4YBMA

Crystal structure of trim24 phd-bromodomain complexed with n-{6-[3-(benzyloxy)phenoxy]-1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl}-3,4-dimethoxybenzene-1-sulfonamide (7b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
177
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 52
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ybmA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ybmA01
4UYFA 4GPJA 4WHUA 5F25A 1FP0A 4GNGA 2H0DB 4LR6A 2YQDA 4F52B 4IORA 2LGKA 4O71A 2LQ6A 5D3LA 5AD3A 5CQAA 5HCLA 4NXJA 2MT5A 5CUCA 4IR6A 4LYSA 2QIZA 2RNXA 2G45A 4LYWA 4MR6A 3MQMA 4LK9A 2MD7B 4WZ0A 4A4CA 5EWDA 5FDZA 2DKWA 4FLPA 5E3GA 2VNFA 5FH6A 3N9PA 4NRBA 5AD2A 2YELA 5EPBA 4AYCB 2R0VA 2PUYA 5FG4A 5F62A 5AMFA 2IDAA 5TABA 5ENEA 5C4QA 5HRXA 3MHHA 4Z1QA 5D3JA 4CL9A 2VP7A 2JMIA 5F3AA 3GL6A 4UIYA 1ZS5A 4BW3A 2E7NA 3PUQA 5H9MA 2ECGA 2YREA 2R10A 4LDFA 5L97A 1MM3A 4NQNA 5H1VA 4NRCA 4YYGA 4ALHA 5E9IA 4HXMA 2ECIA 4O78A 5C13A 4ZDTA 5L99A 4CUSA 2M85A 4CURA 2OO1A 4MR5A 2XB1A 1LDKC 3C6WA 2ECVA 3P1FA 4UI9B 2RNWA 3MB4A 5E74A 4BHWA 4QUTA 2LN0A 2D8SA 4GB0A 4QSUA 2CKLA 1JM4B 4NQMA 3I3JA 5CQTA 5FE1A 5HJCA 2R0YA 2YUCA 5L8TA 4NR5A 4LLBA 4WHWA 1F62A 4YYNA 4OGIA 4BW1A 4QEWA 4HBVA 5F1LA 4TZ2A 4TYLA 5ETDA 2EODA 2JRJA 4QSVA 5A5OA 4Q0NA 2H0DA 4YH4A 5KU3A 3O36A 2YW8A 5HFQA 4E96A 5I89A 5E7DA 3LQIA 5AMEA 4R8PK 2RI7A 4QR3A 5DLZA 5DFBA 5BT5A 5A5SA 1WUGA 4UYFB 5DY7A 4NS5A 3QZTA 1X4IA 5LKUA 4XUBA 4PKLA 5CUEA 5L98A 5D3RA 4IR5A 3U5LA 2OSSA 4AYCA 3S92A 2VPBA 3AQAA 4HBXA 1V87A 3UVXA 1WESA 2K16A 5FBXA 2Y1MA 3U5PA 5DBMA 3RCWA 3MB3A 2L0BA 3MXFA 5I40A 4FO9A 3LJWA 4NYWA 3U5JA 4R7EA 4UIWA 5KHMA 5CUAA 2G43A 4O7FA 5EICA 4A9OA 1WEOA 2CSYA 2PNXA 3DPLR 2LXPC 2KYUA 4WA6A 2DWWA 4PPEA 4YYMA 5F61A 5E73A 3U5MA 4CUUA 5FE9A 1WEEA 4IC3A 5TB6A 4HXOA 4QUUA 5DW2A 5H1UA 4L58A 4O7EA 3U5KA 3O7AA 4YH3A 1N72A 3T7LA 2MJVB 4MEPA 5CRMA 2K4DA 5LKZA 2L80A 4PY6A 3RPGB 2GRCA 5ENGA 4UYHA 3SVHA 5TRBA 5I88A 2G4AA 4MVTA 4KV1A 2MA6A 5FE4A 5BT4A 2UZGA 3U5OA 3P1CA 5CQ4A 5C87A 2KWKA 2LSPB 4NUDA 2XEUA 4LJNA 4HXPA 5KH9A 5DYXA 5HELA 4I7DA 4A9FA 5FE8A 2CKLB 2KTBB 2CSZA 3JVLA 4CCGX 4NR4A 5CQ3A 2MIQA 4N4GA 4TT4A 4NUCA 3IHPA 3DAIA 4YK0A 4YAXA 2DX8A 2F42A 1T1HA 5D3SA 1F68A 3UV2A 3QZSA 2QJ0A 5ENHA 2FUUA 3MUKA 2RO1A 2L5UA 2VJEA 5HENA 5DLXA 4F3IA 2H60A 3G0JA 5EK9A 2R0SA 4HXNA 5CRZA 4YC9A 1U6GB 5FG5A 4YYDA 1WEMA 5D1KB 5FB0A 2LGLA 3N9LA 4Z1SA 4NR7A 2Y43A 5F2PA 5I83A 2FSAA 4UYEA 3KNVA 4WIVA 2YHOA 5LJ2A 1IYMA 5G4RA 4KV4A 5IBNA 4MR3A 2C2LA 4QNSA 5FG6A 4AKNA 5I86A 3NXBA 2YU4A 5FFVA 2L75A 5EM3A 1EQFA 4A9KA 2MUMA 2D9EA 5DX4A 4O76A 4XY9A 4DONA 5CY9A 2Y1NA 5B79A 5EYAF 4X2IA 3SVFA 2I50A 5I29A 3O70A 2JMJA 5A81A 1X4UA 2RS9B 2M6MA 2N9GA 2D82A 1DVPA 4KCXA 5FERA 4HBYA 4Z6HA 3M62A 3M99A 4WZ2A 2F6NA 2WP1A 3T6RA 4N3WA 5D3TA 4FK5A 4QY4A 5FE2A 3HCTA 5DKDA 2YT5A 5CZGA 5LJ1A 4QSSA 2WP2A 4IOOA 5EV9A 4QYDA 2I8NA 5TCMA 5II1A 5DW1A 4YY6A 4R2YA 5G04B 4YBSA 1WE9A 3GG3A 5ENFA 2VPEA 3SOXA 3GV4A 2YQLA 4PCEA 3KQIA 4N4HA 4I7CA 2NXBA 4BJXA 2YSMA 5CP5A 3L1ZB 2C2VS 5D1LB 2VJFB 5EPSA 5TBNA 5LJ0A 4Z6IA 5CTLA 5ENBA 4CA1A 4QC3A 5A82A 5IGMA 2OUOA 4MSXA 4CUQA 5D1MB 2KU3A 4AP4A 5I7YA 1E6IA 5D25A 2MNYA 4TKPB 5HQ5A 4TU4A 5JWMA 3IU6A 3U5NA 5FFYA 5LVQA 2KE1A 2E6SA 5E9KA 2VJEB 5KTWA 3C5KA 3SOWA 4UYGA 5EPRA 5B8DA 5D0CA 2ZETC 3UW9A 4J3IA 5A83A 4QEUA 5EWHA 3PHDA 4GNDA 2I7KA 5CGPA 3S91A 1WILA 4V3LC 4LZ2A 5E9YA 5E3DA 4P5OB 2ECTA 3JVKA 3KV5A 3K2JA 5LKXA 3EB6A 3MHSA 5EI4A 4NR8A 4B86C 4LZSA 5D3PA 5D3NA 1JM7B 4QSRA 2LV9A 4AUQB 4GNFA 3RPGC 5LVRA 1HYIA 5E9VA 5J3XA 5F36A 1MM2A 1WENA 4N4FA 4OGJA 4UIXA 3LRQA 3EB5A 5H1TA 5FE5A 4YYKA 2AN6A 4S3OC 5EVAA 5F1HA 4OUFA 4W4UA 4BW4A 4CUPA 5I7XA 5LUUA 3ZNIA 2L43A 3UVYA 5E9LA 5ENJA 4CUTA 4A9JA 4HXKA 4Q6FA 2YDWA 4N4IA 2E3KA 5G05B 5CQ5A 4NR9A 5H85A 4A9NA 5FE7A 4S3OB 3ZPV1 4QSXA 1VFYA 4YATA 2KWJA 2BAYA 4IC2A 2VJFA 2L5EA 5FE6A 3QZVA 5I80A 3ZTGA 5I1QA 5E0RA 4A9LA 3RTRB 4QB3A 3AADA 4I7BA 3HMEA 1XWHA 4NR6A 4QBMA 1RMDA 3O33A 5C7NA 2EGPA 3ONIA 4QSTA 5FB1A 2YEKA 4PCIA 2E7OA 4TTEA 3SVGA 4O7BA 2YW5A 4J0RA 4QF3A 3UVDA 1JOCA 5FH8A 2EA6A 2KGGA 3VK6A 4UYDA 5B77A 4CLBA 2DVRA 4O72A 2MNZA 3LXJA 2FUIA 4L7XA 5EWVA 3ZPVE 4XI1A 5CQ8A 5HFRA 5EWWA 5HRWA 1BORA 4IR4A 5DKHA 4ALGA 5A85A 1VYXA 3SOUA 4Y03A 2DATA 1WGMA 5DYUA 3FL2A 4YYJA 4FIPA 2KWOA 5ENIA 5CS8A 3HCSA 3UV4A 4QR4A 2DVSA 2YHNA 1WEWA 3HTKC 4Z93A 1JM7A 4UITA 5A5PA 4IR3A 4O77A 4A9IA 2LRIC 4A0CD 5IG6A 5C89A 2L84A 5DKCA 4LADB 1G25A 4TZ8A 2L85A 5FEYA 5KH3A 3ZVYA 5EQ1A 2M1RA 4BW2A 2K1JA 4UP5A 5IGKA 2F6JA 2CT2A 4LC2A 4O70A 4UIZA 3P5OA 5E9MA 5IIDA 2VPGA 4WZ3B 4TS8A 5HM0A 3JVMA 1X4JA 1CHCA 4YABA 2ECNA 2KR4A 5CUBA 3L11A 4C67A 5A7CA 2MD8C 5AIUA 4HXLA 4QSPA 5II2A 5C11A 5KTUA 3HMFA 5B76A 5COIA 1WEVA 5CQ7A 2OXQC 3P1EA 5CUGA 3V43A 5JG6A 2KWNA 3Q2FA 1WIMA 4XY8A 5CQ6A 2KGIA 5DYAA 4MR4A 5TDWA 3L1XA 5I3LA 4A9MA 5IGLA 2LGVA 3TLPA 5CUDA 5L96A 2LXHC 3ZYQA 4A9EA 4MEOA 5EU1A 3N9OA 2KFTA 4YADA 5AITA 1ZBDB 5D26A 2HDPA 5CFWA 1WUMA 4BBQA 5G0FA 1X0JA 2RNYA 4PS5A 4NUEA 3M63A 5EP7A 5FH7A 5KO4A 1FBVA 4GNEA 4B7YC 4PTBA 2RFJA 2DVQA 2K17A 4TT2A 5EA1A 4C66A 5DFDA 3ZVZB 3O37A 5KH7A 4AVXA 1LDJB 3MULA 1HYJA 5ACYA 4J1PA 2NAAA 4O7AA 4UIUA 3P1DA 4YBTA 2MA5A 4ZW1A 5DINA 3O34A 4LZRA 4UIVA 5TDRA 3NG2A 5L8UA 2YQMA 3N9QA 2ECJA 4QEVA 4TT6A 4TU6A 5F5ZA 4XYAA 5F63A 2G6QA 4HXSA 2VPDA 5D24A 3ASLA 4UP0A 4LYIA 5FE0A 5DYCA 4QYLA 5ENCA 4O64A 1N87A 3HMHA 5HQ6A 1Z60A 5EISA 1WEUA 2LDRA 2YYRA 2QICA 4C9ZA 2E6RA 4RVRA 1Z2QA 4A9HA 4X3GA 1WFKA 4O75A 1VD4A 4YY4A 5HLSA 4LKAA 5HEMA 5HQ7A 2ECWA 2M3HA 1WEQA 3UVWA 5B75A 3I2DA 4O74A 4FJCA 5JI8A 5LKTA 4MENA 4TQNA 5J0DA 4O7CA 3UV5A 5ETBA 5A5RA 5FE3A 1JSPB 3D7CA 5K29A 4XUAA 4QSWA 3DWYA 3KV6A 2RSDA 4YYHA 2LGGA 4CFKA 5FFWA 4J0SA 4Q0OA 5B78A 5A5NA 4HXRA 3DQVR 4NN2A 4QR5A 4NYVA 3N9MA 5KTXA 5DKAA 1E4UA 5D3HA 4NYXA 2YYNA 3PURA 5CPEA 4A4BA 1WEPA 5EGUA 3Q2EA 4V3KC 3FKMX 4IOQA 5DFCA 2HYED 5IGNA 4ZQLA 2YURA 1Z6UA 4ZUXU 4QC1A 4QZSA 5EWCA 3LQJA 3O35A 4CFLA 2KIZA 3IU5A 2YSJA 4ZC9A 2DVVA 4LRGA 5BT3A 5LCWB 2JMDA 3JVJA 5C85A 5F60A 3SHBA 5HRVA 3LQHA 4QF2A 3N9NA 3HCUA 2YEMA 4HBWA 5G4SA 3ZYUA 1K2FA 4YBMA 4NRAA 4MEQA 5A5QA 4A49A 5CU8A 5D7XA 3G0LA 5C8GA 2KREA 4YYIA 4QSQA
