  3NG2 A;  4O7B A;  1FP0 A;  2R10 A;  4CUR A;  2XB1 A;  5I7X A;  5DKH A;  1DVP A;  4R2Y A;  2VPG A;  2E7N A;  4QSP A;  2KWK A;  4A49 A;  3LQH A;  3LQJ A;  5DFB A;  3LXJ A;  2MNY A;  5F60 A;  4CLB A;  4O74 A;  2L84 A;  5LKU A;  2KFT A;  5HRV A;  4UYD A;  4S3O B;  5ETB A;  1WUM A;  2KTB B;  4B86 C;  2LGV A;  5KTX A;  2YYN A;  4GPJ A;  5CQA A;  5E9I A;  5KU3 A;  5C85 A;  4QY4 A;  5H9M A;  3SOW A;  3S92 A;  5JWM A;  4HXM A;  2MD8 C;  5CTL A;  3U5K A;  3U5O A;  3HMH A;  4YAT A;  2FUI A;  5TDW A;  2K17 A;  3NXB A;  5AIT A;  5CQ7 A;  5D3P A;  3P1C A;  3HME A;  4QYL A;  3IHP A;  3ZYQ A;  1WES A;  3KNV A;  3KQI A;  4LRG A;  4O72 A;  2E3K A;  5LVR A;  4HBY A;  5CUC A;  5H85 A;  5L99 A;  3ASL A;  3DAI A;  2LXP C;  2RFJ A;  3ZPV E;  3HCU A;  5CQ4 A;  5ENG A;  4PKL A;  2CKL B;  5KH3 A;  5LJ1 A;  2D8S A;  2KR4 A;  5AMF A;  5FH8 A;  5C87 A;  5LKT A;  3U5N A;  4AKN A;  2UZG A;  4A9M A;  1WEQ A;  4UIU A;  2M3H A;  5BT4 A;  5F5Z A;  4S3O C;  3VK6 A;  1LDK C;  4ZW1 A;  4A9N A;  1WUG A;  4QEU A;  2L75 A;  2L0B A;  4ZDT A;  4YC9 A;  4A9I A;  2KGG A;  1E4U A;  4TT4 A;  1ZBD B;  4PTB A;  2IDA A;  5L96 A;  4R8P K;  2DKW A;  5HJC A;  1ZS5 A;  3O37 A;  5KHM A;  4N4H A;  5KTW A;  5A5Q A;  2ECJ A;  5DYX A;  4MEO A;  4IC2 A;  3HMF A;  5A5P A;  4TU4 A;  4NXJ A;  5KTU A;  4YAB A;  1K2F A;  2VPB A;  4HBV A;  2LSP B;  4GNF A;  3O70 A;  4O78 A;  5DW1 A;  3QZT A;  2BAY A;  5D3R A;  2AN6 A;  2MUM A;  3M62 A;  4YY6 A;  5TRB A;  2KGI A;  4TZ2 A;  2JMD A;  2FUU A;  2YSJ A;  4GNG A;  5AIU A;  5A5N A;  2R0V A;  2K1J A;  4CUU A;  5CQT A;  1T1H A;  4BW2 A;  5CQ3 A;  4KV1 A;  5D3J A;  4QSU A; 
#chains in the Genus database with same CATH topology
 3P1E A;  5CY9 A;  4HXN A;  2R0S A;  5D3N A;  4AKI A;  4Y03 A;  2YU4 A;  5F25 A;  3LJU X;  3ZVZ B;  5AD2 A;  4A9J A;  4QR3 A;  4Z6H A;  5F61 A;  4A9F A;  5J0D A;  1JM7 B;  3S91 A;  5F1L A;  2FSA A;  4GND A;  4R7E A;  5EQ1 A;  2F6N A;  2Y43 A;  5KH7 A;  1X0J A;  3U5J A;  5CUG A;  5ENJ A;  5D3H A;  5D7X A;  2JRJ A;  4XUB A;  2YVR A;  3FJU B;  4UYG A;  5ACY A;  5CGP A;  5EIC A;  2ECV A;  5I83 A;  2G43 A;  1JOC A;  4CUS A;  5D1L B;  4A9O A;  2LGK A;  2E6S A;  4FJC A;  2B0O E;  2JM3 A;  1DCQ A;  5DLZ A;  2M85 A;  5DX4 A;  4MVT A;  4A9H A;  5FB1 A;  5DKC A;  4AYC B;  4QSW A;  5FFY A;  5FE6 A;  5C11 A;  5E9L A;  5CQ6 A;  2YSM A;  4LDF A;  5E74 A;  5A7C A;  2VJF A;  4NR6 A;  1VFY A;  5I3L A;  4O7E A;  5F1H A;  4NRB