4YBMA

Crystal structure of trim24 phd-bromodomain complexed with n-{6-[3-(benzyloxy)phenoxy]-1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl}-3,4-dimethoxybenzene-1-sulfonamide (7b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
177
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ybmA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ybmA01
1X4UA 3ZVZB 4LK9A 3HMEA 2AN6A 4NR9A 4NUEA 4XI1A 2KREA 4CURA 2HDPA 5H1TA 3Q2EA 5F60A 2E7NA 4QEUA 5FH6A 1X4JA 4N4HA 2Y1MA 4CLBA 2L5UA 2M1RA 5A85A 5TDRA 4O78A 4QUTA 3U5MA 4NRAA 2VJEB 4QSVA 3MQMA 4NYWA 4CUUA 3P1EA 2EODA 3M63A 3RTRB 5HRVA 4DONA 5EWVA 2RO1A 4C66A 4NQMA 1FP0A 3VK6A 4LLBA 4YYJA 4QEWA 2UZGA 4X2IA 4FIPA 5I40A 4LKAA 2DATA 4J3IA 2LDRA 4PS5A 5DKDA 1WEOA 5ENBA 4I7DA 2QICA 5DFDA 3HTKC 5HM0A 4NN2A 4QF2A 3D7CA 5DFCA 5CU8A 4UIWA 4TQNA 2CSYA 2VJEA 4LC2A 1WFKA 4X3GA 5I80A 4NQNA 5C8GA 3LQJA 4PY6A 4QC3A 3N9NA 1IYMA 4NRBA 5CZGA 4UIYA 5D25A 3MB4A 4FO9A 4CCGX 2DVSA 4UYEA 4UIXA 1WEPA 3FKMX 3MUKA 4CFKA 4QNSA 2F6JA 2LSPB 3M62A 3AQAA 2QIZA 2YU4A 5CQTA 2FSAA 5FERA 5E9MA 5CUGA 5EI4A 3C5KA 5KH7A 2XEUA 5E9VA 4LZSA 4YATA 4UI9B 5FEYA 5B8DA 5K29A 2YREA 2WP2A 2KTBB 4LDFA 5L97A 5L99A 4O75A 5CGPA 5FE2A 1HYJA 1U6GB 5D3HA 4YYNA 4Z1SA 2VPBA 2M3HA 5KH3A 2R0YA 2RFJA 3AADA 5FDZA 3HMFA 5CUDA 2ECIA 2YQMA 5DINA 5A81A 5EV9A 2GRCA 3SVGA 1FBVA 5FB0A 5AD3A 5CQ8A 5D1MB 4QSPA 5CQ5A 4FJCA 5D1KB 4ZC9A 4NS5A 3I2DA 4CUSA 3SOWA 3QZVA 5AITA 5JI8A 4GB0A 3N9OA 3LXJA 5ENGA 2F42A 4I7CA 5II1A 5TRBA 5B79A 3ASLA 4RVRA 5B76A 4O7AA 3P1DA 4A9KA 3C6WA 2E6RA 3DWYA 5D3LA 3UVXA 3UVYA 5JWMA 2G43A 2M85A 2LV9A 3UV4A 4PTBA 5F2PA 4GNDA 4XY8A 5D3TA 4HBWA 5C85A 2KE1A 5IG6A 4GNEA 4PPEA 5LJ1A 5E9YA 1JOCA 3RPGB 4ZQLA 5I3LA 5FE4A 2L5EA 5A83A 2ZETC 5C11A 5L8TA 5CUBA 5KTUA 2QJ0A 2I7KA 4C67A 4O72A 4QEVA 3JVKA 2YELA 4NXJA 5EWHA 3U5NA 3L1XA 4LJNA 2MNYA 3ONIA 4IOQA 4TTEA 2Y43A 4N4IA 4O7CA 2K4DA 5B75A 2L80A 2C2LA 3HCSA 4QSUA 5FG5A 5CUCA 2VPEA 4WZ0A 4P5OB 2RNYA 4QSQA 2HYED 2R0VA 3JVLA 3G0LA 2L85A 4QY4A 5DW2A 5F25A 5A7CA 4O7BA 5E9IA 5D3SA 5IGLA 4QSRA 3MB3A 2DWWA 4YK0A 2ECTA 4A4CA 4YY4A 4AKNA 5A5SA 4WHWA 3UV2A 1HYIA 2I8NA 3HCUA 5B78A 4YYDA 1BORA 1VD4A 4QR4A 5DBMA 4PKLA 4QSXA 3GL6A 1N87A 5FG4A 2RNXA 4LYWA 5F61A 4BW1A 4ZUXU 2H0DB 4QR5A 2C2VS 3SOXA 5CQ7A 3ZYUA 1VYXA 4HXLA 5F62A 3ZNIA 4NYXA 4WZ2A 5CPEA 5ENEA 3UW9A 5A5RA 1WIMA 4IR5A 4ALGA 2XB1A 4O74A 4IORA 4TZ2A 2JMIA 2VP7A 3LRQA 3U5OA 5LKZA 4Y03A 2MNZA 3LQHA 4N4FA 4LRGA 4MR3A 4N3WA 2FUIA 1LDKC 4QF3A 5ACYA 5HQ5A 5ENHA 4O71A 5F1HA 4YYIA 5F1LA 4UYDA 4GNGA 5EISA 4LYIA 2KR4A 2YEMA 2ECJA 5FE9A 2H0DA 2YYNA 2YW5A 2I50A 5II2A 2DVVA 4QYLA 4J0RA 5IGKA 3JVMA 5L98A 4CUPA 2R0SA 2KFTA 5LJ2A 1EQFA 4BBQA 5HRXA 2ECVA 5EWWA 4A0CD 2BAYA 2KGIA 3DAIA 4YABA 2ECGA 4O7EA 1E4UA 5DFBA 4PCEA 2RS9B 5I88A 4QR3A 4A9NA 1JM7B 5A5PA 2ECWA 4O70A 2CSZA 4R8PK 2L84A 4QYDA 4A9LA 4TZ8A 5FE6A 3HMHA 4YYKA 4OGJA 5DKCA 2KYUA 2G6QA 5AIUA 5G4SA 4A49A 5TDWA 3V43A 3U5JA 2H60A 5DYCA 4A9HA 1ZBDB 3L11A 4NRCA 4Q0OA 3MHHA 3N9QA 1RMDA 5C13A 1F62A 3UVDA 4A9EA 3U5PA 5HRWA 3T7LA 5CUAA 4Z6IA 2MD7B 5LUUA 3DPLR 5B77A 5E7DA 2KIZA 5TABA 5CRZA 5BT3A 1JM7A 3Q2FA 1Z2QA 2YSJA 3N9LA 3QZTA 5F5ZA 3M99A 4R7EA 5TCMA 3EB5A 5EYAF 4UIVA 1WENA 4WA6A 2PNXA 4WHUA 4TT4A 5FE7A 1WE9A 4OUFA 2LRIC 2KWKA 1MM2A 2JMDA 2MA5A 4IR3A 5DLZA 5ETDA 4FK5A 5F36A 3K2JA 5IBNA 5D24A 2FUUA 5CQAA 2F6NA 4HXRA 5DYUA 5AMFA 3QZSA 5A5NA 2CT2A 5H1UA 5F3AA 2VPDA 3G0JA 4GNFA 3PHDA 5HQ6A 4O76A 4IC3A 4Q6FA 4UIUA 2RNWA 5KTWA 5EP7A 5LKTA 5G4RA 5I29A 4Z6HA 2LGVA 5BT4A 4S3OB 5DLXA 5EPBA 5H9MA 4FLPA 4HXMA 3IU5A 4CL9A 2MJVB 2Y1NA 1E6IA 4UP0A 4GPJA 4CUQA 2VPGA 4WZ3B 4MR5A 4PCIA 1WESA 4QZSA 5LKXA 2VNFA 4YBMA 1MM3A 1WEWA 4MENA 3ZTGA 5C7NA 3NXBA 4A9FA 4HXOA 3PUQA 3HCTA 5LCWB 2L75A 3P1CA 4L58A 5FE1A 2OSSA 4YC9A 2MA6A 5CUEA 4LADB 5HLSA 2JMJA 2IDAA 3SOUA 4QSTA 5E74A 4BJXA 4HXKA 3MXFA 4HBXA 5ENCA 4QSSA 4C9ZA 4Z1QA 4J0SA 5E0RA 4YYGA 5LVQA 5EVAA 5IIDA 5KH9A 4QC1A 5FFWA 5FFVA 4QBMA 4NR5A 2KWNA 4NR7A 4OGIA 5FE3A 4A9JA 4NUCA 2K1JA 1X4IA 4B86C 2YDWA 5H1VA 2EA6A 2MUMA 5FH8A 5CY9A 4A9OA 4YYMA 4ALHA 5I7YA 3O37A 1X0JA 4AP4A 4MEOA 2D82A 4A4BA 2L0BA 1WGMA 2ECNA 5CS8A 5EU1A 3N9MA 5CTLA 5D3RA 4CUTA 4ZDTA 3RPGC 4TT6A 2OXQC 3UV5A 5C87A 5L96A 3TLPA 2E6SA 5D7XA 5CQ3A 5D0CA 2D9EA 4MR4A 4ZW1A 5FE8A 5HELA 1WUMA 3UVWA 4LR6A 1Z6UA 5CRMA 5KHMA 5FE0A 5EGUA 5DW1A 3DQVR 4BW4A 3PURA 4XY9A 4E96A 1JM4B 1ZS5A 4V3LC 3N9PA 4YBTA 5FE5A 5G05B 3SVFA 2NXBA 5LVRA 2KWOA 2OO1A 4YH4A 4CFLA 3O34A 4TU4A 5HENA 4O77A 5EICA 5CP5A 5A5OA 2LGLA 4IOOA 2YSMA 2YQLA 5G04B 4XUBA 3NG2A 4YADA 5D3JA 2YW8A 2YUCA 1WEMA 5EK9A 5IGNA 3RCWA 3ZPV1 4J1PA 4Q0NA 2DVRA 4TT2A 4NR4A 3O70A 5G0FA 4AYCB 5TB6A 4MR6A 4LZ2A 2G4AA 2LXPC 5A5QA 5EPRA 5CFWA 1JSPB 3P1FA 3S92A 4KV4A 5L8UA 4O7FA 2L43A 2PUYA 4LZRA 4UP5A 5HQ7A 4HBYA 5I7XA 5FBXA 1DVPA 2K17A 4MEPA 2MIQA 5C4QA 3O7AA 2RI7A 3P5OA 4R2YA 1WEVA 2KWJA 4UYFB 5E9LA 3MHSA 4TYLA 1CHCA 5HEMA 4L7XA 4A9IA 4XUAA 2E3KA 5FH7A 5KO4A 3FL2A 5E3GA 5E73A 3L1ZB 4TKPB 4YAXA 4W4UA 3ZYQA 4AYCA 2WP1A 1V87A 2YEKA 2LQ6A 5HJCA 1WUGA 2YURA 4I7BA 4A9MA 2MT5A 4NYVA 5DYAA 1F68A 5DKHA 3IHPA 4UIZA 4BW3A 2LGGA 5AMEA 4B7YC 4HXSA 2CKLB 3MULA 3KQIA 5E3DA 2VJFB 2K16A 1WEEA 3GV4A 3KV6A 2G45A 4TU6A 5JG6A 5AD2A 5FFYA 4UYFA 5E9KA 2LN0A 3O36A 5EWDA 3O35A 5FG6A 5ENJA 1Z60A 3U5LA 4UYHA 5EPSA 5LKUA 4MSXA 3I3JA 4O64A 3KV5A 3SVHA 5J3XA 1XWHA 2EGPA 5I89A 2LGKA 5ENFA 4YYHA 4CA1A 5H85A 1VFYA 4HXNA 4YBSA 5I83A 2YHOA 2YHNA 5EWCA 4TS8A 2LXHC 4IC2A 1WILA 5HFQA 4MEQA 3ZPVE 5DY7A 5J0DA 3KNVA 4YY6A 5D26A 5COIA 5D3PA 4F52B 2E7OA 5EQ1A 2CKLA 4UYGA 4BHWA 2VJFA 2KU3A 2M6MA 2NAAA 5EA1A 5A82A 1K2FA 2YYRA 5D3NA 4V3KC 2DKWA 5I86A 2JRJA 4AUQB 4LYSA 3JVJA 2R10A 3S91A 4KV1A 5C89A 1N72A 5HCLA 5CQ6A 4Z93A 5CQ4A 5DKAA 4N4GA 4NR8A 5I1QA 2OUOA 4WIVA 4NUDA 5LJ0A 5HFRA 4MVTA 4HXPA 1G25A 5KTXA 5IGMA 5ENIA 2KGGA 5FB1A 4QUUA 3EB6A 2RSDA 3ZVYA 1WEUA 5D1LB 4F3IA 4UITA 4XYAA 3IU6A 1WEQA 5F63A 3SHBA 4BW2A 3GG3A 5EM3A 2DVQA 4AVXA 3T6RA 4S3OC 4IR4A 2YT5A 4IR6A 3LQIA 4KCXA 5DX4A 2YQDA 5BT5A 2D8SA 4QB3A 3O33A 3U5KA 1LDJB 2DX8A 4HBVA 3LJWA 5ETBA 1T1HA 4NR6A 5KU3A 4YH3A 4QSWA 5TBNA 2N9GA 5DYXA 2MD8C