chains in the Genus database with same CATH superfamily
4UYFA 4GPJA 2E61A 4WHUA 5F25A 1FP0A 4GNGA 2H0DB 4LR6A 2YQDA 4F52B 4IORA 3T9KA 3DWDA 2LGKA 4O71A 2LQ6A 5D3LA 5AD3A 5CQAA 5HCLA 4NXJA 2MT5A 5CUCA 4IR6A 4LYSA 2QIZA 2RNXA 2G45A 4LYWA 4MR6A 3MQMA 4LK9A 2MD7B 4WZ0A 4A4CA 5EWDA 2P57A 5FDZA 2DKWA 4FLPA 5E3GA 2VNFA 5FH6A 3N9PA 4NRBA 5AD2A 2YELA 5EPBA 4AYCB 2R0VA 2PUYA 2CSVA 5FG4A 5F62A 5AMFA 2IDAA 5TABA 5ENEA 5C4QA 5HRXA 3MHHA 4Z1QA 5D3JA 4CL9A 2VP7A 2JMIA 5F3AA 2KKXA 3GL6A 4UIYA 1ZS5A 4BW3A 4F1PA 2E7NA 3PUQA 5H9MA 2ECGA 2OWAA 4AKHA 2YREA 1ZKRA 2R10A 4LDFA 5L97A 3H7HA 1MM3A 4NQNA 5H1VA 4NRCA 4YYGA 4ALHA 5E9IA 4HXMA 2ECIA 4O78A 5C13A 4ZDTA 5L99A 4CUSA 2M85A 4CURA 2OO1A 4MR5A 2XB1A 1LDKC 3C6WA 2ECVA 3P1FA 4UI9B 2RNWA 3MB4A 5E74A 4BHWA 4QUTA 2LN0A 2D8SA 4GB0A 4QSUA 3Q1DA 2CKLA 1JM4B 2KKYA 2MKEA 4NQMA 3I3JA 5CQTA 5FE1A 5HJCA 2R0YA 2YUCA 5L8TA 4NR5A 4LLBA 4WHWA 1F62A 4YYNA 4OGIA 4BW1A 4QEWA 4HBVA 5F1LA 2L7PA 4TZ2A 4TYLA 5ETDA 2DSMA 2EODA 2JRJA 4QSVA 5A5OA 4Q0NA 2H0DA 4YH4A 5KU3A 3O36A 2YW8A 5HFQA 4E96A 2D8UA 5I89A 5E7DA 3LQIA 5AMEA 4R8PK 2RI7A 3FAOA 4QR3A 5DLZA 5DFBA 5BT5A 5A5SA 1WUGA 4UYFB 5DY7A 4NS5A 3QZTA 1X4IA 5LKUA 4XUBA 4PKLA 5CUEA 5L98A 5D3RA 4IR5A 3U5LA 2OSSA 4AYCA 3S92A 2VPBA 3AQAA 4HBXA 1V87A 2EJNA 3UVXA 1WESA 2K16A 5FBXA 2CONA 2Y1MA 3U5PA 5DBMA 3RCWA 2YVRA 3MB3A 2L0BA 3MXFA 5I40A 3FEHA 4FO9A 3LJWA 4NYWA 3U5JA 4R7EA 4UIWA 5SVIA 5KHMA 5CUAA 2G43A 4O7FA 5EICA 4A9OA 1WEOA 2CSYA 2PNXA 3DPLR 2LXPC 2KYUA 4WA6A 2DWWA 4PPEA 4YYMA 5F61A 5E73A 3U5MA 4CUUA 5FE9A 1WEEA 4IC3A 5TB6A 4HXOA 4QUUA 5DW2A 5H1UA 4L58A 4O7EA 3U5KA 3O7AA 4YH3A 1N72A 3T7LA 2MJVB 4MEPA 5CRMA 2K4DA 5LKZA 2L80A 4PY6A 3RPGB 2GRCA 5ENGA 4UYHA 3SVHA 5TRBA 5I88A 2G4AA 4MVTA 2JM3A 4KV1A 2MA6A 5FE4A 3DDTA 5BT4A 4AI6A 5K3QA 2UZGA 3U5OA 3P1CA 5CQ4A 5C87A 2KWKA 2LSPB 4NUDA 2EGMA 2XEUA 4HXPA 4LJNA 5KH9A 5DYXA 5HELA 4I7DA 4A9FA 5FE8A 2CKLB 2KTBB 2CSZA 3JVLA 4CCGX 4NR4A 5CQ3A 2MIQA 4N4GA 4TT4A 4NUCA 3IHPA 3DAIA 4YK0A 4YAXA 2DX8A 2F42A 1T1HA 5D3SA 1F68A 3UV2A 3QZSA 2QJ0A 5ENHA 2FUUA 3MUKA 2RO1A 2L5UA 2VJEA 5HENA 5DLXA 4F3IA 2H60A 3G0JA 5EK9A 2R0SA 4HXNA 5CRZA 4YC9A 1U6GB 5FG5A 4YYDA 3SUBA 1WEMA 5D1KB 5FB0A 2LGLA 3N9LA 4Z1SA 4NR7A 2Y43A 5F2PA 5I83A 2FSAA 4UYEA 3KNVA 4WIVA 1DCQA 5LJ2A 2FD4A 2YHOA 5G4RA 1IYMA 4KV4A 5IBNA 4MR3A 2C2LA 4QNSA 3PLWA 3KDEC 5FG6A 4AKNA 5I86A 3NXBA 2YU4A 5FFVA 2L75A 5EM3A 3D1DA 1EQFA 4A9KA 2MUMA 2D9EA 5DX4A 4O76A 4XY9A 4DONA 5CY9A 2Y1NA 5B79A 5EYAF 4X2IA 4OGEA 3SVFA 2I50A 5I29A 3O70A 2JMJA 5SVIB 5A81A 1X4UA 2RS9B 2M6MA 2N9GA 2D82A 1DVPA 4KCXA 2LAUA 5FERA 4HBYA 4Z6HA 3M62A 3M99A 4WZ2A 2F6NA 2WP1A 3T6RA 4N3WA 2FFWA 5D3TA 4FK5A 4QY4A 5FE2A 3HCTA 4AKGA 5DKDA 2YT5A 5CZGA 5LJ1A 4QSSA 2WP2A 4IOOA 5EV9A 4QYDA 2I8NA 3FANA 5TCMA 5II1A 5DW1A 4YY6A 4R2YA 5G04B 4YBSA 1WE9A 3GG3A 5ENFA 2VPEA 3SOXA 3GV4A 2YQLA 4PCEA 3KQIA 4N4HA 4I7CA 2NXBA 4BJXA 2YSMA 5CP5A 3L1ZB 2C2VS 5D1LB 2VJFB 5EPSA 5TBNA 5LJ0A 4Z6IA 5CTLA 5ENBA 4CA1A 4QC3A 5A82A 5IGMA 2OUOA 4MSXA 4CUQA 5D1MB 2KU3A 4AP4A 5I7YA 1E6IA 5D25A 2MNYA 4TKPB 5HQ5A 4TU4A 5JWMA 3IU6A 3U5NA 5FFYA 5LVQA 2KE1A 2E6SA 5E9KA 2VJEB 5KTWA 3C5KA 3SOWA 4UYGA 5EPRA 5B8DA 5D0CA 2ZETC 3UW9A 4J3IA 5A83A 4QEUA 5EWHA 3PHDA 2CRRA 4GNDA 2I7KA 4OGCA 5CGPA 3S91A 1WILA 4V3LC 4LZ2A 5E9YA 5E3DA 4P5OB 2ECTA 3JVKA 3KV5A 3K2JA 5LKXA 3EB6A 3MHSA 5EI4A 4NR8A 4B86C 4LZSA 5D3PA 5D3NA 1JM7B 3VKHA 4QSRA 2LV9A 4AUQB 5SVYA 4GNFA 3RPGC 5LVRA 1HYIA 5E9VA 5J3XA 5F36A 1MM2A 1WENA 3LVRE 4N4FA 4OGJA 4UIXA 3LRQA 3EB5A 5H1TA 5FE5A 4YYKA 2AN6A 4O62A 5EVAA 5F1HA 4OUFA 4S3OC 4W4UA 4BW4A 4CUPA 5I7XA 5LUUA 3ZNIA 2L43A 3UVYA 5E9LA 5ENJA 4CUTA 4A9JA 4HXKA 4Q6FA 2YDWA 4N4IA 2E3KA 5G05B 5CQ5A 4NR9A 5H85A 4A9NA 5FE7A 4S3OB 3ZPV1 2XP0A 4QSXA 1VFYA 4YATA 2KWJA 2BAYA 4IC2A 2VJFA 3LVQE 3D1BA 2L5EA 5FE6A 3QZVA 5I80A 3ZTGA 5I1QA 5E0RA 4A9LA 3RTRB 4QB3A 3AADA 4I7BA 3HMEA 1XWHA 4NR6A 4QBMA 1RMDA 3O33A 5C7NA 2EGPA 3ONIA 4QSTA 5FB1A 2YEKA 4PCIA 2E7OA 4TTEA 3SVGA 4O7BA 2IQJA 2YW5A 4J0RA 4QF3A 3UVDA 1JOCA 5FH8A 2EA6A 2KGGA 3VK6A 4UYDA 5B77A 4CLBA 2DVRA 4O72A 2MNZA 3LXJA 2FUIA 4L7XA 5EWVA 3ZPVE 4XI1A 5CQ8A 5HFRA 5EWWA 5HRWA 1BORA 4IR4A 5DKHA 4ALGA 5A85A 1VYXA 2EXUA 3SOUA 4Y03A 2DATA 1WGMA 5DYUA 3FL2A 4YYJA 4FIPA 2KWOA 5ENIA 5CS8A 3HCSA 3UV4A 4QR4A 2DVSA 2YHNA 1WEWA 3HTKC 4Z93A 1JM7A 4UITA 5A5PA 4IR3A 4O77A 4A9IA 2LRIC 4A0CD 5IG6A 5C89A 2L84A 5DKCA 4LADB 1G25A 4TZ8A 2L85A 5FEYA 5KH3A 3ZVYA 5EQ1A 2M1RA 4BW2A 2K1JA 4UP5A 4QQ4A 5IGKA 2F6JA 2CT2A 4LC2A 4O70A 4UIZA 3P5OA 5E9MA 5IIDA 2VPGA 4WZ3B 4TS8A 5HM0A 4AKIA 3JVMA 1X4JA 1CHCA 4YABA 2ECNA 2KR4A 5CUBA 3L11A 4C67A 5A7CA 2MD8C 5AIUA 4HXLA 4QSPA 5II2A 5C11A 3M7KA 5KTUA 3HMFA 5B76A 5COIA 1WEVA 5CQ7A 2OXQC 3P1EA 5CUGA 3V43A 5JG6A 2B0OE 2KWNA 3Q2FA 1WIMA 4XY8A 5CQ6A 2KGIA 5DYAA 4MR4A 3FM8C 5TDWA 3L1XA 5I3LA 4A9MA 5IGLA 2M13A 2LGVA 3TLPA 5CUDA 5L96A 2LXHC 3ZYQA 4A9EA 4MEOA 5EU1A 3N9OA 2XOCA 2KFTA 3LJUX 4YADA 5AITA 1ZBDB 5D26A 2HDPA 5CFWA 1WUMA 3E2DA 4BBQA 5G0FA 1X0JA 2RNYA 4PS5A 4NUEA 3M63A 5EP7A 5FH7A 5KO4A 1FBVA 4GNEA 4B7YC 4PTBA 2RFJA 2DVQA 3ERRA 2K17A 