A;  4NS5 A;  2ECN A;  3HCT A;  3D7C A;  3K2J A;  5FE4 A;  2OUO A;  3UV2 A;  5A5S A;  3D1B A;  2M6M A;  3EB5 A;  2QJ0 A;  5G05 B;  4Z1Q A;  4NQM A;  2RSD A;  3C5K A;  5I1Q A;  5EI4 A;  4TT2 A;  3ERR A;  4QC1 A;  4QF2 A;  4N4I A;  3U5P A;  3SOU A;  2I7K A;  5D3L A;  2VPE A;  2VPD A;  4YH3 A;  5LUU A;  4HXR A;  4V3K C;  5D1K B;  4MEP A;  2VP7 A;  5I7Y A;  3DPL R;  3L1X A;  5E9Y A;  4YH4 A;  4F3I A;  5D24 A;  3IU6 A;  1WGM A;  4LLB A;  2F6J A;  5AME A;  2C2L A;  5K3Q A;  5SVI A;  2YEM A;  4QYD A;  3MDB C;  2QIZ A;  2CRW A;  4L7X A;  1WEP A;  5HCL A;  2EXU A;  4WZ3 B;  4ZUX U;  4UYF A;  5FFW A;  2H0D A;  4XYA A;  2PUY A;  4WZ0 A;  5HRX A;  1X4U A;  4O7F A;  5HQ6 A;  3UW9 A;  4YYN A;  3VKH A;  5EPB A;  5HM0 A;  3LVQ E;  4O64 A;  5EWC A;  1FBV A;  4BBQ A;  4ZQL A;  2L43 A;  5CU8 A;  2YUR A;  5ENE A;  4GNE A;  4MR4 A;  4TQN A;  3SVG A;  5DW2 A;  1E6I A;  3KV6 A;  5DYC A;  4O7A A;  4TZ8 A;  1WEE A;  4YBS A;  5FE5 A;  3LJW A;  2MA6 A;  2XEU A;  5AD3 A;  2KYU A;  4IR4 A;  1VYX A;  4YYM A;  4QF3 A;  5FDZ A;  2LRI C;  5CUE A;  1CHC A;  5EWD A;  4YYD A;  4ALG A;  2F42 A;  5CUA A;  4F1P A;  3AQA A;  3HTK C;  4LZR A;  4NUD A;  5TCM A;  3V43 A;  4I7B A;  4YYK A;  4TTE A;  5FBX A;  4LC2 A;  4UYE A;  5TB6 A;  4P5O B;  3M7K A;  5LVQ A;  2EGP A;  5FH7 A;  1BOR A;  4CFL A;  1Z6U A;  5I88 A;  1WEV A;  2E6R A;  1N72 A;  4UP5 A;  5SVX A;  4QC3 A;  5LJ0 A;  4N4G A;  5E0R A;  4H9D A;  3P1D A;  4AVX A;  3U5M A;  2YQD A;  3I2D A;  4NRA A;  2QIC A;  4QQ4 A;  4O7C A;  5LCW B;  3LRQ A;  4HXS A;  5IBN A;  2MD7 B;  5G04 B;  4CA1 A;  4WHU A;  2LQ6 A;  4N4F A;  4C67 A;  5H1V A;  4TT6 A;  4IOR A;  2YHN A;  5IG6 A;  5ENB A;  4OGJ A;  5DBM A;  2HYE D;  3M63 A;  3LQI A;  4UP0 A;  4LZS A;  4NN2 A;  3KDE C;  3AAD A;  4LYI A;  2YW8 A;  5CRM A;  5HEN A;  4AYC A;  4UIX A;  2EGM A;  3O34 A;  5DFC A;  3MUK A;  2JMJ A;  5BT5 A;  4XY8 A;  4NYX A;  5DFD A;  2XP0 A;  2KWJ A;  5CZG A;  2LXH C;  2YYR A;  3N9N A;  2YEL A;  4HBW A;  2M13 A;  5A85 A;  4A9E A;  4IC3 A;  4TS8 A;  5CFW A;  5F62 A;  3MUL A;  3M99 A;  5JG6 A;  5K29 A;  2RNX A;  1MM2 A;  2KWN A;  4O75 A;  2RS9 B;  4BW4 A;  3LVR E;  2L85 A;  4NR8 A;  5IGL A;  2EJN A;  4HBX A;  4A4B A;  3JVM A;  3G0L A;  4BHW A;  4FO9 A;  4CUQ A;  3G0J A;  5HQ5 A;  3MQM A;  4QNS A;  3SVH A;  5EWH A;  2DJA A;  5G0F A;  4NYV A;  3L1Z B;  2DAT A;  1JSP B;  4NQN A;  4W4U A;  3RPG B;  5ENF A;  5FG4 A;  3QZS A;  5EPR A;  