4YBMA

Crystal structure of trim24 phd-bromodomain complexed with n-{6-[3-(benzyloxy)phenoxy]-1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl}-3,4-dimethoxybenzene-1-sulfonamide (7b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
177
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 52
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ybmA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ybmA01
5FFWA 5FFYA 1HYJA 4HXSA 3KV6A 4UYHA 5CUBA 5FE9A 1RMDA 2CKLA 5A82A 1VYXA 5G05B 5FE1A 2RS9B 4QUTA 5D0CA 1WEOA 5FE2A 4YY4A 4LJNA 2C2VS 4LLBA 4A9JA 4LZSA 5I29A 2RNWA 5LJ0A 2KGIA 2LV9A 3IU5A 3SVGA 5CQ5A 4NR7A 3FKMX 4IR4A 2YHNA 4LRGA 3KQIA 2MD7B 5DBMA 2ECVA 5EYAF 5DYUA 2VNFA 5I88A 2RNXA 3LJWA 4QF3A 5CUGA 5DINA 3ZYQA 3I2DA 2MNYA 2E7OA 5LKXA 4YAXA 5E7DA 1WEPA 4HBVA 5EPRA 5HEMA 3N9PA 4YYKA 3RPGC 5BT3A 2YREA 3VK6A 3UV5A 5I40A 4FO9A 5F1HA 5C13A 2F6NA 3UVWA 4A9LA 4NRBA 5ETBA 5J0DA 4A9KA 5I83A 2R0YA 4MR3A 4QSTA 5BT4A 5FE8A 5FDZA 5B76A 4S3OC 2KIZA 2KWJA 3GL6A 4C67A 1JSPB 5FE5A 5AITA 2KR4A 5FE0A 5F60A 5H85A 5E3GA 5HM0A 4YYJA 2E6SA 2YEKA 5FB1A 2LQ6A 5D7XA 4IC3A 2GRCA 4QB3A 2JRJA 5E74A 3QZVA 4AYCB 5C87A 5L8TA 5C85A 5IGMA 2BAYA 3T6RA 4LYSA 5LCWB 3LQJA 3T7LA 4QSRA 5LKZA 4LDFA 2D82A 3L1XA 1WIMA 2ECGA 4TKPB 4A9IA 4O7AA 3AQAA 4J3IA 5HRWA 3MB3A 5FE6A 4UIZA 2KE1A 5CUDA 4WA6A 4NQMA 4XY8A 5F62A 2LN0A 2YELA 4AVXA 4NR8A 3LQHA 4R8PK 2G43A 4NUDA 2WP1A 5G0FA 3ZNIA 2H0DA 3KV5A 3DWYA 3RTRB 5FEYA 5EP7A 3O37A 1Z2QA 3SVHA 2HYED 4NR9A 5FG6A 5CQ8A 2YHOA 1E4UA 2QJ0A 5L8UA 1WEUA 5D25A 5F25A 2L5UA 4PY6A 5CFWA 3UVXA 2K4DA 1FP0A 4LYIA 2MA6A 2RI7A 4IR3A 4AKNA 2AN6A 5C89A 2DX8A 5B78A 2LXHC 4TU4A 5FFVA 2ECJA 3FL2A 5AD2A 4QY4A 4TTEA 5KH7A 3KNVA 1ZBDB 5CUEA 4UYGA 5LKTA 5B77A 2LRIC 4UP5A 2L85A 4O74A 5EU1A 3ZPVE 4O7BA 5FE3A 2LXPC 2YYRA 5H1UA 2KWKA 3O70A 4QSPA 4QR4A 2Y1MA 5D24A 4MEOA 5E9IA 3S92A 4CUQA 3UVYA 4CLBA 4UI9B 2YT5A 5I80A 5DKAA 5A81A 1JM4B 3L11A 1VD4A 4N3WA 3UV2A 4KCXA 2L0BA 5D1MB 5KO4A 3ZYUA 5A5SA 4MEQA 4BJXA 4OGIA 3PUQA 4C9ZA 4QSUA 2DWWA 4QUUA 2UZGA 5KTUA 3O7AA 5JWMA 2FUIA 3JVMA 4NYWA 5L96A 5LVRA 1WEEA 1Z60A 4XI1A 5EWCA 4UIXA 4CFKA 4NRAA 2E7NA 2OO1A 4TT2A 5E9MA 2VP7A 4UYFB 4QNSA 5F1LA 5E9YA 4CUTA 3JVJA 5A7CA 4YYHA 5F5ZA 2F42A 2KU3A 3C5KA 3N9QA 5TDWA 4L7XA 5CGPA 3UVDA 4GNDA 4O64A 2YQLA 3S91A 4CUUA 2KWNA 5HCLA 1WUGA 3QZTA 5EPBA 1MM2A 4LADB 4PPEA 3LRQA 5K29A 1WFKA 4QSWA 4PS5A 5D1LB 5HRVA 4HBXA 4N4GA 5H9MA 4IC2A 2D8SA 5TRBA 4YADA 2RNYA 1U6GB 2YYNA 3JVKA 4HBYA 5CUCA 5LJ1A 3QZSA 4O70A 3JVLA 4O71A 2DVVA 4QYLA 5D3RA 5ENBA 2YEMA 4UIYA 4HXOA 1LDJB 1JOCA 2CSZA 4HXPA 5CTLA 4UIVA 5A5NA 3O34A 5D3NA 4B7YC 2DVRA 5EQ1A 1WEVA 4NR4A 5EM3A 4E96A 5JI8A 2MNZA 1VFYA 2ECIA 4WZ3B 1WGMA 4YBTA 4TS8A 3U5KA 1F68A 4J0RA 4MEPA 5B75A 4TYLA 1JM7A 2R0SA 5HQ6A 5IBNA 5D3TA 5ENGA 3HMEA 4ZC9A 4HXRA 2G45A 3ZTGA 2VPEA 3U5MA 5A5PA 5CQTA 5LUUA 5D3PA 5DFDA 2OUOA 5DY7A 5A5OA 1V87A 5B8DA 1WILA 2E3KA 5A83A 4UYEA 3RCWA 5G4SA 1WEMA 2VJEA 5KU3A 5I3LA 2MA5A 5DYAA 4L58A 4LC2A 4Y03A 5LJ2A 4WIVA 4A9HA 3AADA 3SOXA 2EODA 4NR6A 2EGPA 2KFTA 2YSMA 2Y43A 5FERA 4TT6A 5C4QA 5DKDA 5HFQA 1X4JA 4NR5A 4Z93A 4BW3A 1LDKC 4GPJA 4UP0A 4CL9A 4AP4A 4QR3A 4A49A 3MQMA 4F52B 4Q0OA 4X3GA 5KHMA 4WHUA 5TB6A 2PUYA 3LQIA 4KV4A 4NN2A 3RPGB 2PNXA 4J0SA 4MR5A 5L99A 2JMIA 1WESA 5COIA 2HDPA 2QIZA 3P1FA 5II1A 4IOQA 3K2JA 4YH4A 3UV4A 1FBVA 1T1HA 1XWHA 5CRZA 5CRMA 2I50A 2KYUA 2K1JA 4Z1QA 2VJFB 4GNFA 4V3KC 5C11A 3MHHA 4GNEA 5C8GA 5A85A 1EQFA 3TLPA 3L1ZB 4S3OB 4ZUXU 3IU6A 4YY6A 2JMJA 4HXLA 1DVPA 4XUBA 2YW8A 4WZ2A 3P1DA 3U5PA 2CKLB 4LZ2A 3HMHA 2F6JA 5L98A 5EWVA 4YBMA 5EVAA 1MM3A 5DKHA 1WUMA 4NXJA 4Z6IA 4TZ2A 5HELA 3N9MA 2RO1A 4P5OB 2QICA 4A9MA 3M62A 5CQ7A 5FH8A 2EA6A 5EV9A 5TDRA 3GV4A 5EK9A 4IORA 4TZ8A 4A9NA 3G0JA 3O33A 2FSAA 3P5OA 4UITA 2YUCA 5G04B 5B79A 2M85A 3DPLR 4PTBA 1F62A 4C66A 5DW2A 5C7NA 4Z6HA 4YK0A 5CP5A 4UIUA 2CSYA 2FUUA 2LGVA 3IHPA 4O7EA 2MJVB 5E9VA 5E3DA 4HXNA 4YABA 4AYCA 4J1PA 4KV1A 4DONA 4R7EA 5CS8A 2ECWA 2N9GA 4YYNA 3SHBA 2KWOA 5AIUA 4LKAA 4CUSA 2ECNA 2YURA 4QF2A 4BW4A 2MD8C 4YYDA 4FIPA 5IGKA 2LSPB 4XY9A 2E6RA 5ENIA 3N9OA 5JG6A 5HLSA 4LR6A 4UIWA 3U5NA 4A0CD 4CURA 2RSDA 3HCSA 5TCMA 2OXQC 4Z1SA 4HXKA 2MT5A 4QYDA 3HCTA 5DKCA 5FB0A 5CPEA 4TQNA 5LVQA 5IIDA 5F36A 1WEQA 3MHSA 5HENA 4NYVA 5ENHA 4IR6A 5DFBA 4BHWA 4LK9A 2L5EA 4LYWA 3MXFA 5FE7A 5D3SA 1X4IA 4YYMA 5FH6A 3M99A 4GNGA 5AMEA 2L75A 4X2IA 2KGGA 3Q2FA 2KREA 4QC3A 5CQ6A 2CT2A 1CHCA 4CA1A 1N87A 5FG4A 1Z6UA 4GB0A 5ENFA 3DQVR 4R2YA 4QBMA 3D7CA 5ENEA 1G25A 3HCUA 1ZS5A 2I8NA 2R10A 3GG3A 4QC1A 5FG5A 1X0JA 4O7FA 5KH9A 2M6MA 5F3AA 2K16A 4Q6FA 2H0DB 5E9LA 3DAIA 3M63A 2ZETC 3SOUA 4MVTA 2VPGA 2DVQA 1E6IA 3EB5A 3SVFA 2L43A 3ZVYA 4XUAA 4ZW1A 5DYCA 3MULA 3V43A 3PHDA 4QSXA 5HRXA 5D3HA 4A9EA 2G6QA 5IGLA 2L84A 2Y1NA 4YH3A 5KH3A 2OSSA 4QSSA 5DX4A 3ZVZB 4TT4A 5AD3A 4O75A 4MSXA 4FLPA 4N4HA 5EWHA 5KTXA 2YDWA 4IR5A 3I3JA 4UYDA 4RVRA 5D26A 5DFCA 5L97A 4CFLA 5DYXA 4B86C 3NXBA 5HQ7A 2DATA 4N4IA 5IG6A 3HTKC 4BW2A 4N4FA 4TU6A 3O35A 4Q0NA 5A5QA 4UYFA 1BORA 2C2LA 4AUQB 4FK5A 4NS5A 4MR6A 5EI4A 4QEVA 2YSJA 5LKUA 2IDAA 4BBQA 4NQNA 4ALHA 5HFRA 2NXBA 3O36A 4YATA 4YBSA 2M1RA 2YU4A 4YC9A 5ETDA 4MENA 5CU8A 4V3LC 5E73A 2VPDA 4O72A 4OGJA 3P1EA 5AMFA 3MB4A 3MUKA 4NUEA 4QSQA 4YYGA 2LGLA 3ASLA 4IOOA 4A4BA 1WE9A 4ZDTA 3N9NA 5G4RA 