4TT2A 5EA1A 4C66A 5DFDA 3ZVZB 3O37A 5KH7A 4AVXA 1LDJB 3MULA 5SVXA 5ACYA 1HYJA 4J1PA 2NAAA 4O7AA 4UIUA 3P1DA 4YBTA 2MA5A 3JUEA 4ZW1A 5DINA 3O34A 4LZRA 4UIVA 5TDRA 3NG2A 4Z0OA 5L8UA 2YQMA 3N9QA 2ECJA 4QEVA 4TT6A 4TU6A 5F5ZA 4XYAA 5F63A 2G6QA 4HXSA 2VPDA 5D24A 3ASLA 4UP0A 4LYIA 2XOYA 5FE0A 4Z0RA 5DYCA 4QYLA 5ENCA 4O64A 1N87A 3LDYA 3HMHA 5HQ6A 1Z60A 5EISA 1WEUA 2LDRA 2YYRA 2QICA 4C9ZA 2E6RA 4RVRA 1Z2QA 4A9HA 4X3GA 1WFKA 4O75A 1VD4A 4YY4A 5HLSA 4LKAA 5HEMA 5HQ7A 2ECWA 2M3HA 1PUOA 3O47A 1WEQA 3UVWA 5B75A 4H9DA 3I2DA 4O74A 2XOZA 4FJCA 5JI8A 5LKTA 4MENA 4TQNA 5J0DA 4O7CA 3UV5A 5ETBA 5A5RA 5FE3A 1JSPB 3D7CA 5K29A 4XUAA 4QSWA 3DWYA 3KV6A 2RSDA 4YYHA 2LGGA 4CFKA 5FFWA 2JUNA 2CRWA 4J0SA 4Q0OA 5B78A 5A5NA 4HXRA 3DQVR 4NN2A 4QR5A 4NYVA 3N9MA 5KTXA 5DKAA 1E4UA 5D3HA 4NYXA 2YYNA 3PURA 5CPEA 4A4BA 1WEPA 5EGUA 3Q2EA 2RR4A 3FKMX 4IOQA 4V3KC 5DFCA 2HYED 5IGNA 4ZQLA 2YURA 3FJUB 1Z6UA 4ZUXU 4QC1A 4QZSA 5EWCA 3LQJA 3O35A 4CFLA 2KIZA 3IU5A 2YSJA 4ZC9A 2DVVA 4LRGA 5BT3A 5LCWB 2JMDA 3JVJA 5C85A 5F60A 3SHBA 1MBMA 5HRVA 3LQHA 4QF2A 2DJAA 3MDBC 3N9NA 3HCUA 2YEMA 4HBWA 5G4SA 3ZYUA 1K2FA 4YBMA 4NRAA 4MEQA 5A5QA 4A49A 5CU8A 5D7XA 3G0LA 5C8GA 3VKGA 2KREA 4YYIA 4QSQA
chains in the Genus database with same CATH topology
4UYFA 4GPJA 4WHUA 5F25A 1FP0A 4GNGA 2H0DB 4LR6A 2YQDA 4F52B 4IORA 2LGKA 4O71A 2LQ6A 5D3LA 5AD3A 5CQAA 5HCLA 4NXJA 2MT5A 5CUCA 4IR6A 4LYSA 2QIZA 2RNXA 2G45A 4LYWA 4MR6A 3MQMA 4LK9A 2MD7B 4WZ0A 4A4CA 5EWDA 5FDZA 2DKWA 4FLPA 5E3GA 2VNFA 5FH6A 3N9PA 4NRBA 5AD2A 2YELA 5EPBA 4AYCB 2R0VA 2PUYA 5FG4A 5F62A 5AMFA 2IDAA 5TABA 5ENEA 5C4QA 5HRXA 3MHHA 4Z1QA 5D3JA 4CL9A 2VP7A 2JMIA 5F3AA 3GL6A 4UIYA 1ZS5A 4BW3A 2E7NA 3PUQA 5H9MA 2ECGA 2YREA 2R10A 4LDFA 5L97A 1MM3A 4NQNA 5H1VA 4NRCA 4YYGA 4ALHA 5E9IA 4HXMA 2ECIA 4O78A 5C13A 4ZDTA 5L99A 4CUSA 2M85A 4CURA 2OO1A 4MR5A 2XB1A 1LDKC 3C6WA 2ECVA 3P1FA 4UI9B 2RNWA 3MB4A 5E74A 4BHWA 4QUTA 2LN0A 2D8SA 4GB0A 4QSUA 2CKLA 1JM4B 4NQMA 3I3JA 5CQTA 5FE1A 5HJCA 2R0YA 2YUCA 5L8TA 4NR5A 4LLBA 4WHWA 1F62A 4YYNA 4OGIA 4BW1A 4QEWA 4HBVA 5F1LA 4TZ2A 4TYLA 5ETDA 2EODA 2JRJA 4QSVA 5A5OA 4Q0NA 2H0DA 4YH4A 5KU3A 3O36A 2YW8A 5HFQA 4E96A 5I89A 5E7DA 3LQIA 5AMEA 4R8PK 2RI7A 4QR3A 5DLZA 5DFBA 5BT5A 5A5SA 1WUGA 4UYFB 5DY7A 4NS5A 3QZTA 1X4IA 5LKUA 4XUBA 4PKLA 5CUEA 5L98A 5D3RA 4IR5A 3U5LA 2OSSA 4AYCA 3S92A 2VPBA 3AQAA 4HBXA 1V87A 3UVXA 1WESA 2K16A 5FBXA 2Y1MA 3U5PA 5DBMA 3RCWA 3MB3A 2L0BA 3MXFA 5I40A 4FO9A 3LJWA 4NYWA 3U5JA 4R7EA 4UIWA 5KHMA 5CUAA 2G43A 4O7FA 5EICA 4A9OA 1WEOA 2CSYA 2PNXA 3DPLR 2LXPC 2KYUA 4WA6A 2DWWA 4PPEA 4YYMA 5F61A 5E73A 3U5MA 4CUUA 5FE9A 1WEEA 4IC3A 5TB6A 4HXOA 4QUUA 5DW2A 5H1UA 4L58A 4O7EA 3U5KA 3O7AA 4YH3A 1N72A 3T7LA 2MJVB 4MEPA 5CRMA 2K4DA 5LKZA 2L80A 4PY6A 3RPGB 2GRCA 5ENGA 4UYHA 3SVHA 5TRBA 5I88A 2G4AA 4MVTA 4KV1A 2MA6A 5FE4A 5BT4A 2UZGA 3U5OA 3P1CA 5CQ4A 5C87A 2KWKA 2LSPB 4NUDA 2XEUA 4LJNA 4HXPA 5KH9A 5DYXA 5HELA 4I7DA 4A9FA 5FE8A 2CKLB 2KTBB 2CSZA 3JVLA 4CCGX 4NR4A 5CQ3A 2MIQA 4N4GA 4TT4A 4NUCA 3IHPA 3DAIA 4YK0A 4YAXA 2DX8A 2F42A 1T1HA 5D3SA 1F68A 3UV2A 3QZSA 2QJ0A 5ENHA 2FUUA 3MUKA 2RO1A 2L5UA 2VJEA 5HENA 5DLXA 4F3IA 2H60A 3G0JA 5EK9A 2R0SA 4HXNA 5CRZA 4YC9A 1U6GB 5FG5A 4YYDA 1WEMA 5D1KB 5FB0A 2LGLA 3N9LA 4Z1SA 4NR7A 2Y43A 5F2PA 5I83A 2FSAA 4UYEA 3KNVA 4WIVA 2YHOA 5LJ2A 1IYMA 5G4RA 4KV4A 5IBNA 4MR3A 2C2LA 4QNSA 5FG6A 4AKNA 5I86A 3NXBA 2YU4A 5FFVA 2L75A 5EM3A 1EQFA 4A9KA 2MUMA 2D9EA 5DX4A 4O76A 4XY9A 4DONA 5CY9A 2Y1NA 5B79A 5EYAF 4X2IA 3SVFA 2I50A 5I29A 3O70A 2JMJA 5A81A 1X4UA 2RS9B 2M6MA 2N9GA 2D82A 1DVPA 4KCXA 5FERA 4HBYA 4Z6HA 3M62A 3M99A 4WZ2A 2F6NA 2WP1A 3T6RA 4N3WA 5D3TA 4FK5A 4QY4A 5FE2A 3HCTA 5DKDA 2YT5A 5CZGA 5LJ1A 4QSSA 2WP2A 4IOOA 5EV9A 4QYDA 2I8NA 5TCMA 5II1A 5DW1A 4YY6A 4R2YA 5G04B 4YBSA 1WE9A 3GG3A 5ENFA 2VPEA 3SOXA 3GV4A 2YQLA 4PCEA 3KQIA 4N4HA 4I7CA 2NXBA 4BJXA 2YSMA 5CP5A 3L1ZB 2C2VS 5D1LB 2VJFB 5EPSA 5TBNA 5LJ0A 4Z6IA 5CTLA 5ENBA 4CA1A 4QC3A 5A82A 5IGMA 2OUOA 4MSXA 4CUQA 5D1MB 2KU3A 4AP4A 5I7YA 1E6IA 5D25A 2MNYA 4TKPB 5HQ5A 4TU4A 5JWMA 3IU6A 3U5NA 5FFYA 5LVQA 2KE1A 2E6SA 5E9KA 2VJEB 5KTWA 3C5KA 3SOWA 4UYGA 5EPRA 5B8DA 5D0CA 2ZETC 3UW9A 4J3IA 5A83A 4QEUA 5EWHA 3PHDA 4GNDA 2I7KA 5CGPA 3S91A 1WILA 4V3LC 4LZ2A 5E9YA 5E3DA 4P5OB 2ECTA 3JVKA 3KV5A 3K2JA 5LKXA 3EB6A 3MHSA 5EI4A 4NR8A 4B86C 4LZSA 5D3PA 5D3NA 1JM7B 4QSRA 2LV9A 4AUQB 4GNFA 3RPGC 5LVRA 1HYIA 5E9VA 5J3XA 5F36A 1MM2A 1WENA 4N4FA 4OGJA 4UIXA 3LRQA 3EB5A 5H1TA 5FE5A 4YYKA 2AN6A 4S3OC 5EVAA 5F1HA 4OUFA 4W4UA 4BW4A 4CUPA 5I7XA 5LUUA 3ZNIA 2L43A 3UVYA 5E9LA 5ENJA 4CUTA 4A9JA 4HXKA 4Q6FA 2YDWA 4N4IA 2E3KA 5G05B 5CQ5A 4NR9A 5H85A 4A9NA 5FE7A 4S3OB 3ZPV1 4QSXA 1VFYA 4YATA 2KWJA 2BAYA 4IC2A 2VJFA 2L5EA 5FE6A 3QZVA 5I80A 3ZTGA 5I1QA 5E0RA 4A9LA 3RTRB 4QB3A 3AADA 4I7BA 3HMEA 1XWHA 4NR6A 4QBMA 1RMDA 3O33A 5C7NA 2EGPA 3ONIA 4QSTA 5FB1A 2YEKA 4PCIA 2E7OA 4TTEA 3SVGA 4O7BA 2YW5A 4J0RA 4QF3A 3UVDA 1JOCA 5FH8A 2EA6A 2KGGA 3VK6A 4UYDA 5B77A 4CLBA 2DVRA 4O72A 2MNZA 3LXJA 2FUIA 4L7XA 5EWVA 3ZPVE 4XI1A 5CQ8A 5HFRA 5EWWA 5HRWA 1BORA 4IR4A 5DKHA 4ALGA 5A85A 1VYXA 3SOUA 4Y03A 2DATA 1WGMA 5DYUA 3FL2A 4YYJA 4FIPA 2KWOA 5ENIA 5CS8A 3HCSA 3UV4A 4QR4A 2DVSA 2YHNA 1WEWA 3HTKC 4Z93A 1JM7A 4UITA 5A5PA 4IR3A 4O77A 4A9IA 2LRIC 4A0CD 5IG6A 5C89A 2L84A 5DKCA 4LADB 1G25A 4TZ8A 2L85A 5FEYA 5KH3A 3ZVYA 5EQ1A 2M1RA 4BW2A 2K1JA 4UP5A 5IGKA 2F6JA 2CT2A 4LC2A 4O70A 4UIZA 3P5OA 5E9MA 5IIDA 2VPGA 4WZ3B 4TS8A 5HM0A 3JVMA 1X4JA 1CHCA 4YABA 2ECNA 2KR4A 5CUBA 3L11A 4C67A 5A7CA 2MD8C 5AIUA 4HXLA 4QSPA 5II2A 5C11A 5KTUA 3HMFA 5B76A 5COIA 1WEVA 5CQ7A 2OXQC 3P1EA 5CUGA 3V43A 5JG6A 2KWNA 3Q2FA 1WIMA 4XY8A 5CQ6A 