2OXQ C;  2MT5 A;  4TU6 A;  2DVQ A;  4UIV A;  5E3G A;  5IGK A;  3SOX A;  5FG6 A;  2YQM A;  4IR3 A;  4YYH A;  4ALH A;  5EWV A;  4CL9 A;  2KRE A;  4UIT A;  4QSQ A;  2LV9 A;  4PY6 A;  4QBM A;  5D0C A;  4UYF B;  4NR9 A;  4AI6 A;  5HQ7 A;  2PNX A;  5DKD A;  5F3A A;  2WP1 A;  2G45 A;  1F68 A;  2KE1 A;  5B76 A;  4OGI A;  4E96 A;  5HLS A;  4MR6 A;  4UIZ A;  3N9L A;  5DY7 A;  2MIQ A;  3HCS A;  4AP4 A;  4FIP A;  2YQL A;  5CPE A;  4Z93 A;  5C89 A;  4PPE A;  5E9M A;  3ZTG A;  4MSX A;  3FKM X;  2KKX A;  4AUQ B;  3GL6 A;  4UYH A;  4KCX A;  1JM4 B;  5D1M B;  5FE3 A;  5EM3 A;  5F2P A;  2CSZ A;  3GG3 A;  4O71 A;  1X4J A;  5C4Q A;  1HYJ A;  2OO1 A;  5FB0 A;  2P57 A;  3JUE A;  2I8N A;  1IYM A;  4YAD A;  2L5U A;  3FEH A;  2L7P A;  4QR4 A;  4X3G A;  4MR3 A;  4A0C D;  5FE8 A;  4N3W A;  2GRC A;  5DYA A;  4Q0N A;  4CUT A;  2JMI A;  2N9G A;  4X2I A;  2E61 A;  4IR6 A;  4GB0 A;  4QZS A;  4A4C A;  5SVI B;  2EA6 A;  2KIZ A;  1HYI A;  5FEY A;  4V3L C;  4LYS A;  4I7D A;  3JVJ A;  4QEW A;  4TYL A;  3U5L A;  5FG5 A;  3N9Q A;  4ZC9 A;  5EP7 A;  2CKL A;  5EV9 A;  5L98 A;  1PUO A;  3UVD A;  5FE9 A;  4XUA A;  3UV4 A;  5D3T A;  2R0Y A;  3O7A A;  4BJX A;  2D9E A;  3PLW A;  2NAA A;  4QSV A;  5II2 A;  3ZNI A;  4PS5 A;  2CSY A;  5I89 A;  2EOD A;  4B7Y C;  4QSR A;  1RMD A;  4IOQ A;  2DVR A;  1JM7 A;  5H1T A;  1MBM A;  1WEU A;  2RI7 A;  4XY9 A;  4Z1S A;  2DVS A;  5FE2 A;  1ZKR A;  5EA1 A;  2DSM A;  1WEN A;  4UIW A;  1N87 A;  3GV4 A;  3PHD A;  3UVY A;  5CQ5 A;  4BW3 A;  2LDR A;  5IGM A;  2M1R A;  2ECG A;  5EWW A;  4FK5 A;  3RTR B;  2HDP A;  5D3S A;  2YDW A;  2ECT A;  3UV5 A;  5L8T A;  5B77 A;  1WEM A;  1V87 A;  5EIS A;  4YYI A;  4J0R A;  5HFR A;  4NUC A;  2ZET C;  3T7L A;  5E7D A;  3ONI A;  5E3D A;  5D25 A;  4MEQ A;  4NR5 A;  5DYU A;  3QZV A;  5A5O A;  2YEK A;  2VJF B;  3JVL A;  2CON A;  2NXB A;  5ENI A;  1EQF A;  5LJ2 A;  3MB4 A;  3PUR A;  5DKA A;  5D26 A;  4YAX A;  2VJE B;  3I3J A;  4WHW A;  4LZ2 A;  5ENH A;  5IID A;  2G6Q A;  5F63 A;  4C66 A;  5J3X A;  3UVW A;  1F62 A;  2RNW A;  4QUT A;  4OGC A;  4WA6 A;  3O36 A;  4QB3 A;  3N9P A;  5FE7 A;  2H60 A;  4LYW A;  3L11 A;  4LKA A;  5TAB A;  2MJV B;  5G4R A;  5B8D A;  2K16 A;  5L8U A;  4QSX A;  4PCE A;  4MR5 A;  4CCG X;  5LKX A;  3SHB A;  2D82 A;  3TLP A;  5TDR A;  3DWD A;  5FER A;  5IGN A;  2Y1N A;  2DVV A;  2YUC A;  3P1F A;  5B79 A;  4YBM A;  5I29 A;  4HXL A;  5ENC A;  4DON A;  3RPG C;  4LAD B;  5A81 A;  