chains in the Genus database with same CATH superfamily
1X4UA 3ZVZB 4LK9A 3HMEA 2AN6A 4NR9A 4NUEA 4XI1A 2KREA 4CURA 2HDPA 5H1TA 3Q2EA 5F60A 2E7NA 4QEUA 5FH6A 1X4JA 4N4HA 2Y1MA 4CLBA 2L5UA 2M1RA 5A85A 5TDRA 4O78A 4QUTA 3U5MA 4NRAA 2VJEB 4QSVA 3MQMA 4NYWA 4CUUA 3P1EA 2EODA 3M63A 3RTRB 5HRVA 3LVQE 4DONA 5EWVA 2RO1A 4C66A 4NQMA 1FP0A 3VK6A 2XOYA 4LLBA 4YYJA 2FFWA 4QEWA 2UZGA 4X2IA 4FIPA 5I40A 4LKAA 2DATA 4J3IA 2LDRA 4PS5A 5DKDA 1WEOA 2OWAA 2XP0A 5ENBA 2XOCA 4I7DA 2QICA 5DFDA 3HTKC 5HM0A 4NN2A 4QF2A 3D7CA 5DFCA 5CU8A 3VKGA 4UIWA 4TQNA 2CSYA 2VJEA 4LC2A 1WFKA 4X3GA 5I80A 4NQNA 5C8GA 3LQJA 4PY6A 4QC3A 3FANA 3N9NA 4OGCA 1IYMA 4NRBA 5CZGA 4UIYA 5D25A 3MB4A 4FO9A 4CCGX 5K3QA 2DVSA 4UYEA 4UIXA 1WEPA 3FKMX 3MUKA 2B0OE 4CFKA 4QNSA 2F6JA 2LSPB 3M62A 3AQAA 2QIZA 2YU4A 5CQTA 2FSAA 5FERA 5E9MA 5CUGA 5EI4A 3C5KA 5KH7A 2XEUA 5E9VA 4LZSA 4YATA 4UI9B 5FEYA 5B8DA 5K29A 2YREA 2WP2A 2KTBB 4LDFA 5L97A 5L99A 4AKIA 4O75A 5CGPA 5FE2A 1HYJA 1U6GB 5D3HA 4YYNA 3MDBC 4Z1SA 2VPBA 2M3HA 5KH3A 3FJUB 2R0YA 2RFJA 3AADA 5FDZA 3HMFA 5CUDA 2ECIA 2YQMA 5DINA 5A81A 5EV9A 2GRCA 3SVGA 1FBVA 5FB0A 3M7KA 5AD3A 2EXUA 5CQ8A 2FD4A 5D1MB 4QSPA 5CQ5A 2CSVA 4FJCA 4ZC9A 5D1KB 4NS5A 3I2DA 4CUSA 3SOWA 3QZVA 5AITA 5JI8A 4GB0A 3N9OA 3LXJA 5ENGA 2F42A 4I7CA 5II1A 5TRBA 5B79A 3ASLA 4RVRA 5B76A 4O7AA 2D8UA 3P1DA 4A9KA 3C6WA 2E6RA 3DWYA 5D3LA 3UVXA 3UVYA 5JWMA 2G43A 2M85A 2LV9A 3UV4A 4PTBA 5F2PA 4GNDA 4XY8A 5D3TA 4HBWA 2DSMA 5C85A 2KE1A 3JUEA 5IG6A 4GNEA 4PPEA 5LJ1A 5E9YA 4Z0RA 1JOCA 3RPGB 4ZQLA 5I3LA 5FE4A 2L5EA 5A83A 2ZETC 5C11A 1PUOA 4QQ4A 5L8TA 5CUBA 5KTUA 2QJ0A 2I7KA 4C67A 4O72A 4QEVA 3JVKA 2YELA 4NXJA 5EWHA 3U5NA 3L1XA 4LJNA 2MNYA 3ONIA 4IOQA 4TTEA 2MKEA 2Y43A 4N4IA 4O7CA 2K4DA 5B75A 4AKGA 2L80A 2C2LA 3HCSA 2LAUA 4QSUA 5FG5A 5CUCA 2VPEA 4WZ0A 4P5OB 2RNYA 4QSQA 2HYED 2R0VA 3JVLA 3G0LA 2L85A 3VKHA 4QY4A 5DW2A 5F25A 5A7CA 4O7BA 3SUBA 5E9IA 5D3SA 5IGLA 4QSRA 3MB3A 2DWWA 4YK0A 2ECTA 4A4CA 4YY4A 4AKNA 5A5SA 4WHWA 3UV2A 4Z0OA 1HYIA 2I8NA 3HCUA 5B78A 4YYDA 1BORA 1VD4A 2RR4A 3FM8C 4QR4A 5DBMA 4PKLA 4QSXA 3GL6A 1N87A 5FG4A 2RNXA 4LYWA 5F61A 4BW1A 4ZUXU 2H0DB 4QR5A 2C2VS 3SOXA 5CQ7A 3ZYUA 1VYXA 4HXLA 5F62A 3ZNIA 4NYXA 4WZ2A 5CPEA 5ENEA 3UW9A 5A5RA 1WIMA 4IR5A 4ALGA 2XB1A 5SVYA 4O74A 4IORA 4TZ2A 2JMIA 2VP7A 3LRQA 3U5OA 5LKZA 4Y03A 2MNZA 3LQHA 4N4FA 4LRGA 4MR3A 4N3WA 2FUIA 1LDKC 4QF3A 5ACYA 5HQ5A 5ENHA 4O71A 3LDYA 5F1HA 4YYIA 5F1LA 4UYDA 4AI6A 4GNGA 5EISA 4LYIA 4OGEA 2KR4A 2YEMA 2ECJA 5FE9A 2H0DA 2YYNA 2YW5A 2I50A 5II2A 2DVVA 4QYLA 4J0RA 5IGKA 3JVMA 5L98A 4CUPA 2R0SA 2KFTA 5LJ2A 1EQFA 4BBQA 5HRXA 2ECVA 5EWWA 4A0CD 2BAYA 2KGIA 3DAIA 4YABA 2ECGA 4O7EA 1E4UA 5DFBA 4PCEA 2RS9B 5I88A 3E2DA 4QR3A 4A9NA 1JM7B 5A5PA 2EGMA 2ECWA 4O70A 2CSZA 4R8PK 2L84A 4QYDA 4A9LA 2CRRA 4TZ8A 5FE6A 3HMHA 4YYKA 4OGJA 5DKCA 2KYUA 2G6QA 5AIUA 2IQJA 3Q1DA 5G4SA 4A49A 2E61A 5TDWA 5SVIB 3V43A 2DJAA 3U5JA 2H60A 5DYCA 2YVRA 4A9HA 1ZBDB 3L11A 4NRCA 4Q0OA 3MHHA 3N9QA 1RMDA 5C13A 1F62A 3UVDA 4A9EA 3U5PA 5HRWA 3T7LA 5CUAA 4Z6IA 2MD7B 5LUUA 3DPLR 5B77A 5E7DA 2KIZA 5TABA 2XOZA 5CRZA 5BT3A 1JM7A 3Q2FA 1Z2QA 2YSJA 3N9LA 2KKXA 3QZTA 5F5ZA 3M99A 4R7EA 5TCMA 3EB5A 5EYAF 4UIVA 1WENA 4WA6A 2PNXA 4WHUA 4TT4A 5FE7A 1WE9A 4OUFA 2LRIC 2KWKA 1MM2A 2JMDA 2MA5A 5SVIA 4IR3A 5DLZA 5ETDA 4FK5A 5F36A 3K2JA 5IBNA 2KKYA 2M13A 5D24A 2FUUA 5CQAA 2F6NA 4HXRA 5DYUA 5AMFA 3QZSA 5A5NA 2CT2A 5H1UA 5F3AA 2VPDA 3G0JA 4GNFA 3PHDA 5HQ6A 4O76A 4IC3A 4Q6FA 4UIUA 1ZKRA 2RNWA 5KTWA 5EP7A 5LKTA 5G4RA 5I29A 4Z6HA 2LGVA 5BT4A 4S3OB 5DLXA 5EPBA 5H9MA 4FLPA 4HXMA 3IU5A 4CL9A 2MJVB 2L7PA 2Y1NA 1E6IA 4UP0A 4GPJA 4CUQA 2VPGA 4WZ3B 4MR5A 4PCIA 1WESA 4QZSA 5LKXA 2VNFA 4YBMA 1MM3A 1WEWA 4MENA 3ZTGA 5C7NA 3NXBA 4A9FA 4HXOA 3PUQA 2JM3A 3HCTA 5LCWB 2L75A 3P1CA 4L58A 5FE1A 2OSSA 4YC9A 2MA6A 5CUEA 4LADB 5HLSA 2JMJA 2IDAA 3SOUA 4QSTA 5E74A 4BJXA 4HXKA 3MXFA 4HBXA 5ENCA 4QSSA 4C9ZA 4Z1QA 4J0SA 3D1DA 5E0RA 4YYGA 5LVQA 5EVAA 5IIDA 5KH9A 4QC1A 5FFWA 5FFVA 4QBMA 4NR5A 2KWNA 4NR7A 4OGIA 5FE3A 4A9JA 4NUCA 3FEHA 2K1JA 1X4IA 4B86C 2YDWA 5H1VA 2EA6A 2MUMA 5FH8A 5CY9A 4A9OA 4YYMA 4ALHA 5I7YA 3O37A 1X0JA 4AP4A 4MEOA 3DWDA 2D82A 4A4BA 2L0BA 1WGMA 2ECNA 5CS8A 5EU1A 3N9MA 5CTLA 5D3RA 4CUTA 4ZDTA 3RPGC 4TT6A 2OXQC 3UV5A 5C87A 5L96A 3TLPA 2E6SA 5D7XA 5CQ3A 5D0CA 2D9EA 4MR4A 4ZW1A 5FE8A 5HELA 1WUMA 3UVWA 4LR6A 1Z6UA 5CRMA 5KHMA 5FE0A 5EGUA 5DW1A 3DQVR 4BW4A 3PURA 4XY9A 4F1PA 4E96A 1JM4B 2CONA 1ZS5A 4V3LC 3N9PA 4YBTA 5FE5A 5G05B 3SVFA 2NXBA 5LVRA 2KWOA 2OO1A 4YH4A 4CFLA 3O34A 4TU4A 5HENA 4O77A 5EICA 5CP5A 3D1BA 5A5OA 4IOOA 2LGLA 2YQLA 2YSMA 5G04B 4XUBA 1DCQA 3NG2A 4YADA 5D3JA 5SVXA 2YW8A 4H9DA 2YUCA 2EJNA 1WEMA 5EK9A 5IGNA 3T9KA 3RCWA 3ZPV1 4J1PA 4Q0NA 2DVRA 4TT2A 4NR4A 3O70A 5G0FA 4AYCB 5TB6A 4MR6A 4LZ2A 2G4AA 2LXPC 5A5QA 5EPRA 5CFWA 1JSPB 3P1FA 3S92A 4KV4A 5L8UA 4O7FA 2L43A 3H7HA 2PUYA 4LZRA 4UP5A 5HQ7A 4HBYA 5I7XA 5FBXA 1DVPA 2K17A 4MEPA 2MIQA 5C4QA 3O7AA 2RI7A 3P5OA 4R2YA 1WEVA 2KWJA 4UYFB 5E9LA 3MHSA 4TYLA 1CHCA 5HEMA 4L7XA 4A9IA 4XUAA 2E3KA 5FH7A 5KO4A 3FL2A 5E3GA 5E73A 3L1ZB 4TKPB 4YAXA 4W4UA 3ZYQA 4AYCA 2WP1A 1V87A 2YEKA 2LQ6A 5HJCA 1WUGA 