2KGIA 5DYAA 4MR4A 5TDWA 3L1XA 5I3LA 4A9MA 5IGLA 2LGVA 3TLPA 5CUDA 5L96A 2LXHC 3ZYQA 4A9EA 4MEOA 5EU1A 3N9OA 2KFTA 4YADA 5AITA 1ZBDB 5D26A 2HDPA 5CFWA 1WUMA 4BBQA 5G0FA 1X0JA 2RNYA 4PS5A 4NUEA 3M63A 5EP7A 5FH7A 5KO4A 1FBVA 4GNEA 4B7YC 4PTBA 2RFJA 2DVQA 2K17A 4TT2A 5EA1A 4C66A 5DFDA 3ZVZB 3O37A 5KH7A 4AVXA 1LDJB 3MULA 1HYJA 5ACYA 4J1PA 2NAAA 4O7AA 4UIUA 3P1DA 4YBTA 2MA5A 4ZW1A 5DINA 3O34A 4LZRA 4UIVA 5TDRA 3NG2A 5L8UA 2YQMA 3N9QA 2ECJA 4QEVA 4TT6A 4TU6A 5F5ZA 4XYAA 5F63A 2G6QA 4HXSA 2VPDA 5D24A 3ASLA 4UP0A 4LYIA 5FE0A 5DYCA 4QYLA 5ENCA 4O64A 1N87A 3HMHA 5HQ6A 1Z60A 5EISA 1WEUA 2LDRA 2YYRA 2QICA 4C9ZA 2E6RA 4RVRA 1Z2QA 4A9HA 4X3GA 1WFKA 4O75A 1VD4A 4YY4A 5HLSA 4LKAA 5HEMA 5HQ7A 2ECWA 2M3HA 1WEQA 3UVWA 5B75A 3I2DA 4O74A 4FJCA 5JI8A 5LKTA 4MENA 4TQNA 5J0DA 4O7CA 3UV5A 5ETBA 5A5RA 5FE3A 1JSPB 3D7CA 5K29A 4XUAA 4QSWA 3DWYA 3KV6A 2RSDA 4YYHA 2LGGA 4CFKA 5FFWA 4J0SA 4Q0OA 5B78A 5A5NA 4HXRA 3DQVR 4NN2A 4QR5A 4NYVA 3N9MA 5KTXA 5DKAA 1E4UA 5D3HA 4NYXA 2YYNA 3PURA 5CPEA 4A4BA 1WEPA 5EGUA 3Q2EA 4V3KC 3FKMX 4IOQA 5DFCA 2HYED 5IGNA 4ZQLA 2YURA 1Z6UA 4ZUXU 4QC1A 4QZSA 5EWCA 3LQJA 3O35A 4CFLA 2KIZA 3IU5A 2YSJA 4ZC9A 2DVVA 4LRGA 5BT3A 5LCWB 2JMDA 3JVJA 5C85A 5F60A 3SHBA 5HRVA 3LQHA 4QF2A 3N9NA 3HCUA 2YEMA 4HBWA 5G4SA 3ZYUA 1K2FA 4YBMA 4NRAA 4MEQA 5A5QA 4A49A 5CU8A 5D7XA 3G0LA 5C8GA 2KREA 4YYIA 4QSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UYF A;  4GPJ A;  4WHU A;  5F25 A;  1FP0 A;  4GNG A;  2H0D B;  4LR6 A;  2YQD A;  4F52 B;  4IOR A;  2LGK A;  4O71 A;  2LQ6 A;  5D3L A;  5AD3 A;  5CQA A;  5HCL A;  4NXJ A;  2MT5 A;  5CUC A;  4IR6 A;  4LYS A;  2QIZ A;  2RNX A;  2G45 A;  4LYW A;  4MR6 A;  3MQM A;  4LK9 A;  2MD7 B;  4WZ0 A;  4A4C A;  5EWD A;  5FDZ A;  2DKW A;  4FLP A;  5E3G A;  2VNF A;  5FH6 A;  3N9P A;  4NRB A;  5AD2 A;  2YEL A;  5EPB A;  4AYC B;  2R0V A;  2PUY A;  5FG4 A;  5F62 A;  5AMF A;  2IDA A;  5TAB A;  5ENE A;  5C4Q A;  5HRX A;  3MHH A;  4Z1Q A;  5D3J A;  4CL9 A;  2VP7 A;  2JMI A;  5F3A A;  3GL6 A;  4UIY A;  1ZS5 A;  4BW3 A;  2E7N A;  3PUQ A;  5H9M A;  2ECG A;  2YRE A;  2R10 A;  4LDF A;  5L97 A;  1MM3 A;  4NQN A;  5H1V A;  4NRC A;  4YYG A;  4ALH A;  5E9I A;  4HXM A;  2ECI A;  4O78 A;  5C13 A;  4ZDT A;  5L99 A;  4CUS A;  2M85 A;  4CUR A;  2OO1 A;  4MR5 A;  2XB1 A;  1LDK C;  3C6W A;  2ECV A;  3P1F A;  4UI9 B;  2RNW A;  3MB4 A;  5E74 A;  4BHW A;  4QUT A;  2LN0 A;  2D8S A;  4GB0 A;  4QSU A;  2CKL A;  1JM4 B;  4NQM A;  3I3J A;  5CQT A;  5FE1 A;  5HJC A;  2R0Y A;  2YUC A;  5L8T A;  4NR5 A;  4LLB A;  4WHW A;  1F62 A;  4YYN A;  4OGI A;  4BW1 A;  4QEW A;  4HBV A;  5F1L A;  4TZ2 A;  4TYL A;  5ETD A;  2EOD A;  2JRJ A;  4QSV A;  5A5O A;  4Q0N A;  2H0D A;  4YH4 A;  5KU3 A;  3O36 A;  2YW8 A;  5HFQ A;  4E96 A;  5I89 A;  5E7D A;  3LQI A;  5AME A;  4R8P K;  2RI7 A;  4QR3 A;  5DLZ A;  5DFB A;  5BT5 A;  5A5S A;  1WUG A;  4UYF B;  5DY7 A;  4NS5 A;  3QZT A;  1X4I A;  5LKU A;  4XUB A;  4PKL A;  5CUE A;  5L98 A;  5D3R A;  4IR5 A;  3U5L A;  2OSS A;  4AYC A;  3S92 A;  2VPB A;  3AQA A;  4HBX A;  1V87 A;  3UVX A;  1WES A;  2K16 A;  5FBX A;  2Y1M A;  3U5P A;  5DBM A;  3RCW A;  3MB3 A;  2L0B A;  3MXF A;  5I40 A;  4FO9 A;  3LJW A;  4NYW A;  3U5J A;  4R7E A;  4UIW A;  5KHM A;  5CUA A;  2G43 A;  4O7F A;  5EIC A;  4A9O A;  1WEO A;  2CSY A;  2PNX A;  3DPL R;  2LXP C;  2KYU A;  4WA6 A;  2DWW A;  4PPE A;  4YYM A;  5F61 A;  5E73 A;  3U5M A;  4CUU A;  5FE9 A;  1WEE A;  4IC3 A;  5TB6 A;  4HXO A;  4QUU A;  5DW2 A;  5H1U A;  4L58 A;  4O7E A;  3U5K A;  3O7A A;  4YH3 A;  1N72 A;  3T7L A;  2MJV B;  4MEP A;  5CRM A;  2K4D A;  5LKZ A;  2L80 A;  4PY6 A;  3RPG B;  2GRC A;  5ENG A;  4UYH A;  3SVH A;  5TRB A;  5I88 A;  2G4A A;  4MVT A;  4KV1 A;  2MA6 A;  5FE4 A;  5BT4 A;  2UZG A;  3U5O A;  3P1C A;  5CQ4 A;  5C87 A;  2KWK A;  2LSP B;  4NUD A;  2XEU A;  4LJN A;  4HXP A;  5KH9 A;  5DYX A;  5HEL A;  4I7D A;  4A9F A;  5FE8 A;  2CKL B;  2KTB B;  2CSZ A;  3JVL A;  4CCG X;  4NR4 A;  5CQ3 A;  2MIQ A;  4N4G A;  4TT4 A;  4NUC A;  3IHP A;  3DAI A;  4YK0 A;  4YAX A;  2DX8 A;  2F42 A;  1T1H A;  5D3S A;  1F68 A;  3UV2 A;  3QZS A;  2QJ0 A;  5ENH A;  2FUU A;  3MUK A;  2RO1 A;  2L5U A;  2VJE A;  5HEN A;  5DLX A;  4F3I A;  2H60 A;  3G0J A;  5EK9 A;  2R0S A;  4HXN A;  5CRZ A;  4YC9 A;  1U6G B;  5FG5 A;  4YYD A;  1WEM A;  5D1K B;  5FB0 A;  2LGL A;  3N9L A;  4Z1S A;  4NR7 A;  2Y43 A;  5F2P A;  5I83 A;  2FSA A;  4UYE A;  3KNV A;  4WIV A;  2YHO A;  5LJ2 A;  1IYM A;  5G4R A;  4KV4 A;  5IBN A;  4MR3 A;  2C2L A;  4QNS A;  5FG6 A;  4AKN A;  5I86 A;  3NXB A;  2YU4 A;  5FFV A;  2L75 A;  5EM3 A;  1EQF A;  4A9K A;  2MUM A;  2D9E A;  5DX4 A;  4O76 A;  4XY9 A;  4DON A;  5CY9 A;  2Y1N A;  5B79 A;  5EYA F;  4X2I A;  3SVF A;  2I50 A;  5I29 A;  3O70 A;  2JMJ A;  5A81 A;  1X4U A;  2RS9 B;  2M6M A;  2N9G A;  2D82 A;  1DVP A;  4KCX A;  5FER A;  4HBY A;  4Z6H A;  3M62 A;  3M99 A;  4WZ2 A;  2F6N A;  2WP1 A;  3T6R A;  4N3W A;  5D3T A;  4FK5 A;  4QY4 A;  5FE2 A;  3HCT A;  5DKD A;  2YT5 A;  5CZG A;  5LJ1 A;  4QSS A;  2WP2 A;  4IOO A;  5EV9 A;  4QYD A;  2I8N A;  5TCM A;  5II1 A;  5DW1 A;  4YY6 A;  4R2Y A;  5G04 B;  4YBS A;  1WE9 A;  3GG3 A;  5ENF A;  2VPE A;  3SOX A;  3GV4 A;  2YQL A;  4PCE A;  3KQI A;  4N4H A;  4I7C A;  2NXB A;  4BJX A;  2YSM A;  5CP5 A;  3L1Z B;  2C2V S;  5D1L B;  2VJF B;  5EPS A;  5TBN A;  5LJ0 A;  4Z6I A;  5CTL A;  5ENB A;  4CA1 A;  4QC3 A;  5A82 A;  5IGM A;  2OUO A;  4MSX A;  4CUQ A;  5D1M B;  2KU3 A;  4AP4 A;  5I7Y A;  1E6I A;  5D25 A;  2MNY A;  4TKP B;  5HQ5 A;  4TU4 A;  5JWM A;  3IU6 A;  3U5N A;  5FFY A;  5LVQ A;  2KE1 