5A5R A;  4A9L A;  4Q6F A;  4PCI A;  3E2D A;  3IU5 A;  3DQV R;  5CQ8 A;  4XI1 A;  1WFK A;  2YW5 A;  1X4I A;  5H1U A;  3PUQ A;  4MEN A;  2CT2 A;  5DIN A;  1WIM A;  5CS8 A;  4CUP A;  1WIL A;  2RNY A;  2WP2 A;  5E9K A;  5B75 A;  2E7O A;  2K4D A;  2KWO A;  2LGL A;  4C9Z A;  5CRZ A;  3VKG A;  4NR7 A;  3O47 A;  4YBT A;  4OUF A;  2LN0 A;  4IOO A;  2RO1 A;  3O35 A;  4J0S A;  5I86 A;  2OSS A;  3ZYU A;  5C8G A;  2KKY A;  3SUB A;  4QEV A;  4WZ2 A;  4L58 A;  4YYG A;  5FE1 A;  3KV5 A;  2ECI A;  5HRW A;  4HXK A;  2L5E A;  3JVK A;  2XOY A;  2LGG A;  5C13 A;  4CFK A;  2YRE A;  3FM8 C;  3MHH A;  4HXP A;  2LAU A;  4O77 A;  4O76 A;  3RCW A;  3EB6 A;  3N9M A;  3MXF A;  4FLP A;  4QST A;  4NR4 A;  4NRC A;  2G4A A;  4KV4 A;  2DWW A;  4QR5 A;  5A82 A;  5II1 A;  4HXO A;  2H0D B;  5L97 A;  3DDT A;  5CUB A;  3N9O A;  1VD4 A;  2Y1M A;  2MA5 A;  1U6G B;  5ETD A;  5LKZ A;  5FH6 A;  2ECW A;  3T9K A;  4Z6I A;  3O33 A;  3FAN A;  4LJN A;  5FFV A;  3P5O A;  4J1P A;  5EYA F;  3UVX A;  4J3I A;  2L80 A;  1Z2Q A;  5F36 A;  2DX8 A;  2KU3 A;  5KH9 A;  5KO4 A;  4IR5 A;  2C2V S;  5HEL A;  4NYW A;  3C6W A;  5SVY A;  5CP5 A;  5FE0 A;  4I7C A;  1LDJ B;  1WEW A;  2JUN A;  3MB3 A;  4AKG A;  4A9K A;  2IQJ A;  4LK9 A;  3Q2F A;  5EGU A;  4BW1 A;  4RVR A;  1Z60 A;  3T6R A;  5E73 A;  4O62 A;  5G4S A;  1G25 A;  5JI8 A;  3ZVY A;  5C7N A;  2YT5 A;  5COI A;  1MM3 A;  4YYJ A;  4YK0 A;  4F52 B;  2VJE A;  5E9V A;  4OGE A;  4UI9 B;  4NUE A;  5EVA A;  5I40 A;  3MHS A;  4QUU A;  3ZPV 1;  2YHO A;  1WE9 A;  5TBN A;  5EK9 A;  5DLX A;  2MNZ A;  2OWA A;  4O70 A;  4WIV A;  3SVF A;  2I50 A;  4Q0O A;  3Q2E A;  4UIY A;  5CUD A;  4LR6 A;  4YY4 A;  1WEO A;  4TKP B;  4QSS A;  5EU1 A;  3DWY A;  5HFQ A;  5A83 A;  1XWH A;  5I80 A;  5HEM A;  5EPS A;  3FL2 A;  5BT3 A;  2VNF A;  5B78 A;  3NG2 A;  4O7B A;  1FP0 A;  2R10 A;  4Z0O A;  4CUR A;  2XB1 A;  5I7X A;  5DKH A;  1DVP A;  4R2Y A;  2VPG A;  2E7N A;  4QSP A;  2KWK A;  2XOC A;  4A49 A;  3LQH A;  3LQJ A;  5DFB A;  3LXJ A;  2CSV A;  2MNY A;  5F60 A;  4CLB A;  4O74 A;  2L84 A;  5LKU A;  2KFT A;  5HRV A;  4UYD A;  4S3O B;  5ETB A;  1WUM A;  2KTB B;  3FAO A;  2FFW A;  4B86 C;  2LGV A;  5KTX A;  2YYN A;  4GPJ A;  5CQA A;  5E9I A;  5KU3 A;  5C85 A;  4QY4 A;  5H9M A;  3SOW A;  3S92 A;  5JWM A;  4HXM A;  2MD8 C;  5CTL A;  3U5K A;  3U5O A;  3HMH A;  4YAT A;  2FUI A;  5TDW A;  2K17 A;  3NXB A;  5AIT A;  5CQ7 A;  5D3P A;  3P1C A;  3HME A;  4QYL