2VPBA 4MR4A 5ACYA 1WENA 5EWWA 5FBXA 4WHWA 3UW9A 5EGUA 4QR5A 4PKLA 5FE4A 4NYXA 5F63A 2I7KA 1N72A 5H1TA 5CQAA 4BW1A 5J3XA 4O77A 2WP2A 5F2PA 5D3LA 3ZPV1 3ONIA 3U5LA 4A9FA 5DLXA 4O7CA 3U5OA 5TABA 5EWDA 4I7BA 4QSVA 5II2A 2LGKA 3Q2EA 4ZQLA 5HQ5A 3SOWA 3NG2A 5CZGA 5DLZA 4FJCA 4O76A 5CUAA 2H60A 2R0VA 5FH7A 1K2FA 5CQ4A 5HJCA 2ECTA 1HYIA 5EA1A 4YYIA 3HMFA 4PCEA 4CUPA 2LGGA 2YW5A 2KTBB 3G0LA 2XEUA 5I86A 2LDRA 4OUFA 5I7XA 1WEWA 3LXJA 2XB1A 2YQDA 4QZSA 4ALGA 3N9LA 4NUCA 4CCGX 5D3JA 4F3IA 2DVSA 4XYAA 5I7YA 2MUMA 4QEUA 4WZ0A 2NAAA 5H1VA 5I89A 4I7CA 1JM7B 4A9OA 5E9KA 4O78A 5DW1A 3C6WA 2MIQA 5CY9A 5CQ3A 5E0RA 3U5JA 2D9EA 5I1QA 3P1CA 5ENCA 5ENJA 4HBWA 5BT5A 4I7DA 5D1KB 1X4UA 5A5RA 5EPSA 2M3HA 4HXMA 5EISA 2VJEB 4NRCA 5F61A 4W4UA 5IGNA 4PCIA 2JMDA 3PURA 2DKWA 4LZRA 5EICA 2K17A 5TBNA 2VJFA 4A4CA 2RFJA 4QEWA 2G4AA 2YQMA 1IYMA 3EB6A 2L80A 5KTWA
chains in the Genus database with same CATH superfamily
5FFWA 3E2DA 5FFYA 1HYJA 4HXSA 3KV6A 4UYHA 5CUBA 5FE9A 1RMDA 2CKLA 5A82A 1VYXA 2RR4A 5G05B 5FE1A 2RS9B 4QUTA 5D0CA 2XOYA 1WEOA 5FE2A 4YY4A 3FM8C 4LJNA 2C2VS 4LLBA 4A9JA 4LZSA 5I29A 2RNWA 5LJ0A 2KGIA 3FAOA 2LV9A 3IU5A 3SVGA 5CQ5A 4NR7A 3FKMX 4IR4A 2YHNA 4LRGA 3KQIA 3LDYA 2MD7B 5DBMA 4Z0RA 2ECVA 5EYAF 5DYUA 2VNFA 5I88A 2RNXA 3LJWA 4QF3A 3ERRA 5CUGA 5DINA 3ZYQA 3I2DA 2MNYA 2E7OA 5LKXA 4YAXA 5E7DA 1WEPA 4HBVA 5EPRA 5HEMA 3N9PA 4YYKA 3RPGC 5BT3A 2YREA 3VK6A 3UV5A 5I40A 4FO9A 2E61A 5F1HA 5C13A 2F6NA 3UVWA 4A9LA 4NRBA 5ETBA 5J0DA 4A9KA 5I83A 2R0YA 4MR3A 4QSTA 5BT4A 5FE8A 5FDZA 5B76A 4S3OC 2KIZA 2KWJA 3GL6A 4C67A 1JSPB 5FE5A 5AITA 2KR4A 4OGCA 5FE0A 5F60A 5H85A 5E3GA 5HM0A 4YYJA 2E6SA 2YEKA 5FB1A 2LQ6A 5D7XA 4IC3A 2CONA 2GRCA 1PUOA 4QB3A 2JRJA 5E74A 3QZVA 4AYCB 5C87A 5L8TA 5C85A 5IGMA 2BAYA 3T6RA 4LYSA 5LCWB 3LQJA 3T7LA 2XOCA 4QSRA 5LKZA 4LDFA 2P57A 2D82A 3L1XA 1WIMA 2ECGA 3FEHA 4TKPB 4A9IA 4O7AA 3AQAA 4J3IA 5HRWA 3MB3A 5FE6A 3D1DA 4UIZA 2KE1A 5CUDA 4WA6A 4NQMA 4XY8A 5F62A 2LN0A 2YELA 4AVXA 4NR8A 3LQHA 4R8PK 2G43A 4NUDA 2WP1A 5G0FA 3ZNIA 2H0DA 3KV5A 3DWYA 3RTRB 5FEYA 5EP7A 3O37A 1Z2QA 3SVHA 2HYED 4NR9A 5FG6A 5CQ8A 2YHOA 1E4UA 2QJ0A 5L8UA 1WEUA 5D25A 5F25A 2L5UA 4PY6A 5CFWA 3UVXA 2K4DA 1FP0A 4LYIA 2MA6A 2RI7A 3FANA 4IR3A 4AKNA 2AN6A 5C89A 2DX8A 2JM3A 2LXHC 5B78A 4TU4A 5FFVA 2ECJA 3FL2A 5AD2A 4QY4A 4TTEA 5KH7A 3KNVA 1ZBDB 5CUEA 4UYGA 5LKTA 5B77A 2LRIC 4UP5A 2L85A 4O74A 5EU1A 3ZPVE 4O7BA 5FE3A 2LXPC 2YYRA 5H1UA 2KWKA 2YVRA 3O70A 5SVXA 4QSPA 4QR4A 2Y1MA 5D24A 5K3QA 4MEOA 5E9IA 3S92A 4CUQA 3UVYA 4CLBA 4UI9B 2YT5A 5I80A 2EXUA 5DKAA 5A81A 1JM4B 3L11A 1VD4A 4N3WA 3UV2A 4KCXA 2L0BA 5D1MB 5KO4A 2KKXA 3ZYUA 5A5SA 4MEQA 4BJXA 4OGIA 3PUQA 4C9ZA 4QSUA 2EGMA 2DWWA 4QUUA 2UZGA 5KTUA 3O7AA 5JWMA 2FUIA 3JVMA 4NYWA 5L96A 5LVRA 1WEEA 1Z60A 4XI1A 5EWCA 4UIXA 1MBMA 4CFKA 4NRAA 2E7NA 2OO1A 4TT2A 5E9MA 2VP7A 4UYFB 4QNSA 5F1LA 5E9YA 4CUTA 3JVJA 5A7CA 4YYHA 5F5ZA 2F42A 2KU3A 3C5KA 3N9QA 5SVIA 2CSVA 5TDWA 4L7XA 5CGPA 3UVDA 4GNDA 4O64A 2YQLA 3S91A 4CUUA 2KWNA 5HCLA 1WUGA 3QZTA 5EPBA 1MM2A 2D8UA 4LADB 3LRQA 4PPEA 5K29A 1WFKA 4QSWA 4PS5A 5D1LB 5HRVA 4HBXA 4N4GA 5H9MA 4IC2A 2D8SA 5TRBA 4YADA 2RNYA 1U6GB 2YYNA 3JVKA 4HBYA 5CUCA 5LJ1A 3QZSA 4O70A 3JVLA 4O71A 2DVVA 4QYLA 5D3RA 5ENBA 2YEMA 4UIYA 4HXOA 1LDJB 1JOCA 2CSZA 4HXPA 5CTLA 4UIVA 5A5NA 3O34A 5D3NA 4B7YC 2DVRA 5EQ1A 1WEVA 4NR4A 5EM3A 4E96A 5JI8A 2DSMA 2MNZA 1ZKRA 1VFYA 2ECIA 4WZ3B 1WGMA 4YBTA 4TS8A 3U5KA 1F68A 4J0RA 4MEPA 4QQ4A 4TYLA 5B75A 1JM7A 2R0SA 5HQ6A 5IBNA 5D3TA 5ENGA 3HMEA 4ZC9A 4HXRA 2G45A 3ZTGA 2VPEA 3U5MA 5A5PA 5CQTA 5LUUA 5D3PA 5DFDA 2OUOA 5DY7A 5A5OA 1V87A 3JUEA 5B8DA 1WILA 2E3KA 3M7KA 5A83A 4UYEA 3RCWA 5G4SA 3VKGA 1WEMA 2VJEA 2EJNA 5KU3A 5I3LA 2MA5A 5DYAA 4L58A 4LC2A 4Y03A 5LJ2A 4WIVA 4A9HA 3AADA 3SOXA 2EODA 4NR6A 2OWAA 2EGPA 2KFTA 2YSMA 2Y43A 5FERA 4TT6A 5C4QA 5DKDA 5HFQA 1X4JA 5SVYA 4NR5A 4Z93A 4BW3A 4O62A 1LDKC 4GPJA 4UP0A 4CL9A 4AP4A 4QR3A 4A49A 3MQMA 4F52B 4Q0OA 4X3GA 5KHMA 4WHUA 5TB6A 2PUYA 3DDTA 3LQIA 4KV4A 4NN2A 3RPGB 2PNXA 4J0SA 4MR5A 5L99A 2JMIA 1WESA 5COIA 2HDPA 2QIZA 3P1FA 5II1A 4IOQA 3K2JA 4YH4A 3UV4A 1FBVA 1T1HA 1XWHA 5CRZA 5CRMA 2I50A 2KYUA 2K1JA 3SUBA 4Z1QA 2VJFB 3VKHA 4GNFA 4V3KC 5C11A 3MHHA 4GNEA 5C8GA 5A85A 1EQFA 3TLPA 3L1ZB 4S3OB 4ZUXU 3IU6A 4YY6A 2IQJA 2JMJA 4HXLA 1DVPA 4XUBA 2YW8A 4WZ2A 3PLWA 3P1DA 3U5PA 2CKLB 4LZ2A 3HMHA 2F6JA 5L98A 5EWVA 3FJUB 4YBMA 5EVAA 1MM3A 5DKHA 1WUMA 4NXJA 4Z6IA 4TZ2A 5HELA 3N9MA 2RO1A 4P5OB 2QICA 4A9MA 3O47A 3M62A 5CQ7A 5FH8A 2EA6A 5EV9A 5TDRA 4AKHA 2L7PA 3GV4A 5EK9A 4IORA 2FFWA 4TZ8A 4A9NA 3G0JA 3O33A 2FSAA 3P5OA 4UITA 2YUCA 2JUNA 5G04B 5B79A 2M85A 3DPLR 4PTBA 1F62A 4C66A 5DW2A 5C7NA 4Z6HA 4YK0A 5CP5A 4UIUA 2CSYA 2FUUA 2LGVA 3IHPA 4O7EA 2MJVB 5E9VA 5E3DA 4HXNA 4YABA 4AYCA 4J1PA 4KV1A 4DONA 4R7EA 5CS8A 2ECWA 2N9GA 4YYNA 3SHBA 2KWOA 5AIUA 4LKAA 4CUSA 2CRWA 2ECNA 2YURA 4BW4A 4QF2A 2MD8C 4YYDA 4FIPA 5IGKA 2LSPB 4XY9A 2E6RA 5ENIA 3N9OA 5JG6A 5HLSA 3LJUX 4AKIA 4LR6A 4UIWA 3U5NA 4A0CD 4CURA 2RSDA 3HCSA 5TCMA 2OXQC 4Z1SA 4HXKA 2MT5A 4QYDA 3HCTA 5DKCA 5FB0A 5CPEA 4TQNA 5LVQA 4H9DA 5IIDA 5F36A 1WEQA 3MHSA 5HENA 4NYVA 5ENHA 4IR6A 5DFBA 4BHWA 4LK9A 2L5EA 4LYWA 3MXFA 3D1BA 5D3SA 5FE7A 1X4IA 4YYMA 5FH6A 3M99A 4GNGA 5AMEA 2L75A 4X2IA 2KGGA 3Q2FA 2KREA 4QC3A 5CQ6A 2CT2A 1CHCA 3LVQE 4CA1A 1N87A 5FG4A 1Z6UA 