A;  2E6S A;  5E9K A;  2VJE B;  5KTW A;  3C5K A;  3SOW A;  4UYG A;  5EPR A;  5B8D A;  5D0C A;  2ZET C;  3UW9 A;  4J3I A;  5A83 A;  4QEU A;  5EWH A;  3PHD A;  4GND A;  2I7K A;  5CGP A;  3S91 A;  1WIL A;  4V3L C;  4LZ2 A;  5E9Y A;  5E3D A;  4P5O B;  2ECT A;  3JVK A;  3KV5 A;  3K2J A;  5LKX A;  3EB6 A;  3MHS A;  5EI4 A;  4NR8 A;  4B86 C;  4LZS A;  5D3P A;  5D3N A;  1JM7 B;  4QSR A;  2LV9 A;  4AUQ B;  4GNF A;  3RPG C;  5LVR A;  1HYI A;  5E9V A;  5J3X A;  5F36 A;  1MM2 A;  1WEN A;  4N4F A;  4OGJ A;  4UIX A;  3LRQ A;  3EB5 A;  5H1T A;  5FE5 A;  4YYK A;  2AN6 A;  4S3O C;  5EVA A;  5F1H A;  4OUF A;  4W4U A;  4BW4 A;  4CUP A;  5I7X A;  5LUU A;  3ZNI A;  2L43 A;  3UVY A;  5E9L A;  5ENJ A;  4CUT A;  4A9J A;  4HXK A;  4Q6F A;  2YDW A;  4N4I A;  2E3K A;  5G05 B;  5CQ5 A;  4NR9 A;  5H85 A;  4A9N A;  5FE7 A;  4S3O B;  3ZPV 1;  4QSX A;  1VFY A;  4YAT A;  2KWJ A;  2BAY A;  4IC2 A;  2VJF A;  2L5E A;  5FE6 A;  3QZV A;  5I80 A;  3ZTG A;  5I1Q A;  5E0R A;  4A9L A;  3RTR B;  4QB3 A;  3AAD A;  4I7B A;  3HME A;  1XWH A;  4NR6 A;  4QBM A;  1RMD A;  3O33 A;  5C7N A;  2EGP A;  3ONI A;  4QST A;  5FB1 A;  2YEK A;  4PCI A;  2E7O A;  4TTE A;  3SVG A;  4O7B A;  2YW5 A;  4J0R A;  4QF3 A;  3UVD A;  1JOC A;  5FH8 A;  2EA6 A;  2KGG A;  3VK6 A;  4UYD A;  5B77 A;  4CLB A;  2DVR A;  4O72 A;  2MNZ A;  3LXJ A;  2FUI A;  4L7X A;  5EWV A;  3ZPV E;  4XI1 A;  5CQ8 A;  5HFR A;  5EWW A;  5HRW A;  1BOR A;  4IR4 A;  5DKH A;  4ALG A;  5A85 A;  1VYX A;  3SOU A;  4Y03 A;  2DAT A;  1WGM A;  5DYU A;  3FL2 A;  4YYJ A;  4FIP A;  2KWO A;  5ENI A;  5CS8 A;  3HCS A;  3UV4 A;  4QR4 A;  2DVS A;  2YHN A;  1WEW A;  3HTK C;  4Z93 A;  1JM7 A;  4UIT A;  5A5P A;  4IR3 A;  4O77 A;  4A9I A;  2LRI C;  4A0C D;  5IG6 A;  5C89 A;  2L84 A;  5DKC A;  4LAD B;  1G25 A;  4TZ8 A;  2L85 A;  5FEY A;  5KH3 A;  3ZVY A;  5EQ1 A;  2M1R A;  4BW2 A;  2K1J A;  4UP5 A;  5IGK A;  2F6J A;  2CT2 A;  4LC2 A;  4O70 A;  4UIZ A;  3P5O A;  5E9M A;  5IID A;  2VPG A;  4WZ3 B;  4TS8 A;  5HM0 A;  3JVM A;  1X4J A;  1CHC A;  4YAB A;  2ECN A;  2KR4 A;  5CUB A;  3L11 A;  4C67 A;  5A7C A;  2MD8 C;  5AIU A;  4HXL A;  4QSP A;  5II2 A;  5C11 A;  5KTU A;  3HMF A;  5B76 A;  5COI A;  1WEV A;  5CQ7 A;  2OXQ C;  3P1E A;  5CUG A;  3V43 A;  5JG6 A;  2KWN A;  3Q2F A;  1WIM A;  4XY8 A;  5CQ6 A;  2KGI A;  5DYA A;  4MR4 A;  5TDW A;  3L1X A;  5I3L A;  4A9M A;  5IGL A;  2LGV A;  3TLP A;  5CUD A;  5L96 A;  2LXH C;  3ZYQ A;  4A9E A;  4MEO A;  5EU1 A;  3N9O A;  2KFT A;  4YAD A;  5AIT A;  1ZBD B;  5D26 A;  2HDP A;  5CFW A;  1WUM A;  4BBQ A;  5G0F A;  1X0J A;  2RNY A;  4PS5 A;  4NUE A;  3M63 A;  5EP7 A;  5FH7 A;  5KO4 A;  1FBV A;  4GNE A;  4B7Y C;  4PTB A;  2RFJ A;  2DVQ A;  2K17 A;  4TT2 A;  5EA1 A;  4C66 A;  5DFD A;  3ZVZ B;  3O37 A;  5KH7 A;  4AVX A;  1LDJ B;  3MUL A;  1HYJ A;  5ACY A;  4J1P A;  2NAA A;  4O7A A;  4UIU A;  3P1D A;  4YBT A;  2MA5 A;  4ZW1 A;  5DIN A;  3O34 A;  4LZR A;  4UIV A;  5TDR A;  3NG2 A;  5L8U A;  2YQM A;  3N9Q A;  2ECJ A;  4QEV A;  4TT6 A;  4TU6 A;  5F5Z A;  4XYA A;  5F63 A;  2G6Q A;  4HXS A;  2VPD A;  5D24 A;  3ASL A;  4UP0 A;  4LYI A;  5FE0 A;  5DYC A;  4QYL A;  5ENC A;  4O64 A;  1N87 A;  3HMH A;  5HQ6 A;  1Z60 A;  5EIS A;  1WEU A;  2LDR A;  2YYR A;  2QIC A;  4C9Z A;  2E6R A;  4RVR A;  1Z2Q A;  4A9H A;  4X3G A;  1WFK A;  4O75 A;  1VD4 A;  4YY4 A;  5HLS A;  4LKA A;  5HEM A;  5HQ7 A;  2ECW A;  2M3H A;  1WEQ A;  3UVW A;  5B75 A;  3I2D A;  4O74 A;  4FJC A;  5JI8 A;  5LKT A;  4MEN A;  4TQN A;  5J0D A;  4O7C A;  3UV5 A;  5ETB A;  5A5R A;  5FE3 A;  1JSP B;  3D7C A;  5K29 A;  4XUA A;  4QSW A;  3DWY A;  3KV6 A;  2RSD A;  4YYH A;  2LGG A;  4CFK A;  5FFW A;  4J0S A;  4Q0O A;  5B78 A;  5A5N A;  4HXR A;  3DQV R;  4NN2 A;  4QR5 A;  4NYV A;  3N9M A;  5KTX A;  5DKA A;  1E4U A;  5D3H A;  4NYX A;  2YYN A;  3PUR A;  5CPE A;  4A4B A;  1WEP A;  5EGU A;  3Q2E A;  4V3K C;  3FKM X;  4IOQ A;  5DFC A;  2HYE D;  5IGN A;  4ZQL A;  2YUR A;  1Z6U A;  4ZUX U;  4QC1 A;  4QZS A;  5EWC A;  3LQJ A;  3O35 A;  4CFL A;  2KIZ A;  3IU5 A;  2YSJ A;  4ZC9 A;  2DVV A;  4LRG A;  5BT3 A;  5LCW B;  2JMD A;  3JVJ A;  5C85 A;  5F60 A;  3SHB A;  5HRV A;  3LQH A;  4QF2 A;  3N9N A;  3HCU A;  2YEM A;  4HBW A;  5G4S A;  3ZYU A;  1K2F A;  4YBM A;  4NRA A;  4MEQ A;  5A5Q A;  4A49 A;  5CU8 A;  5D7X A;  3G0L A;  5C8G A;  2KRE A;  4YYI A;  4QSQ A; 
#chains in the Genus database with same CATH topology
 4UYF A;  4GPJ A;  2E61 A;  4WHU A;  5F25 A;  1FP0 A;  4GNG A;  2H0D B;  4LR6 A;  2YQD A;  4F52 B;  4IOR A;  3T9K A;  3DWD A;  2LGK A;  4O71 A;  2LQ6 A;  5D3L A;  5AD3 A;  5CQA A;  5HCL A;  4NXJ A;  2MT5 A;  5CUC A;  4IR6 A;  4LYS A;  2QIZ A;  2RNX A;  2G45 A;  4LYW A;  4MR6 A;  3MQM A;  4LK9 A;  2MD7 B;  4WZ0 A;  4A4C A;  5EWD A;  2P57 A;  5FDZ A;  2DKW A;  4FLP A;  5E3G A;  2VNF A;  5FH6 A;  3N9P A;  4NRB A;  5AD2 A;  2YEL A;  5EPB A;  4AYC B;  2R0V A;  2PUY A;  2CSV A;  5FG4 A;  5F62 A;  5AMF A;  2IDA A;  5TAB A;  5ENE A;  5C4Q A;  5HRX A;  3MHH A;  4Z1Q A;  5D3J A;  4CL9 A;  2VP7 A;  2JMI A;  5F3A A;  2KKX A;  3GL6 A;  4UIY A;  1ZS5 A;  4BW3 A;  4F1P A;  2E7N A;  3PUQ A;  5H9M A;  2ECG A;  2OWA A;  4AKH A;  2YRE A;  1ZKR A;  2R10 A;  4LDF A;  5L97 A;  3H7H A;  1MM3 A;  4NQN A;  5H1V A;  4NRC A;  4YYG A;  4ALH A;  5E9I A;  4HXM A;  2ECI A;  4O78 A;  5C13 A;  4ZDT A;  5L99 A;  4CUS A;  2M85 A;  4CUR A;  2OO1 A;  4MR5 A;  2XB1 A;  1LDK C;  3C6W A;  2ECV A;  3P1F A;  4UI9 B;  2RNW A;  3MB4 A;  5E74 A;  4BHW A;  4QUT A;  2LN0 A;  2D8S A;  4GB0 A;  4QSU A;  3Q1D A;  2CKL A;  1JM4 B;  2KKY A;  2MKE A;  