A;  3IHP A;  3ZYQ A;  1WES A;  3KNV A;  3KQI A;  4LRG A;  4O72 A;  2E3K A;  5LVR A;  4HBY A;  3H7H A;  5CUC A;  5H85 A;  5L99 A;  4AKH A;  3DAI A;  2LXP C;  3ASL A;  2RFJ A;  3ZPV E;  3HCU A;  5CQ4 A;  5ENG A;  4PKL A;  2CKL B;  3LDY A;  5KH3 A;  5LJ1 A;  2D8S A;  2KR4 A;  5AMF A;  5FH8 A;  5C87 A;  5LKT A;  3U5N A;  4AKN A;  2UZG A;  4A9M A;  1WEQ A;  2MKE A;  4UIU A;  2M3H A;  5BT4 A;  5F5Z A;  4S3O C;  3VK6 A;  1LDK C;  4ZW1 A;  4A9N A;  1WUG A;  4QEU A;  2L75 A;  2CRR A;  2L0B A;  4YC9 A;  4ZDT A;  4A9I A;  2KGG A;  1E4U A;  4TT4 A;  1ZBD B;  4PTB A;  2IDA A;  2XOZ A;  5L96 A;  4R8P K;  2DKW A;  5HJC A;  1ZS5 A;  3O37 A;  5KHM A;  4N4H A;  5KTW A;  5A5Q A;  2ECJ A;  5DYX A;  4MEO A;  4IC2 A;  3HMF A;  5A5P A;  4TU4 A;  4NXJ A;  5KTU A;  4YAB A;  1K2F A;  2VPB A;  4HBV A;  2LSP B;  4GNF A;  3O70 A;  4Z0R A;  4O78 A;  5DW1 A;  3QZT A;  2BAY A;  5D3R A;  2D8U A;  2AN6 A;  2MUM A;  3M62 A;  3D1D A;  4YY6 A;  5TRB A;  2KGI A;  4TZ2 A;  2JMD A;  2FUU A;  2YSJ A;  4GNG A;  5AIU A;  5A5N A;  2R0V A;  2K1J A;  4CUU A;  2FD4 A;  5CQT A;  1T1H A;  4BW2 A;  2RR4 A;  5CQ3 A;  4KV1 A;  3Q1D A;  5D3J A;  4QSU A; 
#chains in the Genus database with same CATH homology
 3P1E A;  5CY9 A;  4HXN A;  2R0S A;  5D3N A;  4Y03 A;  2YU4 A;  5F25 A;  3ZVZ B;  5AD2 A;  4A9J A;  4QR3 A;  4Z6H A;  5F61 A;  4A9F A;  5J0D A;  1JM7 B;  3S91 A;  5F1L A;  2FSA A;  4GND A;  4R7E A;  5EQ1 A;  2F6N A;  2Y43 A;  5KH7 A;  1X0J A;  3U5J A;  5CUG A;  5ENJ A;  5D3H A;  5D7X A;  2JRJ A;  4XUB A;  4UYG A;  5ACY A;  5CGP A;  5EIC A;  2ECV A;  5I83 A;  2G43 A;  1JOC A;  4CUS A;  5D1L B;  4A9O A;  2LGK A;  2E6S A;  4FJC A;  4MVT A;  5DLZ A;  2M85 A;  5DX4 A;  4A9H A;  5FB1 A;  5DKC A;  4AYC B;  4QSW A;  5FFY A;  5FE6 A;  5C11 A;  5E9L A;  5CQ6 A;  2YSM A;  4LDF A;  5E74 A;  5A7C A;  2VJF A;  4NR6 A;  1VFY A;  5I3L A;  4O7E A;  5F1H A;  4NRB A;  4NS5 A;  2ECN A;  3HCT A;  3D7C A;  3K2J A;  5FE4 A;  2OUO A;  3UV2 A;  5A5S A;  2M6M A;  3EB5 A;  2QJ0 A;  5G05 B;  4Z1Q A;  4NQM A;  2RSD A;  3C5K A;  5I1Q A;  5EI4 A;  4TT2 A;  4QC1 A;  4QF2 A;  4N4I A;  3U5P A;  3SOU A;  2I7K A;  5D3L A;  2VPE A;  2VPD A;  4YH3 A;  5LUU A;  4HXR A;  4V3K C;  5D1K B;  4MEP A;  2VP7 A;  5I7Y A;  3DPL R;  3L1X A;  5E9Y A;  4YH4 A;  4F3I A;  5D24 A;  3IU6 A;  1WGM A;  4LLB A;  2F6J A;  5AME A;  2C2L A;  2YEM A;  4QYD A;  2QIZ A;  4L7X A;  1WEP A;  5HCL A;  4WZ3 B;  4ZUX U;  4UYF