4GB0A 5ENFA 3DQVR 4R2YA 4QBMA 3T9KA 3D7CA 5ENEA 1G25A 3HCUA 1ZS5A 2I8NA 2R10A 3GG3A 4QC1A 5FG5A 1X0JA 4O7FA 5KH9A 2M6MA 5F3AA 2K16A 4Q6FA 2H0DB 5E9LA 3DAIA 3M63A 2ZETC 4OGEA 3SOUA 4MVTA 2VPGA 2DVQA 1E6IA 3EB5A 3SVFA 2L43A 3ZVYA 4XUAA 4ZW1A 5DYCA 3MULA 3V43A 3PHDA 4QSXA 5HRXA 5D3HA 4A9EA 2G6QA 5IGLA 2L84A 2Y1NA 4YH3A 5KH3A 3H7HA 2OSSA 4QSSA 5DX4A 3ZVZB 4TT4A 5AD3A 4O75A 4MSXA 4FLPA 4N4HA 5EWHA 5KTXA 2YDWA 4IR5A 3I3JA 4UYDA 4RVRA 5D26A 5DFCA 5L97A 4CFLA 2B0OE 5DYXA 2M13A 2XOZA 4B86C 3NXBA 5HQ7A 2LAUA 2DATA 4N4IA 5IG6A 3HTKC 4BW2A 4N4FA 4TU6A 3O35A 4Q0NA 5A5QA 4UYFA 1BORA 2C2LA 4AUQB 4FK5A 4NS5A 4MR6A 5EI4A 4QEVA 2YSJA 5LKUA 2IDAA 4BBQA 2CRRA 4NQNA 4ALHA 5HFRA 2NXBA 3O36A 4YATA 4YBSA 2M1RA 2MKEA 2YU4A 4YC9A 5ETDA 4MENA 5CU8A 2DJAA 4V3LC 5E73A 2VPDA 4O72A 4OGJA 3P1EA 5AMFA 3MB4A 3MUKA 4NUEA 4QSQA 4YYGA 2LGLA 3ASLA 4IOOA 4A4BA 1WE9A 4ZDTA 3N9NA 5G4RA 4F1PA 2VPBA 4MR4A 5ACYA 2FD4A 1WENA 5EWWA 5FBXA 4WHWA 3UW9A 5EGUA 4QR5A 4PKLA 5FE4A 4NYXA 3KDEC 5F63A 2I7KA 1N72A 5H1TA 5CQAA 4BW1A 5J3XA 4O77A 2WP2A 5F2PA 5D3LA 5SVIB 3ONIA 3ZPV1 3U5LA 4A9FA 5DLXA 4O7CA 3U5OA 1DCQA 4AI6A 5TABA 5EWDA 4I7BA 3DWDA 4QSVA 5II2A 2LGKA 3Q2EA 4ZQLA 5HQ5A 3SOWA 3NG2A 5CZGA 2XP0A 5DLZA 4FJCA 4O76A 5CUAA 2H60A 2R0VA 5FH7A 1K2FA 5CQ4A 5HJCA 2ECTA 1HYIA 5EA1A 4YYIA 3HMFA 4PCEA 4CUPA 2LGGA 2YW5A 4Z0OA 2KTBB 3G0LA 2XEUA 5I86A 2LDRA 4OUFA 5I7XA 1WEWA 3LXJA 2XB1A 2YQDA 4QZSA 4ALGA 3N9LA 4NUCA 4CCGX 5D3JA 4F3IA 2DVSA 4XYAA 5I7YA 2MUMA 4QEUA 4WZ0A 2NAAA 5H1VA 5I89A 4I7CA 1JM7B 4A9OA 5E9KA 4O78A 5DW1A 2KKYA 3C6WA 2MIQA 5CY9A 5CQ3A 5E0RA 3U5JA 2D9EA 5I1QA 3P1CA 5ENCA 5ENJA 3LVRE 4HBWA 5BT5A 4I7DA 5D1KB 1X4UA 5A5RA 3MDBC 5EPSA 2M3HA 4HXMA 5EISA 2VJEB 4NRCA 5F61A 4W4UA 5IGNA 4PCIA 2JMDA 3PURA 2DKWA 4LZRA 5EICA 2K17A 5TBNA 2VJFA 4A4CA 3Q1DA 2RFJA 4QEWA 2G4AA 2YQMA 1IYMA 4AKGA 3EB6A 2L80A 5KTWA
chains in the Genus database with same CATH topology
5FFWA 5FFYA 1HYJA 4HXSA 3KV6A 4UYHA 5CUBA 5FE9A 1RMDA 2CKLA 5A82A 1VYXA 5G05B 5FE1A 2RS9B 4QUTA 5D0CA 1WEOA 5FE2A 4YY4A 4LJNA 2C2VS 4LLBA 4A9JA 4LZSA 5I29A 2RNWA 5LJ0A 2KGIA 2LV9A 3IU5A 3SVGA 5CQ5A 4NR7A 3FKMX 4IR4A 2YHNA 4LRGA 3KQIA 2MD7B 5DBMA 2ECVA 5EYAF 5DYUA 2VNFA 5I88A 2RNXA 3LJWA 4QF3A 5CUGA 5DINA 3ZYQA 3I2DA 2MNYA 2E7OA 5LKXA 4YAXA 5E7DA 1WEPA 4HBVA 5EPRA 5HEMA 3N9PA 4YYKA 3RPGC 5BT3A 2YREA 3VK6A 3UV5A 5I40A 4FO9A 5F1HA 5C13A 2F6NA 3UVWA 4A9LA 4NRBA 5ETBA 5J0DA 4A9KA 5I83A 2R0YA 4MR3A 4QSTA 5BT4A 5FE8A 5FDZA 5B76A 4S3OC 2KIZA 2KWJA 3GL6A 4C67A 1JSPB 5FE5A 5AITA 2KR4A 5FE0A 5F60A 5H85A 5E3GA 5HM0A 4YYJA 2E6SA 2YEKA 5FB1A 2LQ6A 5D7XA 4IC3A 2GRCA 4QB3A 2JRJA 5E74A 3QZVA 4AYCB 5C87A 5L8TA 5C85A 5IGMA 2BAYA 3T6RA 4LYSA 5LCWB 3LQJA 3T7LA 4QSRA 5LKZA 4LDFA 2D82A 3L1XA 1WIMA 2ECGA 4TKPB 4A9IA 4O7AA 3AQAA 4J3IA 5HRWA 3MB3A 5FE6A 4UIZA 2KE1A 5CUDA 4WA6A 4NQMA 4XY8A 5F62A 2LN0A 2YELA 4AVXA 4NR8A 3LQHA 4R8PK 2G43A 4NUDA 2WP1A 5G0FA 3ZNIA 2H0DA 3KV5A 3DWYA 3RTRB 5FEYA 5EP7A 3O37A 1Z2QA 3SVHA 2HYED 4NR9A 5FG6A 5CQ8A 2YHOA 1E4UA 2QJ0A 5L8UA 1WEUA 5D25A 5F25A 2L5UA 4PY6A 5CFWA 3UVXA 2K4DA 1FP0A 4LYIA 2MA6A 2RI7A 4IR3A 4AKNA 2AN6A 5C89A 2DX8A 5B78A 2LXHC 4TU4A 5FFVA 2ECJA 3FL2A 5AD2A 4QY4A 4TTEA 5KH7A 3KNVA 1ZBDB 5CUEA 4UYGA 5LKTA 5B77A 2LRIC 4UP5A 2L85A 4O74A 5EU1A 3ZPVE 4O7BA 5FE3A 2LXPC 2YYRA 5H1UA 2KWKA 3O70A 4QSPA 4QR4A 2Y1MA 5D24A 4MEOA 5E9IA 3S92A 4CUQA 3UVYA 4CLBA 4UI9B 2YT5A 5I80A 5DKAA 5A81A 1JM4B 3L11A 1VD4A 4N3WA 3UV2A 4KCXA 2L0BA 5D1MB 5KO4A 3ZYUA 5A5SA 4MEQA 4BJXA 4OGIA 3PUQA 4C9ZA 4QSUA 2DWWA 4QUUA 2UZGA 5KTUA 3O7AA 5JWMA 2FUIA 3JVMA 4NYWA 5L96A 5LVRA 1WEEA 1Z60A 4XI1A 5EWCA 4UIXA 4CFKA 4NRAA 2E7NA 2OO1A 4TT2A 5E9MA 2VP7A 4UYFB 4QNSA 5F1LA 5E9YA 4CUTA 3JVJA 5A7CA 4YYHA 5F5ZA 2F42A 2KU3A 3C5KA 3N9QA 5TDWA 4L7XA 5CGPA 3UVDA 4GNDA 4O64A 2YQLA 3S91A 4CUUA 2KWNA 5HCLA 1WUGA 3QZTA 5EPBA 1MM2A 4LADB 4PPEA 3LRQA 5K29A 1WFKA 4QSWA 4PS5A 5D1LB 5HRVA 4HBXA 4N4GA 5H9MA 4IC2A 2D8SA 5TRBA 4YADA 2RNYA 1U6GB 2YYNA 3JVKA 4HBYA 5CUCA 5LJ1A 3QZSA 4O70A 3JVLA 4O71A 2DVVA 4QYLA 5D3RA 5ENBA 2YEMA 4UIYA 4HXOA 1LDJB 1JOCA 2CSZA 4HXPA 5CTLA 4UIVA 5A5NA 3O34A 5D3NA 4B7YC 2DVRA 5EQ1A 1WEVA 4NR4A 5EM3A 4E96A 5JI8A 2MNZA 1VFYA 2ECIA 4WZ3B 1WGMA 4YBTA 4TS8A 3U5KA 1F68A 4J0RA 4MEPA 5B75A 4TYLA 1JM7A 2R0SA 5HQ6A 5IBNA 5D3TA 5ENGA 3HMEA 4ZC9A 4HXRA 2G45A 3ZTGA 2VPEA 3U5MA 5A5PA 5CQTA 5LUUA 5D3PA 5DFDA 2OUOA 5DY7A 5A5OA 1V87A 5B8DA 1WILA 2E3KA 5A83A 4UYEA 3RCWA 5G4SA 1WEMA 2VJEA 5KU3A 5I3LA 2MA5A 5DYAA 4L58A 4LC2A 4Y03A 5LJ2A 4WIVA 4A9HA 3AADA 3SOXA 2EODA 4NR6A 2EGPA 2KFTA 2YSMA 2Y43A 5FERA 4TT6A 5C4QA 5DKDA 5HFQA 1X4JA 4NR5A 4Z93A 4BW3A 1LDKC 4GPJA 4UP0A 4CL9A 4AP4A 4QR3A 4A49A 3MQMA 4F52B 4Q0OA 4X3GA 5KHMA 4WHUA 5TB6A 2PUYA 3LQIA 4KV4A 4NN2A 3RPGB 2PNXA 4J0SA 4MR5A 5L99A 2JMIA 1WESA 5COIA 2HDPA 2QIZA 3P1FA 5II1A 4IOQA 3K2JA 4YH4A 3UV4A 1FBVA 1T1HA 1XWHA 5CRZA 5CRMA 2I50A 2KYUA 2K1JA 4Z1QA 2VJFB 4GNFA 4V3KC 5C11A 3MHHA 4GNEA 5C8GA 5A85A 1EQFA 3TLPA 3L1ZB 4S3OB 4ZUXU 3IU6A 4YY6A 2JMJA 4HXLA 1DVPA 4XUBA 2YW8A 4WZ2A 3P1DA 3U5PA 2CKLB 4LZ2A 3HMHA 2F6JA 5L98A 5EWVA 4YBMA 5EVAA 1MM3A 5DKHA 1WUMA 4NXJA 4Z6IA 4TZ2A 5HELA 3N9MA 2RO1A 4P5OB 2QICA 4A9MA 3M62A 5CQ7A 5FH8A 2EA6A 5EV9A 5TDRA 3GV4A 5EK9A 4IORA 4TZ8A 4A9NA 3G0JA 3O33A 2FSAA 3P5OA 4UITA 2YUCA 5G04B 5B79A 2M85A 3DPLR 4PTBA 