2YURA 4I7BA 4A9MA 2MT5A 4NYVA 5DYAA 1F68A 5DKHA 3IHPA 4UIZA 4BW3A 2LGGA 5AMEA 4B7YC 4HXSA 2P57A 2CKLB 3MULA 3KQIA 5E3DA 2VJFB 2K16A 1WEEA 3GV4A 3KV6A 2G45A 4TU6A 3O47A 5JG6A 5AD2A 5FFYA 1MBMA 4UYFA 5E9KA 3KDEC 2LN0A 3O36A 5EWDA 3O35A 5FG6A 5ENJA 1Z60A 3U5LA 4UYHA 5EPSA 5LKUA 4MSXA 3I3JA 4O64A 3KV5A 3SVHA 5J3XA 1XWHA 2EGPA 5I89A 2LGKA 5ENFA 4YYHA 4CA1A 5H85A 1VFYA 4HXNA 4YBSA 5I83A 2YHOA 2YHNA 5EWCA 4TS8A 2LXHC 4IC2A 1WILA 5HFQA 4MEQA 3PLWA 3ZPVE 5DY7A 5J0DA 3KNVA 4YY6A 5D26A 5COIA 5D3PA 4F52B 2E7OA 3LJUX 5EQ1A 2CKLA 4UYGA 4BHWA 2VJFA 2KU3A 2M6MA 2NAAA 5EA1A 5A82A 1K2FA 2YYRA 5D3NA 4V3KC 2DKWA 5I86A 2JRJA 4AUQB 4LYSA 3JVJA 2R10A 3S91A 4KV1A 5C89A 1N72A 5HCLA 5CQ6A 4Z93A 5CQ4A 5DKAA 4N4GA 4NR8A 5I1QA 2OUOA 4WIVA 4NUDA 5LJ0A 5HFRA 4MVTA 3ERRA 4HXPA 1G25A 5KTXA 5IGMA 5ENIA 2JUNA 2KGGA 5FB1A 4QUUA 3EB6A 2RSDA 3ZVYA 1WEUA 5D1LB 4F3IA 4UITA 4XYAA 3IU6A 1WEQA 5F63A 3SHBA 4BW2A 3GG3A 5EM3A 2DVQA 4AVXA 3T6RA 4S3OC 4IR4A 2YT5A 4IR6A 3LQIA 4KCXA 5DX4A 4O62A 3DDTA 2YQDA 5BT5A 2D8SA 4QB3A 3O33A 3U5KA 1LDJB 2DX8A 4HBVA 3LJWA 5ETBA 1T1HA 3FAOA 4NR6A 5KU3A 4AKHA 4YH3A 2CRWA 3LVRE 4QSWA 5TBNA 2N9GA 5DYXA 2MD8C
chains in the Genus database with same CATH topology
1X4UA 3ZVZB 4LK9A 3HMEA 2AN6A 4NR9A 4NUEA 4XI1A 2KREA 4CURA 2HDPA 5H1TA 3Q2EA 5F60A 2E7NA 4QEUA 5FH6A 1X4JA 4N4HA 2Y1MA 4CLBA 2L5UA 2M1RA 5A85A 5TDRA 4O78A 4QUTA 3U5MA 4NRAA 2VJEB 4QSVA 3MQMA 4NYWA 4CUUA 3P1EA 2EODA 3M63A 3RTRB 5HRVA 4DONA 5EWVA 2RO1A 4C66A 4NQMA 1FP0A 3VK6A 4LLBA 4YYJA 4QEWA 2UZGA 4X2IA 4FIPA 5I40A 4LKAA 2DATA 4J3IA 2LDRA 4PS5A 5DKDA 1WEOA 5ENBA 4I7DA 2QICA 5DFDA 3HTKC 5HM0A 4NN2A 4QF2A 3D7CA 5DFCA 5CU8A 4UIWA 4TQNA 2CSYA 2VJEA 4LC2A 1WFKA 4X3GA 5I80A 4NQNA 5C8GA 3LQJA 4PY6A 4QC3A 3N9NA 1IYMA 4NRBA 5CZGA 4UIYA 5D25A 3MB4A 4FO9A 4CCGX 2DVSA 4UYEA 4UIXA 1WEPA 3FKMX 3MUKA 4CFKA 4QNSA 2F6JA 2LSPB 3M62A 3AQAA 2QIZA 2YU4A 5CQTA 2FSAA 5FERA 5E9MA 5CUGA 5EI4A 3C5KA 5KH7A 2XEUA 5E9VA 4LZSA 4YATA 4UI9B 5FEYA 5B8DA 5K29A 2YREA 2WP2A 2KTBB 4LDFA 5L97A 5L99A 4O75A 5CGPA 5FE2A 1HYJA 1U6GB 5D3HA 4YYNA 4Z1SA 2VPBA 2M3HA 5KH3A 2R0YA 2RFJA 3AADA 5FDZA 3HMFA 5CUDA 2ECIA 2YQMA 5DINA 5A81A 5EV9A 2GRCA 3SVGA 1FBVA 5FB0A 5AD3A 5CQ8A 5D1MB 4QSPA 5CQ5A 4FJCA 5D1KB 4ZC9A 4NS5A 3I2DA 4CUSA 3SOWA 3QZVA 5AITA 5JI8A 4GB0A 3N9OA 3LXJA 5ENGA 2F42A 4I7CA 5II1A 5TRBA 5B79A 3ASLA 4RVRA 5B76A 4O7AA 3P1DA 4A9KA 3C6WA 2E6RA 3DWYA 5D3LA 3UVXA 3UVYA 5JWMA 2G43A 2M85A 2LV9A 3UV4A 4PTBA 5F2PA 4GNDA 4XY8A 5D3TA 4HBWA 5C85A 2KE1A 5IG6A 4GNEA 4PPEA 5LJ1A 5E9YA 1JOCA 3RPGB 4ZQLA 5I3LA 5FE4A 2L5EA 5A83A 2ZETC 5C11A 5L8TA 5CUBA 5KTUA 2QJ0A 2I7KA 4C67A 4O72A 4QEVA 3JVKA 2YELA 4NXJA 5EWHA 3U5NA 3L1XA 4LJNA 2MNYA 3ONIA 4IOQA 4TTEA 2Y43A 4N4IA 4O7CA 2K4DA 5B75A 2L80A 2C2LA 3HCSA 4QSUA 5FG5A 5CUCA 2VPEA 4WZ0A 4P5OB 2RNYA 4QSQA 2HYED 2R0VA 3JVLA 3G0LA 2L85A 4QY4A 5DW2A 5F25A 5A7CA 4O7BA 5E9IA 5D3SA 5IGLA 4QSRA 3MB3A 2DWWA 4YK0A 2ECTA 4A4CA 4YY4A 4AKNA 5A5SA 4WHWA 3UV2A 1HYIA 2I8NA 3HCUA 5B78A 4YYDA 1BORA 1VD4A 4QR4A 5DBMA 4PKLA 4QSXA 3GL6A 1N87A 5FG4A 2RNXA 4LYWA 5F61A 4BW1A 4ZUXU 2H0DB 4QR5A 2C2VS 3SOXA 5CQ7A 3ZYUA 1VYXA 4HXLA 5F62A 3ZNIA 4NYXA 4WZ2A 5CPEA 5ENEA 3UW9A 5A5RA 1WIMA 4IR5A 4ALGA 2XB1A 4O74A 4IORA 4TZ2A 2JMIA 2VP7A 3LRQA 3U5OA 5LKZA 4Y03A 2MNZA 3LQHA 4N4FA 4LRGA 4MR3A 4N3WA 2FUIA 1LDKC 4QF3A 5ACYA 5HQ5A 5ENHA 4O71A 5F1HA 4YYIA 5F1LA 4UYDA 4GNGA 5EISA 4LYIA 2KR4A 2YEMA 2ECJA 5FE9A 2H0DA 2YYNA 2YW5A 2I50A 5II2A 2DVVA 4QYLA 4J0RA 5IGKA 3JVMA 5L98A 4CUPA 2R0SA 2KFTA 5LJ2A 1EQFA 4BBQA 5HRXA 2ECVA 5EWWA 4A0CD 2BAYA 2KGIA 3DAIA 4YABA 2ECGA 4O7EA 1E4UA 5DFBA 4PCEA 2RS9B 5I88A 4QR3A 4A9NA 1JM7B 5A5PA 2ECWA 4O70A 2CSZA 4R8PK 2L84A 4QYDA 4A9LA 4TZ8A 5FE6A 3HMHA 4YYKA 4OGJA 5DKCA 2KYUA 2G6QA 5AIUA 5G4SA 4A49A 5TDWA 3V43A 3U5JA 2H60A 5DYCA 4A9HA 1ZBDB 3L11A 4NRCA 4Q0OA 3MHHA 3N9QA 1RMDA 5C13A 1F62A 3UVDA 4A9EA 3U5PA 5HRWA 3T7LA 5CUAA 4Z6IA 2MD7B 5LUUA 3DPLR 5B77A 5E7DA 2KIZA 5TABA 5CRZA 5BT3A 1JM7A 3Q2FA 1Z2QA 2YSJA 3N9LA 3QZTA 5F5ZA 3M99A 4R7EA 5TCMA 3EB5A 5EYAF 4UIVA 1WENA 4WA6A 2PNXA 4WHUA 4TT4A 5FE7A 1WE9A 4OUFA 2LRIC 2KWKA 1MM2A 2JMDA 2MA5A 4IR3A 5DLZA 5ETDA 4FK5A 5F36A 3K2JA 5IBNA 5D24A 2FUUA 5CQAA 2F6NA 4HXRA 5DYUA 5AMFA 3QZSA 5A5NA 2CT2A 5H1UA 5F3AA 2VPDA 3G0JA 4GNFA 3PHDA 5HQ6A 4O76A 4IC3A 4Q6FA 4UIUA 2RNWA 5KTWA 5EP7A 5LKTA 5G4RA 5I29A 4Z6HA 2LGVA 5BT4A 4S3OB 5DLXA 5EPBA 5H9MA 4FLPA 4HXMA 3IU5A 4CL9A 2MJVB 2Y1NA 1E6IA 4UP0A 4GPJA 4CUQA 2VPGA 4WZ3B 4MR5A 4PCIA 1WESA 4QZSA 5LKXA 2VNFA 4YBMA 1MM3A 1WEWA 4MENA 3ZTGA 5C7NA 3NXBA 4A9FA 4HXOA 3PUQA 3HCTA 5LCWB 2L75A 3P1CA 4L58A 5FE1A 2OSSA 4YC9A 2MA6A 5CUEA 4LADB 5HLSA 2JMJA 2IDAA 3SOUA 4QSTA 5E74A 4BJXA 4HXKA 3MXFA 4HBXA 5ENCA 4QSSA 4C9ZA 4Z1QA 4J0SA 5E0RA 4YYGA 5LVQA 5EVAA 5IIDA 5KH9A 4QC1A 5FFWA 5FFVA 4QBMA 4NR5A 2KWNA 4NR7A 4OGIA 5FE3A 4A9JA 4NUCA 2K1JA 1X4IA 4B86C 2YDWA 5H1VA 2EA6A 2MUMA 5FH8A 5CY9A 4A9OA 4YYMA 4ALHA 5I7YA 3O37A 1X0JA 4AP4A 4MEOA 2D82A 4A4BA 2L0BA 1WGMA 2ECNA 5CS8A 5EU1A 3N9MA 5CTLA 5D3RA 4CUTA 4ZDTA 3RPGC 4TT6A 2OXQC 3UV5A 5C87A 5L96A 3TLPA 2E6SA 5D7XA 5CQ3A 5D0CA 2D9EA 4MR4A 4ZW1A 5FE8A 5HELA 1WUMA 3UVWA 4LR6A 1Z6UA 5CRMA 5KHMA 5FE0A 5EGUA 5DW1A 3DQVR 4BW4A 3PURA 4XY9A 4E96A 1JM4B 1ZS5A 4V3LC 3N9PA 4YBTA 5FE5A 5G05B 3SVFA 2NXBA 5LVRA 2KWOA 2OO1A 4YH4A 4CFLA 3O34A 4TU4A 5HENA 4O77A 5EICA 5CP5A 5A5OA 2LGLA 4IOOA 2YSMA 2YQLA 5G04B 4XUBA 3NG2A 4YADA 5D3JA 2YW8A 2YUCA 1WEMA 5EK9A 5IGNA 3RCWA 3ZPV1 4J1PA 4Q0NA 2DVRA 4TT2A 4NR4A 3O70A 5G0FA 4AYCB 5TB6A 4MR6A 4LZ2A 2G4AA 2LXPC 5A5QA 5EPRA 5CFWA 1JSPB 3P1FA 3S92A 4KV4A 5L8UA 4O7FA 2L43A 2PUYA 4LZRA 4UP5A 5HQ7A 4HBYA 