A;  5FFW A;  2H0D A;  4XYA A;  2PUY A;  4WZ0 A;  5HRX A;  1X4U A;  4O7F A;  5HQ6 A;  3UW9 A;  4YYN A;  5EPB A;  5HM0 A;  4O64 A;  5EWC A;  1FBV A;  4BBQ A;  4ZQL A;  2L43 A;  5CU8 A;  2YUR A;  5ENE A;  4GNE A;  4MR4 A;  4TQN A;  3SVG A;  5DW2 A;  1E6I A;  3KV6 A;  5DYC A;  4O7A A;  4TZ8 A;  1WEE A;  4YBS A;  5FE5 A;  3LJW A;  2MA6 A;  2XEU A;  5AD3 A;  2KYU A;  4IR4 A;  1VYX A;  4YYM A;  4QF3 A;  5FDZ A;  2LRI C;  5CUE A;  1CHC A;  5EWD A;  4YYD A;  4ALG A;  2F42 A;  5CUA A;  3AQA A;  3HTK C;  4LZR A;  4NUD A;  5TCM A;  3V43 A;  4I7B A;  4YYK A;  4TTE A;  5FBX A;  4LC2 A;  4UYE A;  5TB6 A;  4P5O B;  5LVQ A;  2EGP A;  5FH7 A;  1BOR A;  4CFL A;  1Z6U A;  5I88 A;  1WEV A;  2E6R A;  1N72 A;  4UP5 A;  4QC3 A;  5LJ0 A;  4N4G A;  5E0R A;  4AVX A;  3P1D A;  3U5M A;  2YQD A;  3I2D A;  4NRA A;  2QIC A;  4O7C A;  5LCW B;  3LRQ A;  4HXS A;  5IBN A;  2MD7 B;  5G04 B;  4CA1 A;  4WHU A;  2LQ6 A;  4N4F A;  4C67 A;  5H1V A;  4TT6 A;  4IOR A;  2YHN A;  5IG6 A;  5ENB A;  4OGJ A;  5DBM A;  2HYE D;  3M63 A;  3LQI A;  4UP0 A;  4LZS A;  4NN2 A;  3AAD A;  4LYI A;  2YW8 A;  5CRM A;  5HEN A;  4AYC A;  4UIX A;  3O34 A;  5DFC A;  3MUK A;  2JMJ A;  5BT5 A;  4XY8 A;  4NYX A;  5DFD A;  2KWJ A;  5CZG A;  2LXH C;  2YYR A;  3N9N A;  2YEL A;  4HBW A;  5A85 A;  4A9E A;  4IC3 A;  4TS8 A;  5CFW A;  5F62 A;  3MUL A;  3M99 A;  5JG6 A;  5K29 A;  2RNX A;  1MM2 A;  2KWN A;  4O75 A;  2RS9 B;  4BW4 A;  2L85 A;  4NR8 A;  5IGL A;  4HBX A;  4A4B A;  3JVM A;  3G0L A;  4BHW A;  4FO9 A;  4CUQ A;  3G0J A;  5HQ5 A;  3MQM A;  4QNS A;  3SVH A;  5EWH A;  5G0F A;  4NYV A;  3L1Z B;  2DAT A;  1JSP B;  4NQN A;  4W4U A;  3RPG B;  5ENF A;  5FG4 A;  3QZS A;  5EPR A;  2OXQ C;  2MT5 A;  4TU6 A;  2DVQ A;  4UIV A;  5E3G A;  5IGK A;  3SOX A;  5FG6 A;  2YQM A;  4IR3 A;  4YYH A;  4ALH A;  5EWV A;  4CL9 A;  2KRE A;  4UIT A;  4QSQ A;  2LV9 A;  4PY6 A;  4QBM A;  5D0C A;  4UYF B;  4NR9 A;  5HQ7 A;  2PNX A;  5DKD A;  5F3A A;  2WP1 A;  2G45 A;  1F68 A;  2KE1 A;  5B76 A;  4OGI A;  4E96 A;  5HLS A;  4MR6 A;  4UIZ A;  3N9L A;  5DY7 A;  2MIQ A;  3HCS A;  4AP4 A;  4FIP A;  2YQL A;  5CPE A;  4Z93 A;  5C89 A;  4PPE A;  5E9M A;  3ZTG A;  4MSX A;  3FKM X;  4AUQ B;  3GL6 A;  4UYH A;  4KCX A;  1JM4 B;  5D1M B;  5FE3 A;  5EM3 A;  5F2P A;  2CSZ A;  3GG3 A;  4O71 A;  1X4J A;  5C4Q A;  1HYJ A;  2OO1 A;  5FB0 A;  2I8N A;  1IYM A;  4YAD A;  2L5U A;  4QR4 A;  4X3G A;  4MR3 A;  4A0C D;  5FE8 A;  