1F62A 4C66A 5DW2A 5C7NA 4Z6HA 4YK0A 5CP5A 4UIUA 2CSYA 2FUUA 2LGVA 3IHPA 4O7EA 2MJVB 5E9VA 5E3DA 4HXNA 4YABA 4AYCA 4J1PA 4KV1A 4DONA 4R7EA 5CS8A 2ECWA 2N9GA 4YYNA 3SHBA 2KWOA 5AIUA 4LKAA 4CUSA 2ECNA 2YURA 4QF2A 4BW4A 2MD8C 4YYDA 4FIPA 5IGKA 2LSPB 4XY9A 2E6RA 5ENIA 3N9OA 5JG6A 5HLSA 4LR6A 4UIWA 3U5NA 4A0CD 4CURA 2RSDA 3HCSA 5TCMA 2OXQC 4Z1SA 4HXKA 2MT5A 4QYDA 3HCTA 5DKCA 5FB0A 5CPEA 4TQNA 5LVQA 5IIDA 5F36A 1WEQA 3MHSA 5HENA 4NYVA 5ENHA 4IR6A 5DFBA 4BHWA 4LK9A 2L5EA 4LYWA 3MXFA 5FE7A 5D3SA 1X4IA 4YYMA 5FH6A 3M99A 4GNGA 5AMEA 2L75A 4X2IA 2KGGA 3Q2FA 2KREA 4QC3A 5CQ6A 2CT2A 1CHCA 4CA1A 1N87A 5FG4A 1Z6UA 4GB0A 5ENFA 3DQVR 4R2YA 4QBMA 3D7CA 5ENEA 1G25A 3HCUA 1ZS5A 2I8NA 2R10A 3GG3A 4QC1A 5FG5A 1X0JA 4O7FA 5KH9A 2M6MA 5F3AA 2K16A 4Q6FA 2H0DB 5E9LA 3DAIA 3M63A 2ZETC 3SOUA 4MVTA 2VPGA 2DVQA 1E6IA 3EB5A 3SVFA 2L43A 3ZVYA 4XUAA 4ZW1A 5DYCA 3MULA 3V43A 3PHDA 4QSXA 5HRXA 5D3HA 4A9EA 2G6QA 5IGLA 2L84A 2Y1NA 4YH3A 5KH3A 2OSSA 4QSSA 5DX4A 3ZVZB 4TT4A 5AD3A 4O75A 4MSXA 4FLPA 4N4HA 5EWHA 5KTXA 2YDWA 4IR5A 3I3JA 4UYDA 4RVRA 5D26A 5DFCA 5L97A 4CFLA 5DYXA 4B86C 3NXBA 5HQ7A 2DATA 4N4IA 5IG6A 3HTKC 4BW2A 4N4FA 4TU6A 3O35A 4Q0NA 5A5QA 4UYFA 1BORA 2C2LA 4AUQB 4FK5A 4NS5A 4MR6A 5EI4A 4QEVA 2YSJA 5LKUA 2IDAA 4BBQA 4NQNA 4ALHA 5HFRA 2NXBA 3O36A 4YATA 4YBSA 2M1RA 2YU4A 4YC9A 5ETDA 4MENA 5CU8A 4V3LC 5E73A 2VPDA 4O72A 4OGJA 3P1EA 5AMFA 3MB4A 3MUKA 4NUEA 4QSQA 4YYGA 2LGLA 3ASLA 4IOOA 4A4BA 1WE9A 4ZDTA 3N9NA 5G4RA 2VPBA 4MR4A 5ACYA 1WENA 5EWWA 5FBXA 4WHWA 3UW9A 5EGUA 4QR5A 4PKLA 5FE4A 4NYXA 5F63A 2I7KA 1N72A 5H1TA 5CQAA 4BW1A 5J3XA 4O77A 2WP2A 5F2PA 5D3LA 3ZPV1 3ONIA 3U5LA 4A9FA 5DLXA 4O7CA 3U5OA 5TABA 5EWDA 4I7BA 4QSVA 5II2A 2LGKA 3Q2EA 4ZQLA 5HQ5A 3SOWA 3NG2A 5CZGA 5DLZA 4FJCA 4O76A 5CUAA 2H60A 2R0VA 5FH7A 1K2FA 5CQ4A 5HJCA 2ECTA 1HYIA 5EA1A 4YYIA 3HMFA 4PCEA 4CUPA 2LGGA 2YW5A 2KTBB 3G0LA 2XEUA 5I86A 2LDRA 4OUFA 5I7XA 1WEWA 3LXJA 2XB1A 2YQDA 4QZSA 4ALGA 3N9LA 4NUCA 4CCGX 5D3JA 4F3IA 2DVSA 4XYAA 5I7YA 2MUMA 4QEUA 4WZ0A 2NAAA 5H1VA 5I89A 4I7CA 1JM7B 4A9OA 5E9KA 4O78A 5DW1A 3C6WA 2MIQA 5CY9A 5CQ3A 5E0RA 3U5JA 2D9EA 5I1QA 3P1CA 5ENCA 5ENJA 4HBWA 5BT5A 4I7DA 5D1KB 1X4UA 5A5RA 5EPSA 2M3HA 4HXMA 5EISA 2VJEB 4NRCA 5F61A 4W4UA 5IGNA 4PCIA 2JMDA 3PURA 2DKWA 4LZRA 5EICA 2K17A 5TBNA 2VJFA 4A4CA 2RFJA 4QEWA 2G4AA 2YQMA 1IYMA 3EB6A 2L80A 5KTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFW A;  5FFY A;  1HYJ A;  4HXS A;  3KV6 A;  4UYH A;  5CUB A;  5FE9 A;  1RMD A;  2CKL A;  5A82 A;  1VYX A;  5G05 B;  5FE1 A;  2RS9 B;  4QUT A;  5D0C A;  1WEO A;  5FE2 A;  4YY4 A;  4LJN A;  2C2V S;  4LLB A;  4A9J A;  4LZS A;  5I29 A;  2RNW A;  5LJ0 A;  2KGI A;  2LV9 A;  3IU5 A;  3SVG A;  5CQ5 A;  4NR7 A;  3FKM X;  4IR4 A;  2YHN A;  4LRG A;  3KQI A;  2MD7 B;  5DBM A;  2ECV A;  5EYA F;  5DYU A;  2VNF A;  5I88 A;  2RNX A;  3LJW A;  4QF3 A;  5CUG A;  5DIN A;  3ZYQ A;  3I2D A;  2MNY A;  2E7O A;  5LKX A;  4YAX A;  5E7D A;  1WEP A;  4HBV A;  5EPR A;  5HEM A;  3N9P A;  4YYK A;  3RPG C;  5BT3 A;  2YRE A;  3VK6 A;  3UV5 A;  5I40 A;  4FO9 A;  5F1H A;  5C13 A;  2F6N A;  3UVW A;  4A9L A;  4NRB A;  5ETB A;  5J0D A;  4A9K A;  5I83 A;  2R0Y A;  4MR3 A;  4QST A;  5BT4 A;  5FE8 A;  5FDZ A;  5B76 A;  4S3O C;  2KIZ A;  2KWJ A;  3GL6 A;  4C67 A;  1JSP B;  5FE5 A;  5AIT A;  2KR4 A;  5FE0 A;  5F60 A;  5H85 A;  5E3G A;  5HM0 A;  4YYJ A;  2E6S A;  2YEK A;  5FB1 A;  2LQ6 A;  5D7X A;  4IC3 A;  2GRC A;  4QB3 A;  2JRJ A;  5E74 A;  3QZV A;  4AYC B;  5C87 A;  5L8T A;  5C85 A;  5IGM A;  2BAY A;  3T6R A;  4LYS A;  5LCW B;  3LQJ A;  3T7L A;  4QSR A;  5LKZ A;  4LDF A;  2D82 A;  3L1X A;  1WIM A;  2ECG A;  4TKP B;  4A9I A;  4O7A A;  3AQA A;  4J3I A;  5HRW A;  3MB3 A;  5FE6 A;  4UIZ A;  2KE1 A;  5CUD A;  4WA6 A;  4NQM A;  4XY8 A;  5F62 A;  2LN0 A;  2YEL A;  4AVX A;  4NR8 A;  3LQH A;  4R8P K;  2G43 A;  4NUD A;  2WP1 A;  5G0F A;  3ZNI A;  2H0D A;  3KV5 A;  3DWY A;  3RTR B;  5FEY A;  5EP7 A;  3O37 A;  1Z2Q A;  3SVH A;  2HYE D;  4NR9 A;  5FG6 A;  5CQ8 A;  2YHO A;  1E4U A;  2QJ0 A;  5L8U A;  1WEU A;  5D25 A;  5F25 A;  2L5U A;  4PY6 A;  5CFW A;  3UVX A;  2K4D A;  1FP0 A;  4LYI A;  2MA6 A;  2RI7 A;  4IR3 A;  4AKN A;  2AN6 A;  5C89 A;  2DX8 A;  5B78 A;  2LXH C;  4TU4 A;  5FFV A;  2ECJ A;  3FL2 A;  5AD2 A;  4QY4 A;  4TTE A;  5KH7 A;  3KNV A;  1ZBD B;  5CUE A;  4UYG A;  5LKT A;  5B77 A;  2LRI C;  4UP5 A;  2L85 A;  4O74 A;  5EU1 A;  3ZPV E;  4O7B A;  5FE3 A;  2LXP C;  2YYR A;  5H1U A;  2KWK A;  3O70 A;  4QSP A;  4QR4 A;  2Y1M A;  5D24 A;  4MEO A;  5E9I A;  3S92 A;  4CUQ A;  3UVY A;  4CLB A;  4UI9 B;  2YT5 A;  5I80 A;  5DKA A;  5A81 A;  1JM4 B;  3L11 A;  1VD4 A;  4N3W A;  3UV2 A;  4KCX A;  2L0B A;  5D1M B;  5KO4 A;  3ZYU A;  5A5S A;  4MEQ A;  4BJX A;  4OGI A;  3PUQ A;  4C9Z A;  4QSU A;  2DWW A;  4QUU A;  2UZG A;  5KTU A;  3O7A A;  5JWM A;  2FUI A;  3JVM A;  4NYW A;  5L96 A;  5LVR A;  1WEE A;  1Z60 A;  4XI1 A;  5EWC A;  4UIX A;  4CFK A;  4NRA A;  2E7N A;  2OO1 A;  4TT2 A;  5E9M A;  2VP7 A;  4UYF B;  4QNS A;  5F1L A;  5E9Y A;  4CUT A;  3JVJ A;  5A7C A;  4YYH A;  5F5Z A;  2F42 A;  2KU3 A;  3C5K A;  3N9Q A;  5TDW A;  4L7X A;  5CGP A;  3UVD A;  4GND A;  4O64 A;  2YQL A;  3S91 A;  4CUU A;  2KWN A;  5HCL A;  1WUG A;  3QZT A;  5EPB A;  1MM2 A;  4LAD