5I7XA 5FBXA 1DVPA 2K17A 4MEPA 2MIQA 5C4QA 3O7AA 2RI7A 3P5OA 4R2YA 1WEVA 2KWJA 4UYFB 5E9LA 3MHSA 4TYLA 1CHCA 5HEMA 4L7XA 4A9IA 4XUAA 2E3KA 5FH7A 5KO4A 3FL2A 5E3GA 5E73A 3L1ZB 4TKPB 4YAXA 4W4UA 3ZYQA 4AYCA 2WP1A 1V87A 2YEKA 2LQ6A 5HJCA 1WUGA 2YURA 4I7BA 4A9MA 2MT5A 4NYVA 5DYAA 1F68A 5DKHA 3IHPA 4UIZA 4BW3A 2LGGA 5AMEA 4B7YC 4HXSA 2CKLB 3MULA 3KQIA 5E3DA 2VJFB 2K16A 1WEEA 3GV4A 3KV6A 2G45A 4TU6A 5JG6A 5AD2A 5FFYA 4UYFA 5E9KA 2LN0A 3O36A 5EWDA 3O35A 5FG6A 5ENJA 1Z60A 3U5LA 4UYHA 5EPSA 5LKUA 4MSXA 3I3JA 4O64A 3KV5A 3SVHA 5J3XA 1XWHA 2EGPA 5I89A 2LGKA 5ENFA 4YYHA 4CA1A 5H85A 1VFYA 4HXNA 4YBSA 5I83A 2YHOA 2YHNA 5EWCA 4TS8A 2LXHC 4IC2A 1WILA 5HFQA 4MEQA 3ZPVE 5DY7A 5J0DA 3KNVA 4YY6A 5D26A 5COIA 5D3PA 4F52B 2E7OA 5EQ1A 2CKLA 4UYGA 4BHWA 2VJFA 2KU3A 2M6MA 2NAAA 5EA1A 5A82A 1K2FA 2YYRA 5D3NA 4V3KC 2DKWA 5I86A 2JRJA 4AUQB 4LYSA 3JVJA 2R10A 3S91A 4KV1A 5C89A 1N72A 5HCLA 5CQ6A 4Z93A 5CQ4A 5DKAA 4N4GA 4NR8A 5I1QA 2OUOA 4WIVA 4NUDA 5LJ0A 5HFRA 4MVTA 4HXPA 1G25A 5KTXA 5IGMA 5ENIA 2KGGA 5FB1A 4QUUA 3EB6A 2RSDA 3ZVYA 1WEUA 5D1LB 4F3IA 4UITA 4XYAA 3IU6A 1WEQA 5F63A 3SHBA 4BW2A 3GG3A 5EM3A 2DVQA 4AVXA 3T6RA 4S3OC 4IR4A 2YT5A 4IR6A 3LQIA 4KCXA 5DX4A 2YQDA 5BT5A 2D8SA 4QB3A 3O33A 3U5KA 1LDJB 2DX8A 4HBVA 3LJWA 5ETBA 1T1HA 4NR6A 5KU3A 4YH3A 4QSWA 5TBNA 2N9GA 5DYXA 2MD8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4U A;  3ZVZ B;  4LK9 A;  3HME A;  2AN6 A;  4NR9 A;  4NUE A;  4XI1 A;  2KRE A;  4CUR A;  2HDP A;  5H1T A;  3Q2E A;  5F60 A;  2E7N A;  4QEU A;  5FH6 A;  1X4J A;  4N4H A;  2Y1M A;  4CLB A;  2L5U A;  2M1R A;  5A85 A;  5TDR A;  4O78 A;  4QUT A;  3U5M A;  4NRA A;  2VJE B;  4QSV A;  3MQM A;  4NYW A;  4CUU A;  3P1E A;  2EOD A;  3M63 A;  3RTR B;  5HRV A;  4DON A;  5EWV A;  2RO1 A;  4C66 A;  4NQM A;  1FP0 A;  3VK6 A;  4LLB A;  4YYJ A;  4QEW A;  2UZG A;  4X2I A;  4FIP A;  5I40 A;  4LKA A;  2DAT A;  4J3I A;  2LDR A;  4PS5 A;  5DKD A;  1WEO A;  5ENB A;  4I7D A;  2QIC A;  5DFD A;  3HTK C;  5HM0 A;  4NN2 A;  4QF2 A;  3D7C A;  5DFC A;  5CU8 A;  4UIW A;  4TQN A;  2CSY A;  2VJE A;  4LC2 A;  1WFK A;  4X3G A;  5I80 A;  4NQN A;  5C8G A;  3LQJ A;  4PY6 A;  4QC3 A;  3N9N A;  1IYM A;  4NRB A;  5CZG A;  4UIY A;  5D25 A;  3MB4 A;  4FO9 A;  4CCG X;  2DVS A;  4UYE A;  4UIX A;  1WEP A;  3FKM X;  3MUK A;  4CFK A;  4QNS A;  2F6J A;  2LSP B;  3M62 A;  3AQA A;  2QIZ A;  2YU4 A;  5CQT A;  2FSA A;  5FER A;  5E9M A;  5CUG A;  5EI4 A;  3C5K A;  5KH7 A;  2XEU A;  5E9V A;  4LZS A;  4YAT A;  4UI9 B;  5FEY A;  5B8D A;  5K29 A;  2YRE A;  2WP2 A;  2KTB B;  4LDF A;  5L97 A;  5L99 A;  4O75 A;  5CGP A;  5FE2 A;  1HYJ A;  1U6G B;  5D3H A;  4YYN A;  4Z1S A;  2VPB A;  2M3H A;  5KH3 A;  2R0Y A;  2RFJ A;  3AAD A;  5FDZ A;  3HMF A;  5CUD A;  2ECI A;  2YQM A;  5DIN A;  5A81 A;  5EV9 A;  2GRC A;  3SVG A;  1FBV A;  5FB0 A;  5AD3 A;  5CQ8 A;  5D1M B;  4QSP A;  5CQ5 A;  4FJC A;  5D1K B;  4ZC9 A;  4NS5 A;  3I2D A;  4CUS A;  3SOW A;  3QZV A;  5AIT A;  5JI8 A;  4GB0 A;  3N9O A;  3LXJ A;  5ENG A;  2F42 A;  4I7C A;  5II1 A;  5TRB A;  5B79 A;  3ASL A;  4RVR A;  5B76 A;  4O7A A;  3P1D A;  4A9K A;  3C6W A;  2E6R A;  3DWY A;  5D3L A;  3UVX A;  3UVY A;  5JWM A;  2G43 A;  2M85 A;  2LV9 A;  3UV4 A;  4PTB A;  5F2P A;  4GND A;  4XY8 A;  5D3T A;  4HBW A;  5C85 A;  2KE1 A;  5IG6 A;  4GNE A;  4PPE A;  5LJ1 A;  5E9Y A;  1JOC A;  3RPG B;  4ZQL A;  5I3L A;  5FE4 A;  2L5E A;  5A83 A;  2ZET C;  5C11 A;  5L8T A;  5CUB A;  5KTU A;  2QJ0 A;  2I7K A;  4C67 A;  4O72 A;  4QEV A;  3JVK A;  2YEL A;  4NXJ A;  5EWH A;  3U5N A;  3L1X A;  4LJN A;  2MNY A;  3ONI A;  4IOQ A;  4TTE A;  2Y43 A;  4N4I A;  4O7C A;  2K4D A;  5B75 A;  2L80 A;  2C2L A;  3HCS A;  4QSU A;  5FG5 A;  5CUC A;  2VPE A;  4WZ0 A;  4P5O B;  2RNY A;  4QSQ A;  2HYE D;  2R0V A;  3JVL A;  3G0L A;  2L85 A;  4QY4 A;  5DW2 A;  5F25 A;  5A7C A;  4O7B A;  5E9I A;  5D3S A;  5IGL A;  4QSR A;  3MB3 A;  2DWW A;  4YK0 A;  2ECT A;  4A4C A;  4YY4 A;  4AKN A;  5A5S A;  4WHW A;  3UV2 A;  1HYI A;  2I8N A;  3HCU A;  5B78 A;  4YYD A;  1BOR A;  1VD4 A;  4QR4 A;  5DBM A;  4PKL A;  4QSX A;  3GL6 A;  1N87 A;  5FG4 A;  2RNX A;  4LYW A;  5F61 A;  4BW1 A;  4ZUX U;  2H0D B;  4QR5 A;  2C2V S;  3SOX A;  5CQ7 A;  3ZYU A;  1VYX A;  4HXL A;  5F62 A;  3ZNI A;  4NYX A;  4WZ2 A;  5CPE A;  5ENE A;  3UW9 A;  5A5R A;  1WIM A;  4IR5 A;  4ALG A;  2XB1 A;  4O74 A;  4IOR A;  4TZ2 A;  2JMI A;  2VP7 A;  3LRQ A;  3U5O A;  5LKZ A;  4Y03 A;  2MNZ A;  3LQH A;  4N4F A;  4LRG A;  4MR3 A;  4N3W A;  2FUI A;  1LDK C;  4QF3 A;  5ACY A;  5HQ5 A;  5ENH A;  4O71 A;  5F1H A;  4YYI A;  5F1L A;  4UYD A;  4GNG A;  5EIS A;  4LYI A;  2KR4 A;  2YEM A;  2ECJ A;  5FE9 A;  2H0D A;  2YYN A;  2YW5 A;  2I50 A;  5II2 A;  2DVV A;  4QYL A;  4J0R A;  5IGK A;  3JVM A;  5L98 A;  4CUP A;  2R0S A;  2KFT A;  5LJ2 A;  1EQF A;  4BBQ A;  5HRX A;  2ECV A;  5EWW A;  4A0C D;  2BAY A;  2KGI A;  3DAI A;  4YAB A;  2ECG A;  4O7E A;  1E4U A;  5DFB A;  4PCE A;  2RS9 B;  5I88 A;  4QR3 A;  4A9N A;  1JM7 B;  5A5P A;  2ECW A;  4O70 A;  2CSZ A;  4R8P K;  2L84 A;  4QYD A;  4A9L A;  4TZ8 A;  5FE6 A;  3HMH A;  4YYK A;  4OGJ A;  5DKC A;  2KYU A;  2G6Q A;  5AIU A;  5G4S A;  4A49 A;  5TDW A;  3V43 A;  3U5J A;  2H60 A;  5DYC A;  4A9H A;  1ZBD B;  3L11 A;  4NRC A;  4Q0O A;  3MHH A;  3N9Q A;  1RMD A;  5C13 A;  1F62 A;  3UVD A;  4A9E A;  3U5P A;  5HRW A;  3T7L A;  5CUA A;  4Z6I A;  2MD7 B;  5LUU A;  3DPL R;  5B77 A;  5E7D A;  2KIZ A;  5TAB A;  5CRZ A;  5BT3 A;  1JM7 A;  3Q2F A;  1Z2Q A;  2YSJ A;  3N9L A;  3QZT A;  5F5Z A;  3M99 A;  4R7E A;  5TCM A;  3EB5 A;  5EYA F;  4UIV