4NQM A;  3I3J A;  5CQT A;  5FE1 A;  5HJC A;  2R0Y A;  2YUC A;  5L8T A;  4NR5 A;  4LLB A;  4WHW A;  1F62 A;  4YYN A;  4OGI A;  4BW1 A;  4QEW A;  4HBV A;  5F1L A;  2L7P A;  4TZ2 A;  4TYL A;  5ETD A;  2DSM A;  2EOD A;  2JRJ A;  4QSV A;  5A5O A;  4Q0N A;  2H0D A;  4YH4 A;  5KU3 A;  3O36 A;  2YW8 A;  5HFQ A;  4E96 A;  2D8U A;  5I89 A;  5E7D A;  3LQI A;  5AME A;  4R8P K;  2RI7 A;  3FAO A;  4QR3 A;  5DLZ A;  5DFB A;  5BT5 A;  5A5S A;  1WUG A;  4UYF B;  5DY7 A;  4NS5 A;  3QZT A;  1X4I A;  5LKU A;  4XUB A;  4PKL A;  5CUE A;  5L98 A;  5D3R A;  4IR5 A;  3U5L A;  2OSS A;  4AYC A;  3S92 A;  2VPB A;  3AQA A;  4HBX A;  1V87 A;  2EJN A;  3UVX A;  1WES A;  2K16 A;  5FBX A;  2CON A;  2Y1M A;  3U5P A;  5DBM A;  3RCW A;  2YVR A;  3MB3 A;  2L0B A;  3MXF A;  5I40 A;  3FEH A;  4FO9 A;  3LJW A;  4NYW A;  3U5J A;  4R7E A;  4UIW A;  5SVI A;  5KHM A;  5CUA A;  2G43 A;  4O7F A;  5EIC A;  4A9O A;  1WEO A;  2CSY A;  2PNX A;  3DPL R;  2LXP C;  2KYU A;  4WA6 A;  2DWW A;  4PPE A;  4YYM A;  5F61 A;  5E73 A;  3U5M A;  4CUU A;  5FE9 A;  1WEE A;  4IC3 A;  5TB6 A;  4HXO A;  4QUU A;  5DW2 A;  5H1U A;  4L58 A;  4O7E A;  3U5K A;  3O7A A;  4YH3 A;  1N72 A;  3T7L A;  2MJV B;  4MEP A;  5CRM A;  2K4D A;  5LKZ A;  2L80 A;  4PY6 A;  3RPG B;  2GRC A;  5ENG A;  4UYH A;  3SVH A;  5TRB A;  5I88 A;  2G4A A;  4MVT A;  2JM3 A;  4KV1 A;  2MA6 A;  5FE4 A;  3DDT A;  5BT4 A;  4AI6 A;  5K3Q A;  2UZG A;  3U5O A;  3P1C A;  5CQ4 A;  5C87 A;  2KWK A;  2LSP B;  4NUD A;  2EGM A;  2XEU A;  4HXP A;  4LJN A;  5KH9 A;  5DYX A;  5HEL A;  4I7D A;  4A9F A;  5FE8 A;  2CKL B;  2KTB B;  2CSZ A;  3JVL A;  4CCG X;  4NR4 A;  5CQ3 A;  2MIQ A;  4N4G A;  4TT4 A;  4NUC A;  3IHP A;  3DAI A;  4YK0 A;  4YAX A;  2DX8 A;  2F42 A;  1T1H A;  5D3S A;  1F68 A;  3UV2 A;  3QZS A;  2QJ0 A;  5ENH A;  2FUU A;  3MUK A;  2RO1 A;  2L5U A;  2VJE A;  5HEN A;  5DLX A;  4F3I A;  2H60 A;  3G0J A;  5EK9 A;  2R0S A;  4HXN A;  5CRZ A;  4YC9 A;  1U6G B;  5FG5 A;  4YYD A;  3SUB A;  1WEM A;  5D1K B;  5FB0 A;  2LGL A;  3N9L A;  4Z1S A;  4NR7 A;  2Y43 A;  5F2P A;  5I83 A;  2FSA A;  4UYE A;  3KNV A;  4WIV A;  1DCQ A;  5LJ2 A;  2FD4 A;  2YHO A;  5G4R A;  1IYM A;  4KV4 A;  5IBN A;  4MR3 A;  2C2L A;  4QNS A;  3PLW A;  3KDE C;  5FG6 A;  4AKN A;  5I86 A;  3NXB A;  2YU4 A;  5FFV A;  2L75 A;  5EM3 A;  3D1D A;  1EQF A;  4A9K A;  2MUM A;  2D9E A;  5DX4 A;  4O76 A;  4XY9 A;  4DON A;  5CY9 A;  2Y1N A;  5B79 A;  5EYA F;  4X2I A;  4OGE A;  3SVF A;  2I50 A;  5I29 A;  3O70 A;  2JMJ A;  5SVI B;  5A81 A;  1X4U A;  2RS9 B;  2M6M A;  2N9G A;  2D82 A;  1DVP A;  4KCX A;  2LAU A;  5FER A;  4HBY A;  4Z6H A;  3M62 A;  3M99 A;  4WZ2 A;  2F6N A;  2WP1 A;  3T6R A;  4N3W A;  2FFW A;  5D3T A;  4FK5 A;  4QY4 A;  5FE2 A;  3HCT A;  4AKG A;  5DKD A;  2YT5 A;  5CZG A;  5LJ1 A;  4QSS A;  2WP2 A;  4IOO A;  5EV9 A;  4QYD A;  2I8N A;  3FAN A;  5TCM A;  5II1 A;  5DW1 A;  4YY6 A;  4R2Y A;  5G04 B;  4YBS A;  1WE9 A;  3GG3 A;  5ENF A;  2VPE A;  3SOX A;  3GV4 A;  2YQL A;  4PCE A;  3KQI A;  4N4H A;  4I7C A;  2NXB A;  4BJX A;  2YSM A;  5CP5 A;  3L1Z B;  2C2V S;  5D1L B;  2VJF B;  5EPS A;  5TBN A;  5LJ0 A;  4Z6I A;  5CTL A;  5ENB A;  4CA1 A;  4QC3 A;  5A82 A;  5IGM A;  2OUO A;  4MSX A;  4CUQ A;  5D1M B;  2KU3 A;  4AP4 A;  5I7Y A;  1E6I A;  5D25 A;  2MNY A;  4TKP B;  5HQ5 A;  4TU4 A;  5JWM A;  3IU6 A;  3U5N A;  5FFY A;  5LVQ A;  2KE1 A;  2E6S A;  5E9K A;  2VJE B;  5KTW A;  3C5K A;  3SOW A;  4UYG A;  5EPR A;  5B8D A;  5D0C A;  2ZET C;  3UW9 A;  4J3I A;  5A83 A;  4QEU A;  5EWH A;  3PHD A;  2CRR A;  4GND A;  2I7K A;  4OGC A;  5CGP A;  3S91 A;  1WIL A;  4V3L C;  4LZ2 A;  5E9Y A;  5E3D A;  4P5O B;  2ECT A;  3JVK A;  3KV5 A;  3K2J A;  5LKX A;  3EB6 A;  3MHS A;  5EI4 A;  4NR8 A;  4B86 C;  4LZS A;  5D3P A;  5D3N A;  1JM7 B;  3VKH A;  4QSR A;  2LV9 A;  4AUQ B;  5SVY A;  4GNF A;  3RPG C;  5LVR A;  1HYI A;  5E9V A;  5J3X A;  5F36 A;  1MM2 A;  1WEN A;  3LVR E;  4N4F A;  4OGJ A;  4UIX A;  3LRQ A;  3EB5 A;  5H1T A;  5FE5 A;  4YYK A;  2AN6 A;  4O62 A;  5EVA A;  5F1H A;  4OUF A;  4S3O C;  4W4U A;  4BW4 A;  4CUP A;  5I7X A;  5LUU A;  3ZNI A;  2L43 A;  3UVY A;  5E9L A;  5ENJ A;  4CUT A;  4A9J A;  4HXK A;  4Q6F A;  2YDW A;  4N4I A;  2E3K A;  5G05 B;  5CQ5 A;  4NR9 A;  5H85 A;  4A9N A;  5FE7 A;  4S3O B;  3ZPV 1;  2XP0 A;  4QSX A;  1VFY A;  4YAT A;  2KWJ A;  2BAY A;  4IC2 A;  2VJF A;  3LVQ E;  3D1B A;  2L5E A;  5FE6 A;  3QZV A;  5I80 A;  3ZTG A;  5I1Q A;  5E0R A;  4A9L A;  3RTR B;  4QB3 A;  3AAD A;  4I7B A;  3HME A;  1XWH A;  4NR6 A;  4QBM A;  1RMD A;  3O33 A;  5C7N A;  2EGP A;  3ONI A;  4QST A;  5FB1 A;  2YEK A;  4PCI A;  2E7O A;  4TTE A;  3SVG A;  4O7B A;  2IQJ A;  2YW5 A;  4J0R A;  4QF3 A;  3UVD A;  1JOC A;  5FH8 A;  2EA6 A;  2KGG A;  3VK6 A;  4UYD A;  5B77 A;  4CLB A;  2DVR A;  4O72 A;  2MNZ A;  3LXJ A;  2FUI A;  4L7X A;  5EWV A;  3ZPV E;  4XI1 A;  5CQ8 A;  5HFR A;  5EWW A;  5HRW A;  1BOR A;  4IR4 A;  5DKH A;  4ALG A;  5A85 A;  1VYX A;  2EXU A;  3SOU A;  4Y03 A;  2DAT A;  1WGM A;  5DYU A;  3FL2 A;  4YYJ A;  4FIP A;  2KWO A;  5ENI A;  5CS8 A;  3HCS A;  3UV4 A;  4QR4 A;  2DVS A;  2YHN A;  1WEW A;  3HTK C;  4Z93 A;  1JM7 A;  4UIT A;  5A5P A;  4IR3 A;  4O77 A;  4A9I A;  2LRI C;  4A0C D;  5IG6 A;  5C89 A;  2L84 A;  5DKC A;  4LAD B;  1G25 A;  4TZ8 A;  2L85 A;  5FEY A;  5KH3 A;  3ZVY A;  5EQ1 A;  2M1R A;  4BW2 A;  2K1J A;  4UP5 A;  4QQ4 A;  5IGK A;  2F6J A;  2CT2 A;  4LC2 A;  4O70 A;  4UIZ A;  3P5O A;  5E9M A;  5IID A;  2VPG A;  4WZ3 B;  4TS8 A;  5HM0 A;  4AKI A;  3JVM A;  1X4J A;  1CHC A;  4YAB A;  2ECN A;  2KR4 A;  5CUB