B;  4PPE A;  3LRQ A;  5K29 A;  1WFK A;  4QSW A;  4PS5 A;  5D1L B;  5HRV A;  4HBX A;  4N4G A;  5H9M A;  4IC2 A;  2D8S A;  5TRB A;  4YAD A;  2RNY A;  1U6G B;  2YYN A;  3JVK A;  4HBY A;  5CUC A;  5LJ1 A;  3QZS A;  4O70 A;  3JVL A;  4O71 A;  2DVV A;  4QYL A;  5D3R A;  5ENB A;  2YEM A;  4UIY A;  4HXO A;  1LDJ B;  1JOC A;  2CSZ A;  4HXP A;  5CTL A;  4UIV A;  5A5N A;  3O34 A;  5D3N A;  4B7Y C;  2DVR A;  5EQ1 A;  1WEV A;  4NR4 A;  5EM3 A;  4E96 A;  5JI8 A;  2MNZ A;  1VFY A;  2ECI A;  4WZ3 B;  1WGM A;  4YBT A;  4TS8 A;  3U5K A;  1F68 A;  4J0R A;  4MEP A;  5B75 A;  4TYL A;  1JM7 A;  2R0S A;  5HQ6 A;  5IBN A;  5D3T A;  5ENG A;  3HME A;  4ZC9 A;  4HXR A;  2G45 A;  3ZTG A;  2VPE A;  3U5M A;  5A5P A;  5CQT A;  5LUU A;  5D3P A;  5DFD A;  2OUO A;  5DY7 A;  5A5O A;  1V87 A;  5B8D A;  1WIL A;  2E3K A;  5A83 A;  4UYE A;  3RCW A;  5G4S A;  1WEM A;  2VJE A;  5KU3 A;  5I3L A;  2MA5 A;  5DYA A;  4L58 A;  4LC2 A;  4Y03 A;  5LJ2 A;  4WIV A;  4A9H A;  3AAD A;  3SOX A;  2EOD A;  4NR6 A;  2EGP A;  2KFT A;  2YSM A;  2Y43 A;  5FER A;  4TT6 A;  5C4Q A;  5DKD A;  5HFQ A;  1X4J A;  4NR5 A;  4Z93 A;  4BW3 A;  1LDK C;  4GPJ A;  4UP0 A;  4CL9 A;  4AP4 A;  4QR3 A;  4A49 A;  3MQM A;  4F52 B;  4Q0O A;  4X3G A;  5KHM A;  4WHU A;  5TB6 A;  2PUY A;  3LQI A;  4KV4 A;  4NN2 A;  3RPG B;  2PNX A;  4J0S A;  4MR5 A;  5L99 A;  2JMI A;  1WES A;  5COI A;  2HDP A;  2QIZ A;  3P1F A;  5II1 A;  4IOQ A;  3K2J A;  4YH4 A;  3UV4 A;  1FBV A;  1T1H A;  1XWH A;  5CRZ A;  5CRM A;  2I50 A;  2KYU A;  2K1J A;  4Z1Q A;  2VJF B;  4GNF A;  4V3K C;  5C11 A;  3MHH A;  4GNE A;  5C8G A;  5A85 A;  1EQF A;  3TLP A;  3L1Z B;  4S3O B;  4ZUX U;  3IU6 A;  4YY6 A;  2JMJ A;  4HXL A;  1DVP A;  4XUB A;  2YW8 A;  4WZ2 A;  3P1D A;  3U5P A;  2CKL B;  4LZ2 A;  3HMH A;  2F6J A;  5L98 A;  5EWV A;  4YBM A;  5EVA A;  1MM3 A;  5DKH A;  1WUM A;  4NXJ A;  4Z6I A;  4TZ2 A;  5HEL A;  3N9M A;  2RO1 A;  4P5O B;  2QIC A;  4A9M A;  3M62 A;  5CQ7 A;  5FH8 A;  2EA6 A;  5EV9 A;  5TDR A;  3GV4 A;  5EK9 A;  4IOR A;  4TZ8 A;  4A9N A;  3G0J A;  3O33 A;  2FSA A;  3P5O A;  4UIT A;  2YUC A;  5G04 B;  5B79 A;  2M85 A;  3DPL R;  4PTB A;  1F62 A;  4C66 A;  5DW2 A;  5C7N A;  4Z6H A;  4YK0 A;  5CP5 A;  4UIU A;  2CSY A;  2FUU A;  2LGV A;  3IHP A;  4O7E A;  2MJV B;  5E9V A;  5E3D A;  4HXN A;  4YAB A;  4AYC A;  4J1P A;  4KV1 A;  4DON A;  4R7E A;  5CS8 A;  2ECW A;  2N9G A;  4YYN A;  3SHB A;  2KWO A;  5AIU A;  4LKA A;  4CUS A;  2ECN A;  2YUR A;  4QF2 A;  4BW4 A;  2MD8 C;  4YYD A;  4FIP A;  5IGK A;  2LSP B;  4XY9 A;  2E6R A;  5ENI A;  3N9O A;  5JG6 A;  5HLS A;  4LR6 A;  4UIW A;  3U5N A;  4A0C D;  4CUR A;  2RSD A;  3HCS A;  5TCM A;  2OXQ C;  4Z1S A;  4HXK A;  2MT5 A;  4QYD A;  3HCT A;  5DKC A;  5FB0 A;  5CPE A;  4TQN A;  5LVQ A;  5IID A;  5F36 A;  1WEQ A;  3MHS A;  5HEN A;  4NYV A;  5ENH A;  4IR6 A;  5DFB A;  4BHW A;  4LK9 A;  2L5E A;  4LYW A;  3MXF A;  5FE7 A;  5D3S A;  1X4I A;  4YYM A;  5FH6 A;  3M99 A;  4GNG A;  5AME A;  2L75 A;  4X2I A;  2KGG A;  3Q2F A;  2KRE A;  4QC3 A;  5CQ6 A;  2CT2 A;  1CHC A;  4CA1 A;  1N87 A;  5FG4 A;  1Z6U A;  4GB0 A;  5ENF A;  3DQV R;  4R2Y A;  4QBM A;  3D7C A;  5ENE A;  1G25 A;  3HCU A;  1ZS5 A;  2I8N A;  2R10 A;  3GG3 A;  4QC1 A;  5FG5 A;  1X0J A;  4O7F A;  5KH9 A;  2M6M A;  5F3A A;  2K16 A;  4Q6F A;  2H0D B;  5E9L A;  3DAI A;  3M63 A;  2ZET C;  3SOU A;  4MVT A;  2VPG A;  2DVQ A;  1E6I A;  3EB5 A;  3SVF A;  2L43 A;  3ZVY A;  4XUA A;  4ZW1 A;  5DYC A;  3MUL A;  3V43 A;  3PHD A;  4QSX A;  5HRX A;  5D3H A;  4A9E A;  2G6Q A;  5IGL A;  2L84 A;  2Y1N A;  4YH3 A;  5KH3 A;  2OSS A;  4QSS A;  5DX4 A;  3ZVZ B;  4TT4 A;  5AD3 A;  4O75 A;  4MSX A;  4FLP A;  4N4H A;  5EWH A;  5KTX A;  2YDW A;  4IR5 A;  3I3J A;  4UYD A;  4RVR A;  5D26 A;  5DFC A;  5L97 A;  4CFL A;  5DYX A;  4B86 C;  3NXB A;  5HQ7 A;  2DAT A;  4N4I A;  5IG6 A;  3HTK C;  4BW2 A;  4N4F A;  4TU6 A;  3O35 A;  4Q0N A;  5A5Q A;  4UYF A;  1BOR A;  2C2L A;  4AUQ B;  4FK5 A;  4NS5 A;  4MR6 A;  5EI4 A;  4QEV A;  2YSJ A;  5LKU A;  2IDA A;  4BBQ A;  4NQN A;  4ALH A;  5HFR A;  2NXB A;  3O36 A;  4YAT A;  4YBS A;  2M1R A;  2YU4 A;  4YC9 A;  5ETD A;  4MEN A;  5CU8 A;  4V3L C;  5E73 A;  2VPD A;  4O72 A;  4OGJ A;  3P1E A;  5AMF A;  3MB4 A;  3MUK A;  4NUE A;  4QSQ A;  4YYG A;  2LGL A;  3ASL A;  4IOO A;  4A4B A;  1WE9 A;  4ZDT A;  3N9N A;  5G4R A;  2VPB A;  4MR4 A;  5ACY A;  1WEN A;  5EWW A;  5FBX A;  4WHW A;  3UW9 A;  5EGU A;  4QR5 A;  4PKL A;  5FE4 A;  4NYX A;  5F63 A;  2I7K A;  1N72 A;  5H1T A;  5CQA A;  4BW1 A;  5J3X A;  4O77 A;  2WP2 A;  5F2P A;  5D3L A;  3ZPV 1;  3ONI A;  3U5L A;  4A9F A;  5DLX A;  4O7C A;  3U5O A;  5TAB A;  5EWD A;  4I7B A;  4QSV A;  5II2 A;  2LGK A;  3Q2E A;  4ZQL A;  5HQ5 A;  3SOW A;  3NG2 A;  5CZG A;  5DLZ A;  4FJC A;  4O76 A;  5CUA A;  2H60 A;  2R0V A;  5FH7 A;  1K2F A;  5CQ4 A;  5HJC A;  2ECT A;  1HYI A;  5EA1 A;  4YYI A;  3HMF A;  4PCE A;  4CUP A;  2LGG A;  2YW5 A;  2KTB B;  3G0L A;  2XEU A;  5I86 A;  2LDR A;  4OUF A;  5I7X A;  1WEW A;  3LXJ A;  2XB1 A;  2YQD A;  4QZS A;  4ALG A;  3N9L A;  4NUC A;  4CCG X;  5D3J A;  4F3I A;  2DVS A;  4XYA A;  5I7Y A;  2MUM A;  4QEU A;  4WZ0 A;  2NAA A;  5H1V A;  5I89 A;  4I7C A;  1JM7 B;  4A9O A;  5E9K A;  4O78 A;  5DW1 A;  3C6W A;  2MIQ A;  5CY9 A;  5CQ3 A;  5E0R A;  3U5J A;  2D9E A;  5I1Q A;  3P1C A;  5ENC A;  5ENJ A;  4HBW A;  5BT5 A;  4I7D A;  5D1K B;  1X4U A;  5A5R A;  5EPS A;  2M3H A;  4HXM A;  5EIS A;  2VJE B;  4NRC A;  5F61 A;  4W4U A;  5IGN A;  4PCI A;  2JMD A;  3PUR A;  2DKW A;  4LZR A;  5EIC A;  2K17 A;  5TBN A;  2VJF A;  4A4C A;  2RFJ A;  4QEW A;  2G4A A;  2YQM A;  1IYM A;  3EB6 A;  2L80 A;  5KTW A; 