A;  1WEN A;  4WA6 A;  2PNX A;  4WHU A;  4TT4 A;  5FE7 A;  1WE9 A;  4OUF A;  2LRI C;  2KWK A;  1MM2 A;  2JMD A;  2MA5 A;  4IR3 A;  5DLZ A;  5ETD A;  4FK5 A;  5F36 A;  3K2J A;  5IBN A;  5D24 A;  2FUU A;  5CQA A;  2F6N A;  4HXR A;  5DYU A;  5AMF A;  3QZS A;  5A5N A;  2CT2 A;  5H1U A;  5F3A A;  2VPD A;  3G0J A;  4GNF A;  3PHD A;  5HQ6 A;  4O76 A;  4IC3 A;  4Q6F A;  4UIU A;  2RNW A;  5KTW A;  5EP7 A;  5LKT A;  5G4R A;  5I29 A;  4Z6H A;  2LGV A;  5BT4 A;  4S3O B;  5DLX A;  5EPB A;  5H9M A;  4FLP A;  4HXM A;  3IU5 A;  4CL9 A;  2MJV B;  2Y1N A;  1E6I A;  4UP0 A;  4GPJ A;  4CUQ A;  2VPG A;  4WZ3 B;  4MR5 A;  4PCI A;  1WES A;  4QZS A;  5LKX A;  2VNF A;  4YBM A;  1MM3 A;  1WEW A;  4MEN A;  3ZTG A;  5C7N A;  3NXB A;  4A9F A;  4HXO A;  3PUQ A;  3HCT A;  5LCW B;  2L75 A;  3P1C A;  4L58 A;  5FE1 A;  2OSS A;  4YC9 A;  2MA6 A;  5CUE A;  4LAD B;  5HLS A;  2JMJ A;  2IDA A;  3SOU A;  4QST A;  5E74 A;  4BJX A;  4HXK A;  3MXF A;  4HBX A;  5ENC A;  4QSS A;  4C9Z A;  4Z1Q A;  4J0S A;  5E0R A;  4YYG A;  5LVQ A;  5EVA A;  5IID A;  5KH9 A;  4QC1 A;  5FFW A;  5FFV A;  4QBM A;  4NR5 A;  2KWN A;  4NR7 A;  4OGI A;  5FE3 A;  4A9J A;  4NUC A;  2K1J A;  1X4I A;  4B86 C;  2YDW A;  5H1V A;  2EA6 A;  2MUM A;  5FH8 A;  5CY9 A;  4A9O A;  4YYM A;  4ALH A;  5I7Y A;  3O37 A;  1X0J A;  4AP4 A;  4MEO A;  2D82 A;  4A4B A;  2L0B A;  1WGM A;  2ECN A;  5CS8 A;  5EU1 A;  3N9M A;  5CTL A;  5D3R A;  4CUT A;  4ZDT A;  3RPG C;  4TT6 A;  2OXQ C;  3UV5 A;  5C87 A;  5L96 A;  3TLP A;  2E6S A;  5D7X A;  5CQ3 A;  5D0C A;  2D9E A;  4MR4 A;  4ZW1 A;  5FE8 A;  5HEL A;  1WUM A;  3UVW A;  4LR6 A;  1Z6U A;  5CRM A;  5KHM A;  5FE0 A;  5EGU A;  5DW1 A;  3DQV R;  4BW4 A;  3PUR A;  4XY9 A;  4E96 A;  1JM4 B;  1ZS5 A;  4V3L C;  3N9P A;  4YBT A;  5FE5 A;  5G05 B;  3SVF A;  2NXB A;  5LVR A;  2KWO A;  2OO1 A;  4YH4 A;  4CFL A;  3O34 A;  4TU4 A;  5HEN A;  4O77 A;  5EIC A;  5CP5 A;  5A5O A;  2LGL A;  4IOO A;  2YSM A;  2YQL A;  5G04 B;  4XUB A;  3NG2 A;  4YAD A;  5D3J A;  2YW8 A;  2YUC A;  1WEM A;  5EK9 A;  5IGN A;  3RCW A;  3ZPV 1;  4J1P A;  4Q0N A;  2DVR A;  4TT2 A;  4NR4 A;  3O70 A;  5G0F A;  4AYC B;  5TB6 A;  4MR6 A;  4LZ2 A;  2G4A A;  2LXP C;  5A5Q A;  5EPR A;  5CFW A;  1JSP B;  3P1F A;  3S92 A;  4KV4 A;  5L8U A;  4O7F A;  2L43 A;  2PUY A;  4LZR A;  4UP5 A;  5HQ7 A;  4HBY A;  5I7X A;  5FBX A;  1DVP A;  2K17 A;  4MEP A;  2MIQ A;  5C4Q A;  3O7A A;  2RI7 A;  3P5O A;  4R2Y A;  1WEV A;  2KWJ A;  4UYF B;  5E9L A;  3MHS A;  4TYL A;  1CHC A;  5HEM A;  4L7X A;  4A9I A;  4XUA A;  2E3K A;  5FH7 A;  5KO4 A;  3FL2 A;  5E3G A;  5E73 A;  3L1Z B;  4TKP B;  4YAX A;  4W4U A;  3ZYQ A;  4AYC A;  2WP1 A;  1V87 A;  2YEK A;  2LQ6 A;  5HJC A;  1WUG A;  2YUR A;  4I7B A;  4A9M A;  2MT5 A;  4NYV A;  5DYA A;  1F68 A;  5DKH A;  3IHP A;  4UIZ A;  4BW3 A;  2LGG A;  5AME A;  4B7Y C;  4HXS A;  2CKL B;  3MUL A;  3KQI A;  5E3D A;  2VJF B;  2K16 A;  1WEE A;  3GV4 A;  3KV6 A;  2G45 A;  4TU6 A;  5JG6 A;  5AD2 A;  5FFY A;  4UYF A;  5E9K A;  2LN0 A;  3O36 A;  5EWD A;  3O35 A;  5FG6 A;  5ENJ A;  1Z60 A;  3U5L A;  4UYH A;  5EPS A;  5LKU A;  4MSX A;  3I3J A;  4O64 A;  3KV5 A;  3SVH A;  5J3X A;  1XWH A;  2EGP A;  5I89 A;  2LGK A;  5ENF A;  4YYH A;  4CA1 A;  5H85 A;  1VFY A;  4HXN A;  4YBS A;  5I83 A;  2YHO A;  2YHN A;  5EWC A;  4TS8 A;  2LXH C;  4IC2 A;  1WIL A;  5HFQ A;  4MEQ A;  3ZPV E;  5DY7 A;  5J0D A;  3KNV A;  4YY6 A;  5D26 A;  5COI A;  5D3P A;  4F52 B;  2E7O A;  5EQ1 A;  2CKL A;  4UYG A;  4BHW A;  2VJF A;  2KU3 A;  2M6M A;  2NAA A;  5EA1 A;  5A82 A;  1K2F A;  2YYR A;  5D3N A;  4V3K C;  2DKW A;  5I86 A;  2JRJ A;  4AUQ B;  4LYS A;  3JVJ A;  2R10 A;  3S91 A;  4KV1 A;  5C89 A;  1N72 A;  5HCL A;  5CQ6 A;  4Z93 A;  5CQ4 A;  5DKA A;  4N4G A;  4NR8 A;  5I1Q A;  2OUO A;  4WIV A;  4NUD A;  5LJ0 A;  5HFR A;  4MVT A;  4HXP A;  1G25 A;  5KTX A;  5IGM A;  5ENI A;  2KGG A;  5FB1 A;  4QUU A;  3EB6 A;  2RSD A;  3ZVY A;  1WEU A;  5D1L B;  4F3I A;  4UIT A;  4XYA A;  3IU6 A;  1WEQ A;  5F63 A;  3SHB A;  4BW2 A;  3GG3 A;  5EM3 A;  2DVQ A;  4AVX A;  3T6R A;  4S3O C;  4IR4 A;  2YT5 A;  4IR6 A;  3LQI A;  4KCX A;  5DX4 A;  2YQD A;  5BT5 A;  2D8S A;  4QB3 A;  3O33 A;  3U5K A;  1LDJ B;  2DX8 A;  4HBV A;  3LJW A;  5ETB A;  1T1H A;  4NR6 A;  5KU3 A;  4YH3 A;  4QSW A;  5TBN A;  2N9G A;  5DYX A;  2MD8 C; 
#chains in the Genus database with same CATH topology
 1X4U A;  3ZVZ B;  4LK9 A;  3HME A;  2AN6 A;  4NR9 A;  4NUE A;  4XI1 A;  2KRE A;  4CUR A;  2HDP A;  5H1T A;  3Q2E A;  5F60 A;  2E7N A;  4QEU A;  5FH6 A;  1X4J A;  4N4H A;  2Y1M A;  4CLB A;  2L5U A;  2M1R A;  5A85 A;  5TDR A;  4O78 A;  4QUT A;  3U5M A;  4NRA A;  2VJE B;  4QSV A;  3MQM A;  4NYW A;  4CUU A;  3P1E A;  2EOD A;  3M63 A;  3RTR B;  5HRV A;  3LVQ E;  4DON A;  5EWV A;  2RO1 A;  4C66 A;  4NQM A;  1FP0 A;  3VK6 A;  2XOY A;  4LLB A;  4YYJ A;  2FFW A;  4QEW A;  2UZG A;  4X2I A;  4FIP A;  5I40 A;  4LKA A;  2DAT A;  4J3I A;  2LDR A;  4PS5 A;  5DKD A;  1WEO A;  2OWA A;  2XP0 A;  5ENB A;  2XOC A;  4I7D A;  2QIC A;  5DFD A;  3HTK C;  5HM0 A;  4NN2 A;  4QF2 A;  3D7C A;  5DFC A;  5CU8 A;  3VKG A;  4UIW A;  4TQN A;  2CSY A;  2VJE A;  4LC2 A;  1WFK A;  4X3G A;  5I80 A;  4NQN A;  5C8G A;  3LQJ A;  4PY6 A;  4QC3 A;  3FAN A;  3N9N A;  4OGC A;  1IYM A;  4NRB A;  5CZG A;  4UIY A;  5D25 A;  3MB4 A;  4FO9 A;  4CCG X;  5K3Q A;  2DVS A;  4UYE A;  4UIX A;  1WEP A;  3FKM X;  3MUK A;  2B0O E;  4CFK A;  4QNS A;  2F6J A;  2LSP B;  3M62 A;  3AQA A;  2QIZ A;  2YU4 A;  5CQT A;  2FSA A;  5FER A;  5E9M A;  5CUG A;  5EI4 A;  3C5K A;  5KH7 A;  2XEU