A;  3L11 A;  4C67 A;  5A7C A;  2MD8 C;  5AIU A;  4HXL A;  4QSP A;  5II2 A;  5C11 A;  3M7K A;  5KTU A;  3HMF A;  5B76 A;  5COI A;  1WEV A;  5CQ7 A;  2OXQ C;  3P1E A;  5CUG A;  3V43 A;  5JG6 A;  2B0O E;  2KWN A;  3Q2F A;  1WIM A;  4XY8 A;  5CQ6 A;  2KGI A;  5DYA A;  4MR4 A;  3FM8 C;  5TDW A;  3L1X A;  5I3L A;  4A9M A;  5IGL A;  2M13 A;  2LGV A;  3TLP A;  5CUD A;  5L96 A;  2LXH C;  3ZYQ A;  4A9E A;  4MEO A;  5EU1 A;  3N9O A;  2XOC A;  2KFT A;  3LJU X;  4YAD A;  5AIT A;  1ZBD B;  5D26 A;  2HDP A;  5CFW A;  1WUM A;  3E2D A;  4BBQ A;  5G0F A;  1X0J A;  2RNY A;  4PS5 A;  4NUE A;  3M63 A;  5EP7 A;  5FH7 A;  5KO4 A;  1FBV A;  4GNE A;  4B7Y C;  4PTB A;  2RFJ A;  2DVQ A;  3ERR A;  2K17 A;  4TT2 A;  5EA1 A;  4C66 A;  5DFD A;  3ZVZ B;  3O37 A;  5KH7 A;  4AVX A;  1LDJ B;  3MUL A;  5SVX A;  5ACY A;  1HYJ A;  4J1P A;  2NAA A;  4O7A A;  4UIU A;  3P1D A;  4YBT A;  2MA5 A;  3JUE A;  4ZW1 A;  5DIN A;  3O34 A;  4LZR A;  4UIV A;  5TDR A;  3NG2 A;  4Z0O A;  5L8U A;  2YQM A;  3N9Q A;  2ECJ A;  4QEV A;  4TT6 A;  4TU6 A;  5F5Z A;  4XYA A;  5F63 A;  2G6Q A;  4HXS A;  2VPD A;  5D24 A;  3ASL A;  4UP0 A;  4LYI A;  2XOY A;  5FE0 A;  4Z0R A;  5DYC A;  4QYL A;  5ENC A;  4O64 A;  1N87 A;  3LDY A;  3HMH A;  5HQ6 A;  1Z60 A;  5EIS A;  1WEU A;  2LDR A;  2YYR A;  2QIC A;  4C9Z A;  2E6R A;  4RVR A;  1Z2Q A;  4A9H A;  4X3G A;  1WFK A;  4O75 A;  1VD4 A;  4YY4 A;  5HLS A;  4LKA A;  5HEM A;  5HQ7 A;  2ECW A;  2M3H A;  1PUO A;  3O47 A;  1WEQ A;  3UVW A;  5B75 A;  4H9D A;  3I2D A;  4O74 A;  2XOZ A;  4FJC A;  5JI8 A;  5LKT A;  4MEN A;  4TQN A;  5J0D A;  4O7C A;  3UV5 A;  5ETB A;  5A5R A;  5FE3 A;  1JSP B;  3D7C A;  5K29 A;  4XUA A;  4QSW A;  3DWY A;  3KV6 A;  2RSD A;  4YYH A;  2LGG A;  4CFK A;  5FFW A;  2JUN A;  2CRW A;  4J0S A;  4Q0O A;  5B78 A;  5A5N A;  4HXR A;  3DQV R;  4NN2 A;  4QR5 A;  4NYV A;  3N9M A;  5KTX A;  5DKA A;  1E4U A;  5D3H A;  4NYX A;  2YYN A;  3PUR A;  5CPE A;  4A4B A;  1WEP A;  5EGU A;  3Q2E A;  2RR4 A;  3FKM X;  4IOQ A;  4V3K C;  5DFC A;  2HYE D;  5IGN A;  4ZQL A;  2YUR A;  3FJU B;  1Z6U A;  4ZUX U;  4QC1 A;  4QZS A;  5EWC A;  3LQJ A;  3O35 A;  4CFL A;  2KIZ A;  3IU5 A;  2YSJ A;  4ZC9 A;  2DVV A;  4LRG A;  5BT3 A;  5LCW B;  2JMD A;  3JVJ A;  5C85 A;  5F60 A;  3SHB A;  1MBM A;  5HRV A;  3LQH A;  4QF2 A;  2DJA A;  3MDB C;  3N9N A;  3HCU A;  2YEM A;  4HBW A;  5G4S A;  3ZYU A;  1K2F A;  4YBM A;  4NRA A;  4MEQ A;  5A5Q A;  4A49 A;  5CU8 A;  5D7X A;  3G0L A;  5C8G A;  3VKG A;  2KRE A;  4YYI A;  4QSQ A; 
#chains in the Genus database with same CATH homology
 4UYF A;  4GPJ A;  4WHU A;  5F25 A;  1FP0 A;  4GNG A;  2H0D B;  4LR6 A;  2YQD A;  4F52 B;  4IOR A;  2LGK A;  4O71 A;  2LQ6 A;  5D3L A;  5AD3 A;  5CQA A;  5HCL A;  4NXJ A;  2MT5 A;  5CUC A;  4IR6 A;  4LYS A;  2QIZ A;  2RNX A;  2G45 A;  4LYW A;  4MR6 A;  3MQM A;  4LK9 A;  2MD7 B;  4WZ0 A;  4A4C A;  5EWD A;  5FDZ A;  2DKW A;  4FLP A;  5E3G A;  2VNF A;  5FH6 A;  3N9P A;  4NRB A;  5AD2 A;  2YEL A;  5EPB A;  4AYC B;  2R0V A;  2PUY A;  5FG4 A;  5F62 A;  5AMF A;  2IDA A;  5TAB A;  5ENE A;  5C4Q A;  5HRX A;  3MHH A;  4Z1Q A;  5D3J A;  4CL9 A;  2VP7 A;  2JMI A;  5F3A A;  3GL6 A;  4UIY A;  1ZS5 A;  4BW3 A;  2E7N A;  3PUQ A;  5H9M A;  2ECG A;  2YRE A;  2R10 A;  4LDF A;  5L97 A;  1MM3 A;  4NQN A;  5H1V A;  4NRC A;  4YYG A;  4ALH A;  5E9I A;  4HXM A;  2ECI A;  4O78 A;  5C13 A;  4ZDT A;  5L99 A;  4CUS A;  2M85 A;  4CUR A;  2OO1 A;  4MR5 A;  2XB1 A;  1LDK C;  3C6W A;  2ECV A;  3P1F A;  4UI9 B;  2RNW A;  3MB4 A;  5E74 A;  4BHW A;  4QUT A;  2LN0 A;  2D8S A;  4GB0 A;  4QSU A;  2CKL A;  1JM4 B;  4NQM A;  3I3J A;  5CQT A;  5FE1 A;  5HJC A;  2R0Y A;  2YUC A;  5L8T A;  4NR5 A;  4LLB A;  4WHW A;  1F62 A;  4YYN A;  4OGI A;  4BW1 A;  4QEW A;  4HBV A;  5F1L A;  4TZ2 A;  4TYL A;  5ETD A;  2EOD A;  2JRJ A;  4QSV A;  5A5O A;  4Q0N A;  2H0D A;  4YH4 A;  5KU3 A;  3O36 A;  2YW8 A;  5HFQ A;  4E96 A;  5I89 A;  5E7D A;  3LQI A;  5AME A;  4R8P K;  2RI7 A;  4QR3 A;  5DLZ A;  5DFB A;  5BT5 A;  5A5S A;  1WUG A;  4UYF B;  5DY7 A;  4NS5 A;  3QZT A;  1X4I A;  5LKU A;  4XUB A;  4PKL A;  5CUE A;  5L98 A;  5D3R A;  4IR5 A;  3U5L A;  2OSS A;  4AYC A;  3S92 A;  2VPB A;  3AQA A;  4HBX A;  1V87 A;  3UVX A;  1WES A;  2K16 A;  5FBX A;  2Y1M A;  3U5P A;  5DBM A;  3RCW A;  3MB3 A;  2L0B A;  3MXF A;  5I40 A;  4FO9 A;  3LJW A;  4NYW A;  3U5J A;  4R7E A;  4UIW A;  5KHM A;  5CUA A;  2G43 A;  4O7F A;  5EIC A;  4A9O A;  1WEO A;  2CSY A;  2PNX A;  3DPL R;  2LXP C;  2KYU A;  4WA6 A;  2DWW A;  4PPE A;  4YYM A;  5F61 A;  5E73 A;  3U5M A;  4CUU A;  5FE9 A;  1WEE A;  4IC3 A;  5TB6 A;  4HXO A;  4QUU A;  5DW2 A;  5H1U A;  4L58 A;  4O7E A;  3U5K A;  3O7A A;  4YH3 A;  1N72 A;  3T7L A;  2MJV B;  4MEP A;  5CRM A;  2K4D A;  5LKZ A;  2L80 A;  4PY6 A;  3RPG B;  2GRC A;  5ENG A;  4UYH A;  3SVH A;  5TRB A;  5I88 A;  2G4A A;  4MVT A;  4KV1 A;  2MA6 A;  5FE4 A;  5BT4 A;  2UZG A;  3U5O A;  3P1C A;  5CQ4 A;  5C87 A;  2KWK A;  2LSP B;  4NUD A;  2XEU A;  4LJN A;  4HXP A;  5KH9 A;  5DYX A;  5HEL A;  4I7D A;  4A9F A;  5FE8 A;  2CKL B;  2KTB B;  2CSZ A;  3JVL A;  4CCG X;  4NR4 A;  5CQ3 A;  2MIQ A;  4N4G A;  4TT4 A;  4NUC A;  3IHP A;  3DAI A;  4YK0 A;  4YAX A;  2DX8 A;  2F42 A;  1T1H A;  5D3S A;  1F68 A;  3UV2 A;  3QZS A;  2QJ0 A;  5ENH A;  2FUU A;  3MUK A;  2RO1 A;  2L5U A;  2VJE A;  5HEN A;  5DLX A;  4F3I A;  2H60 A;  3G0J A;  5EK9 A;  2R0S A;  4HXN A;  5CRZ A;  4YC9 A;  1U6G B;  5FG5 A;  4YYD A;  1WEM A;  5D1K B;  5FB0 A;  2LGL A;  3N9L A;  4Z1S A;  4NR7 A;  2Y43 A;  5F2P A;  5I83 A;  2FSA A;  4UYE A;  