#chains in the Genus database with same CATH topology
 5FFW A;  3E2D A;  5FFY A;  1HYJ A;  4HXS A;  3KV6 A;  4UYH A;  5CUB A;  5FE9 A;  1RMD A;  2CKL A;  5A82 A;  1VYX A;  2RR4 A;  5G05 B;  5FE1 A;  2RS9 B;  4QUT A;  5D0C A;  2XOY A;  1WEO A;  5FE2 A;  4YY4 A;  3FM8 C;  4LJN A;  2C2V S;  4LLB A;  4A9J A;  4LZS A;  5I29 A;  2RNW A;  5LJ0 A;  2KGI A;  3FAO A;  2LV9 A;  3IU5 A;  3SVG A;  5CQ5 A;  4NR7 A;  3FKM X;  4IR4 A;  2YHN A;  4LRG A;  3KQI A;  3LDY A;  2MD7 B;  5DBM A;  4Z0R A;  2ECV A;  5EYA F;  5DYU A;  2VNF A;  5I88 A;  2RNX A;  3LJW A;  4QF3 A;  3ERR A;  5CUG A;  5DIN A;  3ZYQ A;  3I2D A;  2MNY A;  2E7O A;  5LKX A;  4YAX A;  5E7D A;  1WEP A;  4HBV A;  5EPR A;  5HEM A;  3N9P A;  4YYK A;  3RPG C;  5BT3 A;  2YRE A;  3VK6 A;  3UV5 A;  5I40 A;  4FO9 A;  2E61 A;  5F1H A;  5C13 A;  2F6N A;  3UVW A;  4A9L A;  4NRB A;  5ETB A;  5J0D A;  4A9K A;  5I83 A;  2R0Y A;  4MR3 A;  4QST A;  5BT4 A;  5FE8 A;  5FDZ A;  5B76 A;  4S3O C;  2KIZ A;  2KWJ A;  3GL6 A;  4C67 A;  1JSP B;  5FE5 A;  5AIT A;  2KR4 A;  4OGC A;  5FE0 A;  5F60 A;  5H85 A;  5E3G A;  5HM0 A;  4YYJ A;  2E6S A;  2YEK A;  5FB1 A;  2LQ6 A;  5D7X A;  4IC3 A;  2CON A;  2GRC A;  1PUO A;  4QB3 A;  2JRJ A;  5E74 A;  3QZV A;  4AYC B;  5C87 A;  5L8T A;  5C85 A;  5IGM A;  2BAY A;  3T6R A;  4LYS A;  5LCW B;  3LQJ A;  3T7L A;  2XOC A;  4QSR A;  5LKZ A;  4LDF A;  2P57 A;  2D82 A;  3L1X A;  1WIM A;  2ECG A;  3FEH A;  4TKP B;  4A9I A;  4O7A A;  3AQA A;  4J3I A;  5HRW A;  3MB3 A;  5FE6 A;  3D1D A;  4UIZ A;  2KE1 A;  5CUD A;  4WA6 A;  4NQM A;  4XY8 A;  5F62 A;  2LN0 A;  2YEL A;  4AVX A;  4NR8 A;  3LQH A;  4R8P K;  2G43 A;  4NUD A;  2WP1 A;  5G0F A;  3ZNI A;  2H0D A;  3KV5 A;  3DWY A;  3RTR B;  5FEY A;  5EP7 A;  3O37 A;  1Z2Q A;  3SVH A;  2HYE D;  4NR9 A;  5FG6 A;  5CQ8 A;  2YHO A;  1E4U A;  2QJ0 A;  5L8U A;  1WEU A;  5D25 A;  5F25 A;  2L5U A;  4PY6 A;  5CFW A;  3UVX A;  2K4D A;  1FP0 A;  4LYI A;  2MA6 A;  2RI7 A;  3FAN A;  4IR3 A;  4AKN A;  2AN6 A;  5C89 A;  2DX8 A;  2JM3 A;  2LXH C;  5B78 A;  4TU4 A;  5FFV A;  2ECJ A;  3FL2 A;  5AD2 A;  4QY4 A;  4TTE A;  5KH7 A;  3KNV A;  1ZBD B;  5CUE A;  4UYG A;  5LKT A;  5B77 A;  2LRI C;  4UP5 A;  2L85 A;  4O74 A;  5EU1 A;  3ZPV E;  4O7B A;  5FE3 A;  2LXP C;  2YYR A;  5H1U A;  2KWK A;  2YVR A;  3O70 A;  5SVX A;  4QSP A;  4QR4 A;  2Y1M A;  5D24 A;  5K3Q A;  4MEO A;  5E9I A;  3S92 A;  4CUQ A;  3UVY A;  4CLB A;  4UI9 B;  2YT5 A;  5I80 A;  2EXU A;  5DKA A;  5A81 A;  1JM4 B;  3L11 A;  1VD4 A;  4N3W A;  3UV2 A;  4KCX A;  2L0B A;  5D1M B;  5KO4 A;  2KKX A;  3ZYU A;  5A5S A;  4MEQ A;  4BJX A;  4OGI A;  3PUQ A;  4C9Z A;  4QSU A;  2EGM A;  2DWW A;  4QUU A;  2UZG A;  5KTU A;  3O7A A;  5JWM A;  2FUI A;  3JVM A;  4NYW A;  5L96 A;  5LVR A;  1WEE A;  1Z60 A;  4XI1 A;  5EWC A;  4UIX A;  1MBM A;  4CFK A;  4NRA A;  2E7N A;  2OO1 A;  4TT2 A;  5E9M A;  2VP7 A;  4UYF B;  4QNS A;  5F1L A;  5E9Y A;  4CUT A;  3JVJ A;  5A7C A;  4YYH A;  5F5Z A;  2F42 A;  2KU3 A;  3C5K A;  3N9Q A;  5SVI A;  2CSV A;  5TDW A;  4L7X A;  5CGP A;  3UVD A;  4GND A;  4O64 A;  2YQL A;  3S91 A;  4CUU A;  2KWN A;  5HCL A;  1WUG A;  3QZT A;  5EPB A;  1MM2 A;  2D8U A;  4LAD B;  3LRQ A;  4PPE A;  5K29 A;  1WFK A;  4QSW A;  4PS5 A;  5D1L B;  5HRV A;  4HBX A;  4N4G A;  5H9M A;  4IC2 A;  2D8S A;  5TRB A;  4YAD A;  2RNY A;  1U6G B;  2YYN A;  3JVK A;  4HBY A;  5CUC A;  5LJ1 A;  3QZS A;  4O70 A;  3JVL A;  4O71 A;  2DVV A;  4QYL A;  5D3R A;  5ENB A;  2YEM A;  4UIY A;  4HXO A;  1LDJ B;  1JOC A;  2CSZ A;  4HXP A;  5CTL A;  4UIV A;  5A5N A;  3O34 A;  5D3N A;  4B7Y C;  2DVR A;  5EQ1 A;  1WEV A;  4NR4 A;  5EM3 A;  4E96 A;  5JI8 A;  2DSM A;  2MNZ A;  1ZKR A;  1VFY A;  2ECI A;  4WZ3 B;  1WGM A;  4YBT A;  4TS8 A;  3U5K A;  1F68 A;  4J0R A;  4MEP A;  4QQ4 A;  4TYL A;  5B75 A;  1JM7 A;  2R0S A;  5HQ6 A;  5IBN A;  5D3T A;  5ENG A;  3HME A;  4ZC9 A;  4HXR A;  2G45 A;  3ZTG A;  2VPE A;  3U5M A;  5A5P A;  5CQT A;  5LUU A;  5D3P A;  5DFD A;  2OUO A;  5DY7 A;  5A5O A;  1V87 A;  3JUE A;  5B8D A;  1WIL A;  2E3K A;  3M7K A;  5A83 A;  4UYE A;  3RCW A;  5G4S A;  3VKG A;  1WEM A;  2VJE A;  2EJN A;  5KU3 A;  5I3L A;  2MA5 A;  5DYA A;  4L58 A;  4LC2 A;  4Y03 A;  5LJ2 A;  4WIV A;  4A9H A;  3AAD A;  3SOX A;  2EOD A;  4NR6 A;  2OWA A;  2EGP A;  2KFT A;  2YSM A;  2Y43 A;  5FER A;  4TT6 A;  5C4Q A;  5DKD A;  5HFQ A;  1X4J A;  5SVY A;  4NR5 A;  4Z93 A;  4BW3 A;  4O62 A;  1LDK C;  4GPJ A;  4UP0 A;  4CL9 A;  4AP4 A;  4QR3 A;  4A49 A;  3MQM A;  4F52 B;  4Q0O A;  4X3G A;  5KHM A;  4WHU A;  5TB6 A;  2PUY A;  3DDT A;  3LQI A;  4KV4 A;  4NN2 A;  3RPG B;  2PNX A;  4J0S A;  4MR5 A;  5L99 A;  2JMI A;  1WES A;  5COI A;  2HDP A;  2QIZ A;  3P1F A;  5II1 A;  4IOQ A;  3K2J A;  4YH4 A;  3UV4 A;  1FBV A;  1T1H A;  1XWH A;  5CRZ A;  5CRM A;  2I50 A;  2KYU A;  2K1J A;  3SUB A;  4Z1Q A;  2VJF