A;  5E9V A;  4LZS A;  4YAT A;  4UI9 B;  5FEY A;  5B8D A;  5K29 A;  2YRE A;  2WP2 A;  2KTB B;  4LDF A;  5L97 A;  5L99 A;  4AKI A;  4O75 A;  5CGP A;  5FE2 A;  1HYJ A;  1U6G B;  5D3H A;  4YYN A;  3MDB C;  4Z1S A;  2VPB A;  2M3H A;  5KH3 A;  3FJU B;  2R0Y A;  2RFJ A;  3AAD A;  5FDZ A;  3HMF A;  5CUD A;  2ECI A;  2YQM A;  5DIN A;  5A81 A;  5EV9 A;  2GRC A;  3SVG A;  1FBV A;  5FB0 A;  3M7K A;  5AD3 A;  2EXU A;  5CQ8 A;  2FD4 A;  5D1M B;  4QSP A;  5CQ5 A;  2CSV A;  4FJC A;  4ZC9 A;  5D1K B;  4NS5 A;  3I2D A;  4CUS A;  3SOW A;  3QZV A;  5AIT A;  5JI8 A;  4GB0 A;  3N9O A;  3LXJ A;  5ENG A;  2F42 A;  4I7C A;  5II1 A;  5TRB A;  5B79 A;  3ASL A;  4RVR A;  5B76 A;  4O7A A;  2D8U A;  3P1D A;  4A9K A;  3C6W A;  2E6R A;  3DWY A;  5D3L A;  3UVX A;  3UVY A;  5JWM A;  2G43 A;  2M85 A;  2LV9 A;  3UV4 A;  4PTB A;  5F2P A;  4GND A;  4XY8 A;  5D3T A;  4HBW A;  2DSM A;  5C85 A;  2KE1 A;  3JUE A;  5IG6 A;  4GNE A;  4PPE A;  5LJ1 A;  5E9Y A;  4Z0R A;  1JOC A;  3RPG B;  4ZQL A;  5I3L A;  5FE4 A;  2L5E A;  5A83 A;  2ZET C;  5C11 A;  1PUO A;  4QQ4 A;  5L8T A;  5CUB A;  5KTU A;  2QJ0 A;  2I7K A;  4C67 A;  4O72 A;  4QEV A;  3JVK A;  2YEL A;  4NXJ A;  5EWH A;  3U5N A;  3L1X A;  4LJN A;  2MNY A;  3ONI A;  4IOQ A;  4TTE A;  2MKE A;  2Y43 A;  4N4I A;  4O7C A;  2K4D A;  5B75 A;  4AKG A;  2L80 A;  2C2L A;  3HCS A;  2LAU A;  4QSU A;  5FG5 A;  5CUC A;  2VPE A;  4WZ0 A;  4P5O B;  2RNY A;  4QSQ A;  2HYE D;  2R0V A;  3JVL A;  3G0L A;  2L85 A;  3VKH A;  4QY4 A;  5DW2 A;  5F25 A;  5A7C A;  4O7B A;  3SUB A;  5E9I A;  5D3S A;  5IGL A;  4QSR A;  3MB3 A;  2DWW A;  4YK0 A;  2ECT A;  4A4C A;  4YY4 A;  4AKN A;  5A5S A;  4WHW A;  3UV2 A;  4Z0O A;  1HYI A;  2I8N A;  3HCU A;  5B78 A;  4YYD A;  1BOR A;  1VD4 A;  2RR4 A;  3FM8 C;  4QR4 A;  5DBM A;  4PKL A;  4QSX A;  3GL6 A;  1N87 A;  5FG4 A;  2RNX A;  4LYW A;  5F61 A;  4BW1 A;  4ZUX U;  2H0D B;  4QR5 A;  2C2V S;  3SOX A;  5CQ7 A;  3ZYU A;  1VYX A;  4HXL A;  5F62 A;  3ZNI A;  4NYX A;  4WZ2 A;  5CPE A;  5ENE A;  3UW9 A;  5A5R A;  1WIM A;  4IR5 A;  4ALG A;  2XB1 A;  5SVY A;  4O74 A;  4IOR A;  4TZ2 A;  2JMI A;  2VP7 A;  3LRQ A;  3U5O A;  5LKZ A;  4Y03 A;  2MNZ A;  3LQH A;  4N4F A;  4LRG A;  4MR3 A;  4N3W A;  2FUI A;  1LDK C;  4QF3 A;  5ACY A;  5HQ5 A;  5ENH A;  4O71 A;  3LDY A;  5F1H A;  4YYI A;  5F1L A;  4UYD A;  4AI6 A;  4GNG A;  5EIS A;  4LYI A;  4OGE A;  2KR4 A;  2YEM A;  2ECJ A;  5FE9 A;  2H0D A;  2YYN A;  2YW5 A;  2I50 A;  5II2 A;  2DVV A;  4QYL A;  4J0R A;  5IGK A;  3JVM A;  5L98 A;  4CUP A;  2R0S A;  2KFT A;  5LJ2 A;  1EQF A;  4BBQ A;  5HRX A;  2ECV A;  5EWW A;  4A0C D;  2BAY A;  2KGI A;  3DAI A;  4YAB A;  2ECG A;  4O7E A;  1E4U A;  5DFB A;  4PCE A;  2RS9 B;  5I88 A;  3E2D A;  4QR3 A;  4A9N A;  1JM7 B;  5A5P A;  2EGM A;  2ECW A;  4O70 A;  2CSZ A;  4R8P K;  2L84 A;  4QYD A;  4A9L A;  2CRR A;  4TZ8 A;  5FE6 A;  3HMH A;  4YYK A;  4OGJ A;  5DKC A;  2KYU A;  2G6Q A;  5AIU A;  2IQJ A;  3Q1D A;  5G4S A;  4A49 A;  2E61 A;  5TDW A;  5SVI B;  3V43 A;  2DJA A;  3U5J A;  2H60 A;  5DYC A;  2YVR A;  4A9H A;  1ZBD B;  3L11 A;  4NRC A;  4Q0O A;  3MHH A;  3N9Q A;  1RMD A;  5C13 A;  1F62 A;  3UVD A;  4A9E A;  3U5P A;  5HRW A;  3T7L A;  5CUA A;  4Z6I A;  2MD7 B;  5LUU A;  3DPL R;  5B77 A;  5E7D A;  2KIZ A;  5TAB A;  2XOZ A;  5CRZ A;  5BT3 A;  1JM7 A;  3Q2F A;  1Z2Q A;  2YSJ A;  3N9L A;  2KKX A;  3QZT A;  5F5Z A;  3M99 A;  4R7E A;  5TCM A;  3EB5 A;  5EYA F;  4UIV A;  1WEN A;  4WA6 A;  2PNX A;  4WHU A;  4TT4 A;  5FE7 A;  1WE9 A;  4OUF A;  2LRI C;  2KWK A;  1MM2 A;  2JMD A;  2MA5 A;  5SVI A;  4IR3 A;  5DLZ A;  5ETD A;  4FK5 A;  5F36 A;  3K2J A;  5IBN A;  2KKY A;  2M13 A;  5D24 A;  2FUU A;  5CQA A;  2F6N A;  4HXR A;  5DYU A;  5AMF A;  3QZS A;  5A5N A;  2CT2 A;  5H1U A;  5F3A A;  2VPD A;  3G0J A;  4GNF A;  3PHD A;  5HQ6 A;  4O76 A;  4IC3 A;  4Q6F A;  4UIU A;  1ZKR A;  2RNW A;  5KTW A;  5EP7 A;  5LKT A;  5G4R A;  5I29 A;  4Z6H A;  2LGV A;  5BT4 A;  4S3O B;  5DLX A;  5EPB A;  5H9M A;  4FLP A;  4HXM A;  3IU5 A;  4CL9 A;  2MJV B;  2L7P A;  2Y1N A;  1E6I A;  4UP0 A;  4GPJ A;  4CUQ A;  2VPG A;  4WZ3 B;  4MR5 A;  4PCI A;  1WES A;  4QZS A;  5LKX A;  2VNF A;  4YBM A;  1MM3 A;  1WEW A;  4MEN A;  3ZTG A;  5C7N A;  3NXB A;  4A9F A;  4HXO A;  3PUQ A;  2JM3 A;  3HCT A;  5LCW B;  2L75 A;  3P1C A;  4L58 A;  5FE1 A;  2OSS A;  4YC9 A;  2MA6 A;  5CUE A;  4LAD B;  5HLS A;  2JMJ A;  2IDA A;  3SOU A;  4QST A;  5E74 A;  4BJX A;  4HXK A;  3MXF A;  4HBX A;  5ENC A;  4QSS A;  4C9Z A;  4Z1Q A;  4J0S A;  3D1D A;  5E0R A;  4YYG A;  5LVQ A;  5EVA A;  5IID A;  5KH9 A;  4QC1 A;  5FFW A;  5FFV A;  4QBM A;  4NR5 A;  2KWN A;  4NR7 A;  4OGI A;  5FE3 A;  4A9J A;  4NUC A;  3FEH A;  2K1J A;  1X4I A;  4B86 C;  2YDW A;  5H1V A;  2EA6 A;  2MUM A;  5FH8 A;  5CY9 A;  4A9O A;  4YYM A;  4ALH A;  5I7Y A;  3O37 A;  1X0J A;  4AP4 A;  4MEO A;  3DWD A;  2D82 A;  4A4B A;  2L0B A;  1WGM A;  2ECN A;  5CS8 A;  5EU1 A;  3N9M A;  5CTL A;  5D3R A;  4CUT A;  4ZDT A;  3RPG C;  4TT6 A;  2OXQ C;  3UV5 A;  5C87 A;  5L96 A;  3TLP A;  2E6S A;  5D7X A;  5CQ3 A;  5D0C A;  2D9E A;  4MR4 A;  4ZW1 A;  5FE8 A;  5HEL A;  1WUM A;  3UVW A;  4LR6 A;  1Z6U A;  5CRM A;  5KHM A;  5FE0 A;  5EGU A;  5DW1 A;  3DQV R;  4BW4 A;  3PUR A;  4XY9 A;  4F1P A;  4E96 A;  1JM4 B;  2CON A;  1ZS5 A;  4V3L C;  3N9P A;  4YBT A;  5FE5 A;  5G05 B;  3SVF A;  2NXB A;  5LVR A;  2KWO A;  2OO1 A;  4YH4 A;  4CFL A;  3O34 A;  4TU4 A;  5HEN A;  4O77 A;  5EIC A;  5CP5 A;  3D1B A;  5A5O A;  4IOO A;  2LGL A;  2YQL A;  2YSM A;  5G04 B;  4XUB A;  1DCQ A;  3NG2 A;  