3KNV A;  4WIV A;  2YHO A;  5LJ2 A;  1IYM A;  5G4R A;  4KV4 A;  5IBN A;  4MR3 A;  2C2L A;  4QNS A;  5FG6 A;  4AKN A;  5I86 A;  3NXB A;  2YU4 A;  5FFV A;  2L75 A;  5EM3 A;  1EQF A;  4A9K A;  2MUM A;  2D9E A;  5DX4 A;  4O76 A;  4XY9 A;  4DON A;  5CY9 A;  2Y1N A;  5B79 A;  5EYA F;  4X2I A;  3SVF A;  2I50 A;  5I29 A;  3O70 A;  2JMJ A;  5A81 A;  1X4U A;  2RS9 B;  2M6M A;  2N9G A;  2D82 A;  1DVP A;  4KCX A;  5FER A;  4HBY A;  4Z6H A;  3M62 A;  3M99 A;  4WZ2 A;  2F6N A;  2WP1 A;  3T6R A;  4N3W A;  5D3T A;  4FK5 A;  4QY4 A;  5FE2 A;  3HCT A;  5DKD A;  2YT5 A;  5CZG A;  5LJ1 A;  4QSS A;  2WP2 A;  4IOO A;  5EV9 A;  4QYD A;  2I8N A;  5TCM A;  5II1 A;  5DW1 A;  4YY6 A;  4R2Y A;  5G04 B;  4YBS A;  1WE9 A;  3GG3 A;  5ENF A;  2VPE A;  3SOX A;  3GV4 A;  2YQL A;  4PCE A;  3KQI A;  4N4H A;  4I7C A;  2NXB A;  4BJX A;  2YSM A;  5CP5 A;  3L1Z B;  2C2V S;  5D1L B;  2VJF B;  5EPS A;  5TBN A;  5LJ0 A;  4Z6I A;  5CTL A;  5ENB A;  4CA1 A;  4QC3 A;  5A82 A;  5IGM A;  2OUO A;  4MSX A;  4CUQ A;  5D1M B;  2KU3 A;  4AP4 A;  5I7Y A;  1E6I A;  5D25 A;  2MNY A;  4TKP B;  5HQ5 A;  4TU4 A;  5JWM A;  3IU6 A;  3U5N A;  5FFY A;  5LVQ A;  2KE1 A;  2E6S A;  5E9K A;  2VJE B;  5KTW A;  3C5K A;  3SOW A;  4UYG A;  5EPR A;  5B8D A;  5D0C A;  2ZET C;  3UW9 A;  4J3I A;  5A83 A;  4QEU A;  5EWH A;  3PHD A;  4GND A;  2I7K A;  5CGP A;  3S91 A;  1WIL A;  4V3L C;  4LZ2 A;  5E9Y A;  5E3D A;  4P5O B;  2ECT A;  3JVK A;  3KV5 A;  3K2J A;  5LKX A;  3EB6 A;  3MHS A;  5EI4 A;  4NR8 A;  4B86 C;  4LZS A;  5D3P A;  5D3N A;  1JM7 B;  4QSR A;  2LV9 A;  4AUQ B;  4GNF A;  3RPG C;  5LVR A;  1HYI A;  5E9V A;  5J3X A;  5F36 A;  1MM2 A;  1WEN A;  4N4F A;  4OGJ A;  4UIX A;  3LRQ A;  3EB5 A;  5H1T A;  5FE5 A;  4YYK A;  2AN6 A;  4S3O C;  5EVA A;  5F1H A;  4OUF A;  4W4U A;  4BW4 A;  4CUP A;  5I7X A;  5LUU A;  3ZNI A;  2L43 A;  3UVY A;  5E9L A;  5ENJ A;  4CUT A;  4A9J A;  4HXK A;  4Q6F A;  2YDW A;  4N4I A;  2E3K A;  5G05 B;  5CQ5 A;  4NR9 A;  5H85 A;  4A9N A;  5FE7 A;  4S3O B;  3ZPV 1;  4QSX A;  1VFY A;  4YAT A;  2KWJ A;  2BAY A;  4IC2 A;  2VJF A;  2L5E A;  5FE6 A;  3QZV A;  5I80 A;  3ZTG A;  5I1Q A;  5E0R A;  4A9L A;  3RTR B;  4QB3 A;  3AAD A;  4I7B A;  3HME A;  1XWH A;  4NR6 A;  4QBM A;  1RMD A;  3O33 A;  5C7N A;  2EGP A;  3ONI A;  4QST A;  5FB1 A;  2YEK A;  4PCI A;  2E7O A;  4TTE A;  3SVG A;  4O7B A;  2YW5 A;  4J0R A;  4QF3 A;  3UVD A;  1JOC A;  5FH8 A;  2EA6 A;  2KGG A;  3VK6 A;  4UYD A;  5B77 A;  4CLB A;  2DVR A;  4O72 A;  2MNZ A;  3LXJ A;  2FUI A;  4L7X A;  5EWV A;  3ZPV E;  4XI1 A;  5CQ8 A;  5HFR A;  5EWW A;  5HRW A;  1BOR A;  4IR4 A;  5DKH A;  4ALG A;  5A85 A;  1VYX A;  3SOU A;  4Y03 A;  2DAT A;  1WGM A;  5DYU A;  3FL2 A;  4YYJ A;  4FIP A;  2KWO A;  5ENI A;  5CS8 A;  3HCS A;  3UV4 A;  4QR4 A;  2DVS A;  2YHN A;  1WEW A;  3HTK C;  4Z93 A;  1JM7 A;  4UIT A;  5A5P A;  4IR3 A;  4O77 A;  4A9I A;  2LRI C;  4A0C D;  5IG6 A;  5C89 A;  2L84 A;  5DKC A;  4LAD B;  1G25 A;  4TZ8 A;  2L85 A;  5FEY A;  5KH3 A;  3ZVY A;  5EQ1 A;  2M1R A;  4BW2 A;  2K1J A;  4UP5 A;  5IGK A;  2F6J A;  2CT2 A;  4LC2 A;  4O70 A;  4UIZ A;  3P5O A;  5E9M A;  5IID A;  2VPG A;  4WZ3 B;  4TS8 A;  5HM0 A;  3JVM A;  1X4J A;  1CHC A;  4YAB A;  2ECN A;  2KR4 A;  5CUB A;  3L11 A;  4C67 A;  5A7C A;  2MD8 C;  5AIU A;  4HXL A;  4QSP A;  5II2 A;  5C11 A;  5KTU A;  3HMF A;  5B76 A;  5COI A;  1WEV A;  5CQ7 A;  2OXQ C;  3P1E A;  5CUG A;  3V43 A;  5JG6 A;  2KWN A;  3Q2F A;  1WIM A;  4XY8 A;  5CQ6 A;  2KGI A;  5DYA A;  4MR4 A;  5TDW A;  3L1X A;  5I3L A;  4A9M A;  5IGL A;  2LGV A;  3TLP A;  5CUD A;  5L96 A;  2LXH C;  3ZYQ A;  4A9E A;  4MEO A;  5EU1 A;  3N9O A;  2KFT A;  4YAD A;  5AIT A;  1ZBD B;  5D26 A;  2HDP A;  5CFW A;  1WUM A;  4BBQ A;  5G0F A;  1X0J A;  2RNY A;  4PS5 A;  4NUE A;  3M63 A;  5EP7 A;  5FH7 A;  5KO4 A;  1FBV A;  4GNE A;  4B7Y C;  4PTB A;  2RFJ A;  2DVQ A;  2K17 A;  4TT2 A;  5EA1 A;  4C66 A;  5DFD A;  3ZVZ B;  3O37 A;  5KH7 A;  4AVX A;  1LDJ B;  3MUL A;  1HYJ A;  5ACY A;  4J1P A;  2NAA A;  4O7A A;  4UIU A;  3P1D A;  4YBT A;  2MA5 A;  4ZW1 A;  5DIN A;  3O34 A;  4LZR A;  4UIV A;  5TDR A;  3NG2 A;  5L8U A;  2YQM A;  3N9Q A;  2ECJ A;  4QEV A;  4TT6 A;  4TU6 A;  5F5Z A;  4XYA A;  5F63 A;  2G6Q A;  4HXS A;  2VPD A;  5D24 A;  3ASL A;  4UP0 A;  4LYI A;  5FE0 A;  5DYC A;  4QYL A;  5ENC A;  4O64 A;  1N87 A;  3HMH A;  5HQ6 A;  1Z60 A;  5EIS A;  1WEU A;  2LDR A;  2YYR A;  2QIC A;  4C9Z A;  2E6R A;  4RVR A;  1Z2Q A;  4A9H A;  4X3G A;  1WFK A;  4O75 A;  1VD4 A;  4YY4 A;  5HLS A;  4LKA A;  5HEM A;  5HQ7 A;  2ECW A;  2M3H A;  1WEQ A;  3UVW A;  5B75 A;  3I2D A;  4O74 A;  4FJC A;  5JI8 A;  5LKT A;  4MEN A;  4TQN A;  5J0D A;  4O7C A;  3UV5 A;  5ETB A;  5A5R A;  5FE3 A;  1JSP B;  3D7C A;  5K29 A;  4XUA A;  4QSW A;  3DWY A;  3KV6 A;  2RSD A;  4YYH A;  2LGG A;  4CFK A;  5FFW A;  4J0S A;  4Q0O A;  5B78 A;  5A5N A;  4HXR A;  3DQV R;  4NN2 A;  4QR5 A;  4NYV A;  3N9M A;  5KTX A;  5DKA A;  1E4U A;  5D3H A;  4NYX A;  2YYN A;  3PUR A;  5CPE A;  4A4B A;  1WEP A;  5EGU A;  3Q2E A;  4V3K C;  3FKM X;  4IOQ A;  5DFC A;  2HYE D;  5IGN A;  4ZQL A;  2YUR A;  1Z6U A;  4ZUX U;  4QC1 A;  4QZS A;  5EWC A;  3LQJ A;  3O35 A;  4CFL A;  2KIZ A;  3IU5 A;  2YSJ A;  4ZC9 A;  2DVV A;  4LRG A;  5BT3 A;  5LCW B;  2JMD A;  3JVJ A;  5C85 A;  5F60 A;  3SHB A;  5HRV A;  3LQH A;  4QF2 A;  3N9N A;  3HCU A;  2YEM A;  4HBW A;  5G4S A;  3ZYU A;  1K2F A;  4YBM A;  4NRA A;  4MEQ A;  5A5Q A;  4A49 A;  5CU8 A;  5D7X A;  3G0L A;  5C8G A;  2KRE A;  4YYI A;  4QSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...