B;  3VKH A;  4GNF A;  4V3K C;  5C11 A;  3MHH A;  4GNE A;  5C8G A;  5A85 A;  1EQF A;  3TLP A;  3L1Z B;  4S3O B;  4ZUX U;  3IU6 A;  4YY6 A;  2IQJ A;  2JMJ A;  4HXL A;  1DVP A;  4XUB A;  2YW8 A;  4WZ2 A;  3PLW A;  3P1D A;  3U5P A;  2CKL B;  4LZ2 A;  3HMH A;  2F6J A;  5L98 A;  5EWV A;  3FJU B;  4YBM A;  5EVA A;  1MM3 A;  5DKH A;  1WUM A;  4NXJ A;  4Z6I A;  4TZ2 A;  5HEL A;  3N9M A;  2RO1 A;  4P5O B;  2QIC A;  4A9M A;  3O47 A;  3M62 A;  5CQ7 A;  5FH8 A;  2EA6 A;  5EV9 A;  5TDR A;  4AKH A;  2L7P A;  3GV4 A;  5EK9 A;  4IOR A;  2FFW A;  4TZ8 A;  4A9N A;  3G0J A;  3O33 A;  2FSA A;  3P5O A;  4UIT A;  2YUC A;  2JUN A;  5G04 B;  5B79 A;  2M85 A;  3DPL R;  4PTB A;  1F62 A;  4C66 A;  5DW2 A;  5C7N A;  4Z6H A;  4YK0 A;  5CP5 A;  4UIU A;  2CSY A;  2FUU A;  2LGV A;  3IHP A;  4O7E A;  2MJV B;  5E9V A;  5E3D A;  4HXN A;  4YAB A;  4AYC A;  4J1P A;  4KV1 A;  4DON A;  4R7E A;  5CS8 A;  2ECW A;  2N9G A;  4YYN A;  3SHB A;  2KWO A;  5AIU A;  4LKA A;  4CUS A;  2CRW A;  2ECN A;  2YUR A;  4BW4 A;  4QF2 A;  2MD8 C;  4YYD A;  4FIP A;  5IGK A;  2LSP B;  4XY9 A;  2E6R A;  5ENI A;  3N9O A;  5JG6 A;  5HLS A;  3LJU X;  4AKI A;  4LR6 A;  4UIW A;  3U5N A;  4A0C D;  4CUR A;  2RSD A;  3HCS A;  5TCM A;  2OXQ C;  4Z1S A;  4HXK A;  2MT5 A;  4QYD A;  3HCT A;  5DKC A;  5FB0 A;  5CPE A;  4TQN A;  5LVQ A;  4H9D A;  5IID A;  5F36 A;  1WEQ A;  3MHS A;  5HEN A;  4NYV A;  5ENH A;  4IR6 A;  5DFB A;  4BHW A;  4LK9 A;  2L5E A;  4LYW A;  3MXF A;  3D1B A;  5D3S A;  5FE7 A;  1X4I A;  4YYM A;  5FH6 A;  3M99 A;  4GNG A;  5AME A;  2L75 A;  4X2I A;  2KGG A;  3Q2F A;  2KRE A;  4QC3 A;  5CQ6 A;  2CT2 A;  1CHC A;  3LVQ E;  4CA1 A;  1N87 A;  5FG4 A;  1Z6U A;  4GB0 A;  5ENF A;  3DQV R;  4R2Y A;  4QBM A;  3T9K A;  3D7C A;  5ENE A;  1G25 A;  3HCU A;  1ZS5 A;  2I8N A;  2R10 A;  3GG3 A;  4QC1 A;  5FG5 A;  1X0J A;  4O7F A;  5KH9 A;  2M6M A;  5F3A A;  2K16 A;  4Q6F A;  2H0D B;  5E9L A;  3DAI A;  3M63 A;  2ZET C;  4OGE A;  3SOU A;  4MVT A;  2VPG A;  2DVQ A;  1E6I A;  3EB5 A;  3SVF A;  2L43 A;  3ZVY A;  4XUA A;  4ZW1 A;  5DYC A;  3MUL A;  3V43 A;  3PHD A;  4QSX A;  5HRX A;  5D3H A;  4A9E A;  2G6Q A;  5IGL A;  2L84 A;  2Y1N A;  4YH3 A;  5KH3 A;  3H7H A;  2OSS A;  4QSS A;  5DX4 A;  3ZVZ B;  4TT4 A;  5AD3 A;  4O75 A;  4MSX A;  4FLP A;  4N4H A;  5EWH A;  5KTX A;  2YDW A;  4IR5 A;  3I3J A;  4UYD A;  4RVR A;  5D26 A;  5DFC A;  5L97 A;  4CFL A;  2B0O E;  5DYX A;  2M13 A;  2XOZ A;  4B86 C;  3NXB A;  5HQ7 A;  2LAU A;  2DAT A;  4N4I A;  5IG6 A;  3HTK C;  4BW2 A;  4N4F A;  4TU6 A;  3O35 A;  4Q0N A;  5A5Q A;  4UYF A;  1BOR A;  2C2L A;  4AUQ B;  4FK5 A;  4NS5 A;  4MR6 A;  5EI4 A;  4QEV A;  2YSJ A;  5LKU A;  2IDA A;  4BBQ A;  2CRR A;  4NQN A;  4ALH A;  5HFR A;  2NXB A;  3O36 A;  4YAT A;  4YBS A;  2M1R A;  2MKE A;  2YU4 A;  4YC9 A;  5ETD A;  4MEN A;  5CU8 A;  2DJA A;  4V3L C;  5E73 A;  2VPD A;  4O72 A;  4OGJ A;  3P1E A;  5AMF A;  3MB4 A;  3MUK A;  4NUE A;  4QSQ A;  4YYG A;  2LGL A;  3ASL A;  4IOO A;  4A4B A;  1WE9 A;  4ZDT A;  3N9N A;  5G4R A;  4F1P A;  2VPB A;  4MR4 A;  5ACY A;  2FD4 A;  1WEN A;  5EWW A;  5FBX A;  4WHW A;  3UW9 A;  5EGU A;  4QR5 A;  4PKL A;  5FE4 A;  4NYX A;  3KDE C;  5F63 A;  2I7K A;  1N72 A;  5H1T A;  5CQA A;  4BW1 A;  5J3X A;  4O77 A;  2WP2 A;  5F2P A;  5D3L A;  5SVI B;  3ONI A;  3ZPV 1;  3U5L A;  4A9F A;  5DLX A;  4O7C A;  3U5O A;  1DCQ A;  4AI6 A;  5TAB A;  5EWD A;  4I7B A;  3DWD A;  4QSV A;  5II2 A;  2LGK A;  3Q2E A;  4ZQL A;  5HQ5 A;  3SOW A;  3NG2 A;  5CZG A;  2XP0 A;  5DLZ A;  4FJC A;  4O76 A;  5CUA A;  2H60 A;  2R0V A;  5FH7 A;  1K2F A;  5CQ4 A;  5HJC A;  2ECT A;  1HYI A;  5EA1 A;  4YYI A;  3HMF A;  4PCE A;  4CUP A;  2LGG A;  2YW5 A;  4Z0O A;  2KTB B;  3G0L A;  2XEU A;  5I86 A;  2LDR A;  4OUF A;  5I7X A;  1WEW A;  3LXJ A;  2XB1 A;  2YQD A;  4QZS A;  4ALG A;  3N9L A;  4NUC A;  4CCG X;  5D3J A;  4F3I A;  2DVS A;  4XYA A;  5I7Y A;  2MUM A;  4QEU A;  4WZ0 A;  2NAA A;  5H1V A;  5I89 A;  4I7C A;  1JM7 B;  4A9O A;  5E9K A;  4O78 A;  5DW1 A;  2KKY A;  3C6W A;  2MIQ A;  5CY9 A;  5CQ3 A;  5E0R A;  3U5J A;  2D9E A;  5I1Q A;  3P1C A;  5ENC A;  5ENJ A;  3LVR E;  4HBW A;  5BT5 A;  4I7D A;  5D1K B;  1X4U A;  5A5R A;  3MDB C;  5EPS A;  2M3H A;  4HXM A;  5EIS A;  2VJE B;  4NRC A;  5F61 A;  4W4U A;  5IGN A;  4PCI A;  2JMD A;  3PUR A;  2DKW A;  4LZR A;  5EIC A;  2K17 A;  5TBN A;  2VJF A;  4A4C A;  3Q1D A;  2RFJ A;  4QEW A;  2G4A A;  2YQM A;  1IYM A;  4AKG A;  3EB6 A;  2L80 A;  5KTW A; 
#chains in the Genus database with same CATH homology