4YAD A;  5D3J A;  5SVX A;  2YW8 A;  4H9D A;  2YUC A;  2EJN A;  1WEM A;  5EK9 A;  5IGN A;  3T9K A;  3RCW A;  3ZPV 1;  4J1P A;  4Q0N A;  2DVR A;  4TT2 A;  4NR4 A;  3O70 A;  5G0F A;  4AYC B;  5TB6 A;  4MR6 A;  4LZ2 A;  2G4A A;  2LXP C;  5A5Q A;  5EPR A;  5CFW A;  1JSP B;  3P1F A;  3S92 A;  4KV4 A;  5L8U A;  4O7F A;  2L43 A;  3H7H A;  2PUY A;  4LZR A;  4UP5 A;  5HQ7 A;  4HBY A;  5I7X A;  5FBX A;  1DVP A;  2K17 A;  4MEP A;  2MIQ A;  5C4Q A;  3O7A A;  2RI7 A;  3P5O A;  4R2Y A;  1WEV A;  2KWJ A;  4UYF B;  5E9L A;  3MHS A;  4TYL A;  1CHC A;  5HEM A;  4L7X A;  4A9I A;  4XUA A;  2E3K A;  5FH7 A;  5KO4 A;  3FL2 A;  5E3G A;  5E73 A;  3L1Z B;  4TKP B;  4YAX A;  4W4U A;  3ZYQ A;  4AYC A;  2WP1 A;  1V87 A;  2YEK A;  2LQ6 A;  5HJC A;  1WUG A;  2YUR A;  4I7B A;  4A9M A;  2MT5 A;  4NYV A;  5DYA A;  1F68 A;  5DKH A;  3IHP A;  4UIZ A;  4BW3 A;  2LGG A;  5AME A;  4B7Y C;  4HXS A;  2P57 A;  2CKL B;  3MUL A;  3KQI A;  5E3D A;  2VJF B;  2K16 A;  1WEE A;  3GV4 A;  3KV6 A;  2G45 A;  4TU6 A;  3O47 A;  5JG6 A;  5AD2 A;  5FFY A;  1MBM A;  4UYF A;  5E9K A;  3KDE C;  2LN0 A;  3O36 A;  5EWD A;  3O35 A;  5FG6 A;  5ENJ A;  1Z60 A;  3U5L A;  4UYH A;  5EPS A;  5LKU A;  4MSX A;  3I3J A;  4O64 A;  3KV5 A;  3SVH A;  5J3X A;  1XWH A;  2EGP A;  5I89 A;  2LGK A;  5ENF A;  4YYH A;  4CA1 A;  5H85 A;  1VFY A;  4HXN A;  4YBS A;  5I83 A;  2YHO A;  2YHN A;  5EWC A;  4TS8 A;  2LXH C;  4IC2 A;  1WIL A;  5HFQ A;  4MEQ A;  3PLW A;  3ZPV E;  5DY7 A;  5J0D A;  3KNV A;  4YY6 A;  5D26 A;  5COI A;  5D3P A;  4F52 B;  2E7O A;  3LJU X;  5EQ1 A;  2CKL A;  4UYG A;  4BHW A;  2VJF A;  2KU3 A;  2M6M A;  2NAA A;  5EA1 A;  5A82 A;  1K2F A;  2YYR A;  5D3N A;  4V3K C;  2DKW A;  5I86 A;  2JRJ A;  4AUQ B;  4LYS A;  3JVJ A;  2R10 A;  3S91 A;  4KV1 A;  5C89 A;  1N72 A;  5HCL A;  5CQ6 A;  4Z93 A;  5CQ4 A;  5DKA A;  4N4G A;  4NR8 A;  5I1Q A;  2OUO A;  4WIV A;  4NUD A;  5LJ0 A;  5HFR A;  4MVT A;  3ERR A;  4HXP A;  1G25 A;  5KTX A;  5IGM A;  5ENI A;  2JUN A;  2KGG A;  5FB1 A;  4QUU A;  3EB6 A;  2RSD A;  3ZVY A;  1WEU A;  5D1L B;  4F3I A;  4UIT A;  4XYA A;  3IU6 A;  1WEQ A;  5F63 A;  3SHB A;  4BW2 A;  3GG3 A;  5EM3 A;  2DVQ A;  4AVX A;  3T6R A;  4S3O C;  4IR4 A;  2YT5 A;  4IR6 A;  3LQI A;  4KCX A;  5DX4 A;  4O62 A;  3DDT A;  2YQD A;  5BT5 A;  2D8S A;  4QB3 A;  3O33 A;  3U5K A;  1LDJ B;  2DX8 A;  4HBV A;  3LJW A;  5ETB A;  1T1H A;  3FAO A;  4NR6 A;  5KU3 A;  4AKH A;  4YH3 A;  2CRW A;  3LVR E;  4QSW A;  5TBN A;  2N9G A;  5DYX A;  2MD8 C; 
#chains in the Genus database with same CATH homology
 1X4U A;  3ZVZ B;  4LK9 A;  3HME A;  2AN6 A;  4NR9 A;  4NUE A;  4XI1 A;  2KRE A;  4CUR A;  2HDP A;  5H1T A;  3Q2E A;  5F60 A;  2E7N A;  4QEU A;  5FH6 A;  1X4J A;  4N4H A;  2Y1M A;  4CLB A;  2L5U A;  2M1R A;  5A85 A;  5TDR A;  4O78 A;  4QUT A;  3U5M A;  4NRA A;  2VJE B;  4QSV A;  3MQM A;  4NYW A;  4CUU A;  3P1E A;  2EOD A;  3M63 A;  3RTR B;  5HRV A;  4DON A;  5EWV A;  2RO1 A;  4C66 A;  4NQM A;  1FP0 A;  3VK6 A;  4LLB A;  4YYJ A;  4QEW A;  2UZG A;  4X2I A;  4FIP A;  5I40 A;  4LKA A;  2DAT A;  4J3I A;  2LDR A;  4PS5 A;  5DKD A;  1WEO A;  5ENB A;  4I7D A;  2QIC A;  5DFD A;  3HTK C;  5HM0 A;  4NN2 A;  4QF2 A;  3D7C A;  5DFC A;  5CU8 A;  4UIW A;  4TQN A;  2CSY A;  2VJE A;  4LC2 A;  1WFK A;  4X3G A;  5I80 A;  4NQN A;  5C8G A;  3LQJ A;  4PY6 A;  4QC3 A;  3N9N A;  1IYM A;  4NRB A;  5CZG A;  4UIY A;  5D25 A;  3MB4 A;  4FO9 A;  4CCG X;  2DVS A;  4UYE A;  4UIX A;  1WEP A;  3FKM X;  3MUK A;  4CFK A;  4QNS A;  2F6J A;  2LSP B;  3M62 A;  3AQA A;  2QIZ A;  2YU4 A;  5CQT A;  2FSA A;  5FER A;  5E9M A;  5CUG A;  5EI4 A;  3C5K A;  5KH7 A;  2XEU A;  5E9V A;  4LZS A;  4YAT A;  4UI9 B;  5FEY A;  5B8D A;  5K29 A;  2YRE A;  2WP2 A;  2KTB B;  4LDF A;  5L97 A;  5L99 A;  4O75 A;  5CGP A;  5FE2 A;  1HYJ A;  1U6G B;  5D3H A;  4YYN A;  4Z1S A;  2VPB A;  2M3H A;  5KH3 A;  2R0Y A;  2RFJ A;  3AAD A;  5FDZ A;  3HMF A;  5CUD A;  2ECI A;  2YQM A;  5DIN A;  5A81 A;  5EV9 A;  2GRC A;  3SVG A;  1FBV A;  5FB0 A;  5AD3 A;  5CQ8 A;  5D1M B;  4QSP A;  5CQ5 A;  4FJC A;  5D1K B;  4ZC9 A;  4NS5 A;  3I2D A;  4CUS A;  3SOW A;  3QZV A;  5AIT A;  5JI8 A;  4GB0 A;  3N9O A;  3LXJ A;  5ENG A;  2F42 A;  4I7C A;  5II1 A;  5TRB A;  5B79 A;  3ASL A;  4RVR A;  5B76 A;  4O7A A;  3P1D A;  4A9K A;  3C6W A;  2E6R A;  3DWY A;  5D3L A;  3UVX A;  3UVY A;  5JWM A;  2G43 A;  2M85 A;  2LV9 A;  3UV4 A;  4PTB A;  5F2P A;  4GND A;  4XY8 A;  5D3T A;  4HBW A;  5C85 A;  2KE1 A;  5IG6 A;  4GNE A;  4PPE A;  5LJ1 A;  5E9Y A;  1JOC A;  3RPG B;  4ZQL A;  5I3L A;  5FE4 A;  2L5E A;  5A83 A;  2ZET C;  5C11 A;  5L8T A;  5CUB A;  5KTU A;  2QJ0 A;  2I7K A;  4C67 A;  4O72 A;  4QEV A;  3JVK A;  2YEL A;  4NXJ A;  5EWH A;  3U5N A;  3L1X A;  4LJN A;  2MNY A;  3ONI A;  4IOQ A;  4TTE A;  2Y43 A;  4N4I A;  4O7C A;  2K4D A;  5B75 A;  2L80 A;  2C2L A;  3HCS A;  4QSU A;  5FG5 A;  5CUC A;  2VPE A;  4WZ0 A;  4P5O B;  2RNY A;  4QSQ A;  2HYE D;  2R0V A;  3JVL A;  3G0L A;  2L85 A;  4QY4 A;  5DW2 A;  5F25 A;  5A7C A;  4O7B A;  5E9I A;  5D3S A;  5IGL A;  4QSR A;  3MB3 A;  2DWW A;  4YK0 A;  2ECT A;  4A4C A;  4YY4 A;  4AKN A;  5A5S A;  4WHW A;  3UV2 A;  1HYI A;  2I8N A;  3HCU A;  5B78 A;  4YYD A;  1BOR A;  1VD4 A;  4QR4 A;  5DBM A;  4PKL A;  4QSX A;  3GL6 A;  1N87 A;  5FG4 A;  2RNX A;  4LYW A;  5F61 A;  4BW1 A;  4ZUX U;  2H0D B;  4QR5 A;  2C2V S;  3SOX A;  5CQ7 A;  3ZYU A;  1VYX A;  4HXL A;  5F62 A;  3ZNI A;  4NYX A;  4WZ2 A;  5CPE A;  5ENE A;  3UW9 A;  5A5R A;  1WIM A;  4IR5 A;  4ALG A;  2XB1 A;  4O74 A;  4IOR A;  4TZ2 A;  2JMI A;  