4N3W A;  2GRC A;  5DYA A;  4Q0N A;  4CUT A;  2JMI A;  2N9G A;  4X2I A;  4IR6 A;  4GB0 A;  4QZS A;  4A4C A;  2EA6 A;  2KIZ A;  1HYI A;  5FEY A;  4V3L C;  4LYS A;  4I7D A;  3JVJ A;  4QEW A;  4TYL A;  3U5L A;  5FG5 A;  3N9Q A;  4ZC9 A;  5EP7 A;  2CKL A;  5EV9 A;  5L98 A;  3UVD A;  5FE9 A;  4XUA A;  3UV4 A;  5D3T A;  2R0Y A;  3O7A A;  4BJX A;  2D9E A;  2NAA A;  4QSV A;  5II2 A;  3ZNI A;  4PS5 A;  2CSY A;  5I89 A;  2EOD A;  4B7Y C;  4QSR A;  1RMD A;  4IOQ A;  2DVR A;  1JM7 A;  5H1T A;  1WEU A;  2RI7 A;  4XY9 A;  4Z1S A;  2DVS A;  5FE2 A;  5EA1 A;  1WEN A;  4UIW A;  1N87 A;  3GV4 A;  3PHD A;  3UVY A;  5CQ5 A;  4BW3 A;  2LDR A;  5IGM A;  2M1R A;  2ECG A;  5EWW A;  4FK5 A;  3RTR B;  2HDP A;  5D3S A;  2YDW A;  2ECT A;  3UV5 A;  5L8T A;  5B77 A;  1WEM A;  1V87 A;  5EIS A;  4YYI A;  4J0R A;  5HFR A;  4NUC A;  2ZET C;  3T7L A;  5E7D A;  3ONI A;  5E3D A;  5D25 A;  4MEQ A;  4NR5 A;  5DYU A;  3QZV A;  5A5O A;  2YEK A;  2VJF B;  3JVL A;  2NXB A;  5ENI A;  1EQF A;  5LJ2 A;  3MB4 A;  3PUR A;  5DKA A;  5D26 A;  4YAX A;  2VJE B;  3I3J A;  4WHW A;  4LZ2 A;  5ENH A;  5IID A;  2G6Q A;  5F63 A;  4C66 A;  5J3X A;  3UVW A;  1F62 A;  2RNW A;  4QUT A;  4WA6 A;  3O36 A;  4QB3 A;  3N9P A;  5FE7 A;  2H60 A;  4LYW A;  3L11 A;  4LKA A;  5TAB A;  2MJV B;  5G4R A;  5B8D A;  2K16 A;  5L8U A;  4QSX A;  4PCE A;  4MR5 A;  4CCG X;  5LKX A;  3SHB A;  2D82 A;  3TLP A;  5TDR A;  5FER A;  5IGN A;  2Y1N A;  2DVV A;  2YUC A;  3P1F A;  5B79 A;  4YBM A;  5I29 A;  4HXL A;  5ENC A;  4DON A;  3RPG C;  4LAD B;  5A81 A;  5A5R A;  4A9L A;  4Q6F A;  4PCI A;  3IU5 A;  3DQV R;  5CQ8 A;  4XI1 A;  1WFK A;  2YW5 A;  1X4I A;  5H1U A;  3PUQ A;  4MEN A;  2CT2 A;  5DIN A;  1WIM A;  5CS8 A;  4CUP A;  1WIL A;  2RNY A;  2WP2 A;  5E9K A;  5B75 A;  2E7O A;  2K4D A;  2KWO A;  2LGL A;  4C9Z A;  5CRZ A;  4NR7 A;  4YBT A;  4OUF A;  2LN0 A;  4IOO A;  2RO1 A;  3O35 A;  4J0S A;  5I86 A;  2OSS A;  3ZYU A;  5C8G A;  4QEV A;  4WZ2 A;  4L58 A;  4YYG A;  5FE1 A;  3KV5 A;  2ECI A;  5HRW A;  4HXK A;  2L5E A;  3JVK A;  2LGG A;  5C13 A;  4CFK A;  2YRE A;  3MHH A;  4HXP A;  4O77 A;  4O76 A;  3RCW A;  3EB6 A;  3N9M A;  3MXF A;  4FLP A;  4QST A;  4NR4 A;  4NRC A;  2G4A A;  4KV4 A;  2DWW A;  4QR5 A;  5A82 A;  5II1 A;  4HXO A;  2H0D B;  5L97 A;  3N9O A;  5CUB A;  1VD4 A;  2Y1M A;  2MA5 A;  1U6G B;  5ETD A;  5LKZ A;  5FH6 A;  2ECW A;  4Z6I A;  3O33 A;  4LJN A;  5FFV A;  3P5O A;  4J1P A;  5EYA F;  