2VP7 A;  3LRQ A;  3U5O A;  5LKZ A;  4Y03 A;  2MNZ A;  3LQH A;  4N4F A;  4LRG A;  4MR3 A;  4N3W A;  2FUI A;  1LDK C;  4QF3 A;  5ACY A;  5HQ5 A;  5ENH A;  4O71 A;  5F1H A;  4YYI A;  5F1L A;  4UYD A;  4GNG A;  5EIS A;  4LYI A;  2KR4 A;  2YEM A;  2ECJ A;  5FE9 A;  2H0D A;  2YYN A;  2YW5 A;  2I50 A;  5II2 A;  2DVV A;  4QYL A;  4J0R A;  5IGK A;  3JVM A;  5L98 A;  4CUP A;  2R0S A;  2KFT A;  5LJ2 A;  1EQF A;  4BBQ A;  5HRX A;  2ECV A;  5EWW A;  4A0C D;  2BAY A;  2KGI A;  3DAI A;  4YAB A;  2ECG A;  4O7E A;  1E4U A;  5DFB A;  4PCE A;  2RS9 B;  5I88 A;  4QR3 A;  4A9N A;  1JM7 B;  5A5P A;  2ECW A;  4O70 A;  2CSZ A;  4R8P K;  2L84 A;  4QYD A;  4A9L A;  4TZ8 A;  5FE6 A;  3HMH A;  4YYK A;  4OGJ A;  5DKC A;  2KYU A;  2G6Q A;  5AIU A;  5G4S A;  4A49 A;  5TDW A;  3V43 A;  3U5J A;  2H60 A;  5DYC A;  4A9H A;  1ZBD B;  3L11 A;  4NRC A;  4Q0O A;  3MHH A;  3N9Q A;  1RMD A;  5C13 A;  1F62 A;  3UVD A;  4A9E A;  3U5P A;  5HRW A;  3T7L A;  5CUA A;  4Z6I A;  2MD7 B;  5LUU A;  3DPL R;  5B77 A;  5E7D A;  2KIZ A;  5TAB A;  5CRZ A;  5BT3 A;  1JM7 A;  3Q2F A;  1Z2Q A;  2YSJ A;  3N9L A;  3QZT A;  5F5Z A;  3M99 A;  4R7E A;  5TCM A;  3EB5 A;  5EYA F;  4UIV A;  1WEN A;  4WA6 A;  2PNX A;  4WHU A;  4TT4 A;  5FE7 A;  1WE9 A;  4OUF A;  2LRI C;  2KWK A;  1MM2 A;  2JMD A;  2MA5 A;  4IR3 A;  5DLZ A;  5ETD A;  4FK5 A;  5F36 A;  3K2J A;  5IBN A;  5D24 A;  2FUU A;  5CQA A;  2F6N A;  4HXR A;  5DYU A;  5AMF A;  3QZS A;  5A5N A;  2CT2 A;  5H1U A;  5F3A A;  2VPD A;  3G0J A;  4GNF A;  3PHD A;  5HQ6 A;  4O76 A;  4IC3 A;  4Q6F A;  4UIU A;  2RNW A;  5KTW A;  5EP7 A;  5LKT A;  5G4R A;  5I29 A;  4Z6H A;  2LGV A;  5BT4 A;  4S3O B;  5DLX A;  5EPB A;  5H9M A;  4FLP A;  4HXM A;  3IU5 A;  4CL9 A;  2MJV B;  2Y1N A;  1E6I A;  4UP0 A;  4GPJ A;  4CUQ A;  2VPG A;  4WZ3 B;  4MR5 A;  4PCI A;  1WES A;  4QZS A;  5LKX A;  2VNF A;  4YBM A;  1MM3 A;  1WEW A;  4MEN A;  3ZTG A;  5C7N A;  3NXB A;  4A9F A;  4HXO A;  3PUQ A;  3HCT A;  5LCW B;  2L75 A;  3P1C A;  4L58 A;  5FE1 A;  2OSS A;  4YC9 A;  2MA6 A;  5CUE A;  4LAD B;  5HLS A;  2JMJ A;  2IDA A;  3SOU A;  4QST A;  5E74 A;  4BJX A;  4HXK A;  3MXF A;  4HBX A;  5ENC A;  4QSS A;  4C9Z A;  4Z1Q A;  4J0S A;  5E0R A;  4YYG A;  5LVQ A;  5EVA A;  5IID A;  5KH9 A;  4QC1 A;  5FFW A;  5FFV A;  4QBM A;  4NR5 A;  2KWN A;  4NR7 A;  4OGI A;  5FE3 A;  4A9J A;  4NUC A;  2K1J A;  1X4I A;  4B86 C;  2YDW A;  5H1V A;  2EA6 A;  2MUM A;  5FH8 A;  5CY9 A;  4A9O A;  4YYM A;  4ALH A;  5I7Y A;  3O37 A;  1X0J A;  4AP4 A;  4MEO A;  2D82 A;  4A4B A;  2L0B A;  1WGM A;  2ECN A;  5CS8 A;  5EU1 A;  3N9M A;  5CTL A;  5D3R A;  4CUT A;  4ZDT A;  3RPG C;  4TT6 A;  2OXQ C;  3UV5 A;  5C87 A;  5L96 A;  3TLP A;  2E6S A;  5D7X A;  5CQ3 A;  5D0C A;  2D9E A;  4MR4 A;  4ZW1 A;  5FE8 A;  5HEL A;  1WUM A;  3UVW A;  4LR6 A;  1Z6U A;  5CRM A;  5KHM A;  5FE0 A;  5EGU A;  5DW1 A;  3DQV R;  4BW4 A;  3PUR A;  4XY9 A;  4E96 A;  1JM4 B;  1ZS5 A;  4V3L C;  3N9P A;  4YBT A;  5FE5 A;  5G05 B;  3SVF A;  2NXB A;  5LVR A;  2KWO A;  2OO1 A;  4YH4 A;  4CFL A;  3O34 A;  4TU4 A;  5HEN A;  4O77 A;  5EIC A;  5CP5 A;  5A5O A;  2LGL A;  4IOO A;  2YSM A;  2YQL A;  5G04 B;  4XUB A;  3NG2 A;  4YAD A;  5D3J A;  2YW8 A;  2YUC A;  1WEM A;  5EK9 A;  5IGN A;  3RCW A;  3ZPV 1;  4J1P A;  4Q0N A;  2DVR A;  4TT2 A;  4NR4 A;  3O70 A;  5G0F A;  4AYC B;  5TB6 A;  4MR6 A;  4LZ2 A;  2G4A A;  2LXP C;  5A5Q A;  5EPR A;  5CFW A;  1JSP B;  3P1F A;  3S92 A;  4KV4 A;  5L8U A;  4O7F A;  2L43 A;  2PUY A;  4LZR A;  4UP5 A;  5HQ7 A;  4HBY A;  5I7X A;  5FBX A;  1DVP A;  2K17 A;  4MEP A;  2MIQ A;  5C4Q A;  3O7A A;  2RI7 A;  3P5O A;  4R2Y A;  1WEV A;  2KWJ A;  4UYF B;  5E9L A;  3MHS A;  4TYL A;  1CHC A;  5HEM A;  4L7X A;  4A9I A;  4XUA A;  2E3K A;  5FH7 A;  5KO4 A;  3FL2 A;  5E3G A;  5E73 A;  3L1Z B;  4TKP B;  4YAX A;  4W4U A;  3ZYQ A;  4AYC A;  2WP1 A;  1V87 A;  2YEK A;  2LQ6 A;  5HJC A;  1WUG A;  2YUR A;  4I7B A;  4A9M A;  2MT5 A;  4NYV A;  5DYA A;  1F68 A;  5DKH A;  3IHP A;  4UIZ A;  4BW3 A;  2LGG A;  5AME A;  4B7Y C;  4HXS A;  2CKL B;  3MUL A;  3KQI A;  5E3D A;  2VJF B;  2K16 A;  1WEE A;  3GV4 A;  3KV6 A;  2G45 A;  4TU6 A;  5JG6 A;  5AD2 A;  5FFY A;  4UYF A;  5E9K A;  2LN0 A;  3O36 A;  5EWD A;  3O35 A;  5FG6 A;  5ENJ A;  1Z60 A;  3U5L A;  4UYH A;  5EPS A;  5LKU A;  4MSX A;  3I3J A;  4O64 A;  3KV5 A;  3SVH A;  5J3X A;  1XWH A;  2EGP A;  5I89 A;  2LGK A;  5ENF A;  4YYH A;  4CA1 A;  5H85 A;  1VFY A;  4HXN A;  4YBS A;  5I83 A;  2YHO A;  2YHN A;  5EWC A;  4TS8 A;  2LXH C;  4IC2 A;  1WIL A;  5HFQ A;  4MEQ A;  3ZPV E;  5DY7 A;  5J0D A;  3KNV A;  4YY6 A;  5D26 A;  5COI A;  5D3P A;  4F52 B;  2E7O A;  5EQ1 A;  2CKL A;  4UYG A;  4BHW A;  2VJF A;  2KU3 A;  2M6M A;  2NAA A;  5EA1 A;  5A82 A;  1K2F A;  2YYR A;  5D3N A;  4V3K C;  2DKW A;  5I86 A;  2JRJ A;  4AUQ B;  4LYS A;  3JVJ A;  2R10 A;  3S91 A;  4KV1 A;  5C89 A;  1N72 A;  5HCL A;  5CQ6 A;  4Z93 A;  5CQ4 A;  5DKA A;  4N4G A;  4NR8 A;  5I1Q A;  2OUO A;  4WIV A;  4NUD A;  5LJ0 A;  5HFR A;  4MVT A;  4HXP A;  1G25 A;  5KTX A;  5IGM A;  5ENI A;  2KGG A;  5FB1 A;  4QUU A;  3EB6 A;  2RSD A;  3ZVY A;  1WEU A;  5D1L B;  4F3I A;  4UIT A;  4XYA A;  3IU6 A;  1WEQ A;  5F63 A;  3SHB A;  4BW2 A;  3GG3 A;  5EM3 A;  2DVQ A;  4AVX A;  3T6R A;  4S3O C;  4IR4 A;  2YT5 A;  4IR6 A;  3LQI A;  4KCX A;  5DX4 A;  2YQD A;  5BT5 A;  2D8S A;  4QB3 A;  3O33 A;  3U5K A;  1LDJ B;  2DX8 A;  4HBV A;  3LJW A;  5ETB A;  1T1H A;  4NR6 A;  5KU3 A;  4YH3 A;  4QSW A;  5TBN A;  2N9G A;  5DYX A;  2MD8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...