3UVX A;  4J3I A;  2L80 A;  1Z2Q A;  5F36 A;  2DX8 A;  2KU3 A;  5KH9 A;  5KO4 A;  4IR5 A;  2C2V S;  5HEL A;  4NYW A;  3C6W A;  5CP5 A;  5FE0 A;  4I7C A;  1LDJ B;  1WEW A;  3MB3 A;  4LK9 A;  4A9K A;  3Q2F A;  5EGU A;  4BW1 A;  4RVR A;  1Z60 A;  3T6R A;  5E73 A;  5G4S A;  1G25 A;  5JI8 A;  3ZVY A;  5C7N A;  2YT5 A;  5COI A;  1MM3 A;  4YYJ A;  4YK0 A;  4F52 B;  2VJE A;  5E9V A;  4UI9 B;  4NUE A;  5EVA A;  5I40 A;  3MHS A;  4QUU A;  3ZPV 1;  2YHO A;  1WE9 A;  5TBN A;  5EK9 A;  5DLX A;  2MNZ A;  4O70 A;  4WIV A;  3SVF A;  2I50 A;  4Q0O A;  3Q2E A;  4UIY A;  5CUD A;  4LR6 A;  4YY4 A;  1WEO A;  4TKP B;  4QSS A;  5EU1 A;  3DWY A;  5HFQ A;  5A83 A;  1XWH A;  5I80 A;  5HEM A;  5EPS A;  3FL2 A;  5BT3 A;  2VNF A;  5B78 A;  3NG2 A;  4O7B A;  1FP0 A;  2R10 A;  4CUR A;  2XB1 A;  5I7X A;  5DKH A;  1DVP A;  4R2Y A;  2VPG A;  2E7N A;  4QSP A;  2KWK A;  4A49 A;  3LQH A;  3LQJ A;  5DFB A;  3LXJ A;  2MNY A;  5F60 A;  4CLB A;  4O74 A;  2L84 A;  5LKU A;  2KFT A;  5HRV A;  4UYD A;  4S3O B;  5ETB A;  1WUM A;  2KTB B;  4B86 C;  2LGV A;  5KTX A;  2YYN A;  4GPJ A;  5CQA A;  5E9I A;  5KU3 A;  5C85 A;  4QY4 A;  5H9M A;  3SOW A;  3S92 A;  5JWM A;  4HXM A;  2MD8 C;  5CTL A;  3U5K A;  3U5O A;  3HMH A;  4YAT A;  2FUI A;  5TDW A;  2K17 A;  3NXB A;  5AIT A;  5CQ7 A;  5D3P A;  3P1C A;  3HME A;  4QYL A;  3IHP A;  3ZYQ A;  1WES A;  3KNV A;  3KQI A;  4LRG A;  4O72 A;  2E3K A;  5LVR A;  4HBY A;  5CUC A;  5H85 A;  5L99 A;  3ASL A;  3DAI A;  2LXP C;  2RFJ A;  3ZPV E;  3HCU A;  5CQ4 A;  5ENG A;  4PKL A;  2CKL B;  5KH3 A;  5LJ1 A;  2D8S A;  2KR4 A;  5AMF A;  5FH8 A;  5C87 A;  5LKT A;  3U5N A;  4AKN A;  2UZG A;  4A9M A;  1WEQ A;  4UIU A;  2M3H A;  5BT4 A;  5F5Z A;  4S3O C;  3VK6 A;  1LDK C;  4ZW1 A;  4A9N A;  1WUG A;  4QEU A;  2L75 A;  2L0B A;  4ZDT A;  4YC9 A;  4A9I A;  2KGG A;  1E4U A;  4TT4 A;  1ZBD B;  4PTB A;  2IDA A;  5L96 A;  4R8P K;  2DKW A;  5HJC A;  1ZS5 A;  3O37 A;  5KHM A;  4N4H A;  5KTW A;  5A5Q A;  2ECJ A;  5DYX A;  4MEO A;  4IC2 A;  3HMF A;  5A5P A;  4TU4 A;  4NXJ A;  5KTU A;  4YAB A;  1K2F A;  2VPB A;  4HBV A;  2LSP B;  4GNF A;  3O70 A;  4O78 A;  5DW1 A;  3QZT A;  2BAY A;  5D3R A;  2AN6 A;  2MUM A;  3M62 A;  4YY6 A;  5TRB A;  2KGI A;  4TZ2 A;  2JMD A;  2FUU A;  2YSJ A;  4GNG A;  5AIU A;  5A5N A;  2R0V A;  2K1J A;  4CUU A;  5CQT A;  1T1H A;  4BW2 A;  5CQ3 A;  4KV1 A;  5D3J A;  4QSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...