 5FFW A;  5FFY A;  1HYJ A;  4HXS A;  3KV6 A;  4UYH A;  5CUB A;  5FE9 A;  1RMD A;  2CKL A;  5A82 A;  1VYX A;  5G05 B;  5FE1 A;  2RS9 B;  4QUT A;  5D0C A;  1WEO A;  5FE2 A;  4YY4 A;  4LJN A;  2C2V S;  4LLB A;  4A9J A;  4LZS A;  5I29 A;  2RNW A;  5LJ0 A;  2KGI A;  2LV9 A;  3IU5 A;  3SVG A;  5CQ5 A;  4NR7 A;  3FKM X;  4IR4 A;  2YHN A;  4LRG A;  3KQI A;  2MD7 B;  5DBM A;  2ECV A;  5EYA F;  5DYU A;  2VNF A;  5I88 A;  2RNX A;  3LJW A;  4QF3 A;  5CUG A;  5DIN A;  3ZYQ A;  3I2D A;  2MNY A;  2E7O A;  5LKX A;  4YAX A;  5E7D A;  1WEP A;  4HBV A;  5EPR A;  5HEM A;  3N9P A;  4YYK A;  3RPG C;  5BT3 A;  2YRE A;  3VK6 A;  3UV5 A;  5I40 A;  4FO9 A;  5F1H A;  5C13 A;  2F6N A;  3UVW A;  4A9L A;  4NRB A;  5ETB A;  5J0D A;  4A9K A;  5I83 A;  2R0Y A;  4MR3 A;  4QST A;  5BT4 A;  5FE8 A;  5FDZ A;  5B76 A;  4S3O C;  2KIZ A;  2KWJ A;  3GL6 A;  4C67 A;  1JSP B;  5FE5 A;  5AIT A;  2KR4 A;  5FE0 A;  5F60 A;  5H85 A;  5E3G A;  5HM0 A;  4YYJ A;  2E6S A;  2YEK A;  5FB1 A;  2LQ6 A;  5D7X A;  4IC3 A;  2GRC A;  4QB3 A;  2JRJ A;  5E74 A;  3QZV A;  4AYC B;  5C87 A;  5L8T A;  5C85 A;  5IGM A;  2BAY A;  3T6R A;  4LYS A;  5LCW B;  3LQJ A;  3T7L A;  4QSR A;  5LKZ A;  4LDF A;  2D82 A;  3L1X A;  1WIM A;  2ECG A;  4TKP B;  4A9I A;  4O7A A;  3AQA A;  4J3I A;  5HRW A;  3MB3 A;  5FE6 A;  4UIZ A;  2KE1 A;  5CUD A;  4WA6 A;  4NQM A;  4XY8 A;  5F62 A;  2LN0 A;  2YEL A;  4AVX A;  4NR8 A;  3LQH A;  4R8P K;  2G43 A;  4NUD A;  2WP1 A;  5G0F A;  3ZNI A;  2H0D A;  3KV5 A;  3DWY A;  3RTR B;  5FEY A;  5EP7 A;  3O37 A;  1Z2Q A;  3SVH A;  2HYE D;  4NR9 A;  5FG6 A;  5CQ8 A;  2YHO A;  1E4U A;  2QJ0 A;  5L8U A;  1WEU A;  5D25 A;  5F25 A;  2L5U A;  4PY6 A;  5CFW A;  3UVX A;  2K4D A;  1FP0 A;  4LYI A;  2MA6 A;  2RI7 A;  4IR3 A;  4AKN A;  2AN6 A;  5C89 A;  2DX8 A;  5B78 A;  2LXH C;  4TU4 A;  5FFV A;  2ECJ A;  3FL2 A;  5AD2 A;  4QY4 A;  4TTE A;  5KH7 A;  3KNV A;  1ZBD B;  5CUE A;  4UYG A;  5LKT A;  5B77 A;  2LRI C;  4UP5 A;  2L85 A;  4O74 A;  5EU1 A;  3ZPV E;  4O7B A;  5FE3 A;  2LXP C;  2YYR A;  5H1U A;  2KWK A;  3O70 A;  4QSP A;  4QR4 A;  2Y1M A;  5D24 A;  4MEO A;  5E9I A;  3S92 A;  4CUQ A;  3UVY A;  4CLB A;  4UI9 B;  2YT5 A;  5I80 A;  5DKA A;  5A81 A;  1JM4 B;  3L11 A;  1VD4 A;  4N3W A;  3UV2 A;  4KCX A;  2L0B A;  5D1M B;  5KO4 A;  3ZYU A;  5A5S A;  4MEQ A;  4BJX A;  4OGI A;  3PUQ A;  4C9Z A;  4QSU A;  2DWW A;  4QUU A;  2UZG A;  5KTU A;  3O7A A;  5JWM A;  2FUI A;  3JVM A;  4NYW A;  5L96 A;  5LVR A;  1WEE A;  1Z60 A;  4XI1 A;  5EWC A;  4UIX A;  4CFK A;  4NRA A;  2E7N A;  2OO1 A;  4TT2 A;  5E9M A;  2VP7 A;  4UYF B;  4QNS A;  5F1L A;  5E9Y A;  4CUT A;  3JVJ A;  5A7C A;  4YYH A;  5F5Z A;  2F42 A;  2KU3 A;  3C5K A;  3N9Q A;  5TDW A;  4L7X A;  5CGP A;  3UVD A;  4GND A;  4O64 A;  2YQL A;  3S91 A;  4CUU A;  2KWN A;  5HCL A;  1WUG A;  3QZT A;  5EPB A;  1MM2 A;  4LAD B;  4PPE A;  3LRQ A;  5K29 A;  1WFK A;  4QSW A;  4PS5 A;  5D1L B;  5HRV A;  4HBX A;  4N4G A;  5H9M A;  4IC2 A;  2D8S A;  5TRB A;  4YAD A;  2RNY A;  1U6G B;  2YYN A;  3JVK A;  4HBY A;  5CUC A;  5LJ1 A;  3QZS A;  4O70 A;  3JVL A;  4O71 A;  2DVV A;  4QYL A;  5D3R A;  5ENB A;  2YEM A;  4UIY A;  4HXO A;  1LDJ B;  1JOC A;  2CSZ A;  4HXP A;  5CTL A;  4UIV A;  5A5N A;  3O34 A;  5D3N A;  4B7Y C;  2DVR A;  5EQ1 A;  1WEV A;  4NR4 A;  5EM3 A;  4E96 A;  5JI8 A;  2MNZ A;  1VFY A;  2ECI A;  4WZ3 B;  1WGM A;  4YBT A;  4TS8 A;  3U5K A;  1F68 A;  4J0R A;  4MEP A;  5B75 A;  4TYL A;  1JM7 A;  2R0S A;  5HQ6 A;  5IBN A;  5D3T A;  5ENG A;  3HME A;  4ZC9 A;  4HXR A;  2G45 A;  3ZTG A;  2VPE A;  3U5M A;  5A5P A;  5CQT A;  5LUU A;  5D3P A;  5DFD A;  2OUO A;  5DY7 A;  5A5O A;  1V87 A;  5B8D A;  1WIL A;  2E3K A;  5A83 A;  4UYE A;  3RCW A;  5G4S A;  1WEM A;  2VJE A;  5KU3 A;  5I3L A;  2MA5 A;  5DYA A;  4L58 A;  4LC2 A;  4Y03 A;  5LJ2 A;  4WIV A;  4A9H A;  3AAD A;  3SOX A;  2EOD A;  4NR6 A;  2EGP A;  2KFT A;  2YSM A;  2Y43 A;  5FER A;  4TT6 A;  5C4Q A;  5DKD A;  5HFQ A;  1X4J A;  4NR5 A;  4Z93 A;  4BW3 A;  1LDK C;  4GPJ A;  4UP0 A;  4CL9 A;  4AP4 A;  4QR3 A;  4A49 A;  3MQM A;  4F52 B;  4Q0O A;  4X3G A;  5KHM A;  4WHU A;  5TB6 A;  2PUY A;  3LQI A;  4KV4 A;  4NN2 A;  3RPG B;  2PNX A;  4J0S A;  4MR5 A;  5L99 A;  2JMI A;  1WES A;  5COI A;  2HDP A;  2QIZ A;  3P1F A;  5II1 A;  4IOQ A;  3K2J A;  4YH4 A;  3UV4 A;  1FBV A;  1T1H A;  1XWH A;  5CRZ A;  5CRM A;  2I50 A;  2KYU A;  2K1J A;  4Z1Q A;  2VJF B;  4GNF A;  4V3K C;  5C11 A;  3MHH A;  4GNE A;  5C8G A;  5A85 A;  1EQF A;  3TLP A;  3L1Z B;  4S3O B;  4ZUX U;  3IU6 A;  4YY6 A;  2JMJ A;  4HXL A;  1DVP A;  4XUB A;  2YW8 A;  4WZ2 A;  3P1D A;  3U5P A;  2CKL B;  4LZ2 A;  3HMH A;  2F6J A;  5L98 A;  5EWV A;  4YBM A;  5EVA A;  1MM3 A;  5DKH A;  1WUM A;  4NXJ A;  4Z6I A;  4TZ2 A;  5HEL A;  3N9M A;  2RO1 A;  4P5O B;  2QIC A;  4A9M A;  3M62 A;  5CQ7 A;  5FH8 A;  2EA6 A;  5EV9 A;  5TDR A;  3GV4 A;  5EK9 A;  4IOR A;  4TZ8 A;  4A9N A;  3G0J A;  3O33 A;  2FSA A;  3P5O A;  4UIT A;  2YUC A;  5G04 B;  5B79 A;  2M85 A;  3DPL R;  4PTB A;  1F62 A;  4C66 A;  5DW2 A;  5C7N A;  4Z6H A;  4YK0 A;  5CP5 A;  4UIU A;  2CSY A;  2FUU A;  2LGV A;  3IHP A;  4O7E A;  2MJV B;  5E9V A;  5E3D A;  4HXN A;  4YAB A;  4AYC A;  4J1P A;  4KV1 A;  4DON A;  4R7E A;  5CS8 A;  2ECW A;  2N9G A;  4YYN A;  3SHB A;  2KWO A;  5AIU A;  4LKA A;  4CUS A;  2ECN A;  2YUR A;  4QF2 A;  4BW4 A;  2MD8 C;  4YYD A;  4FIP A;  5IGK A;  2LSP B;  4XY9 A;  2E6R A;  5ENI A;  3N9O A;  5JG6 A;  5HLS A;  4LR6 A;  4UIW A;  3U5N A;  4A0C D;  4CUR A;  2RSD A;  3HCS A;  5TCM A;  2OXQ C;  4Z1S A;  4HXK A;  2MT5 A;  4QYD A;  3HCT A;  5DKC A;  5FB0 A;  5CPE A;  4TQN A;  5LVQ A;  5IID A;  5F36 A;  1WEQ A;  3MHS A;  5HEN A;  4NYV A;  5ENH A;  4IR6 A;  5DFB A;  4BHW A;  4LK9 A;  2L5E A;  4LYW A;  3MXF A;  5FE7 A;  5D3S A;  1X4I A;  4YYM A;  5FH6 A;  3M99 A;  4GNG A;  5AME A;  2L75 A;  4X2I A;  2KGG A;  3Q2F A;  2KRE A;  4QC3 A;  5CQ6 A;  2CT2 A;  1CHC A;  4CA1 A;  1N87 A;  5FG4 A;  1Z6U A;  4GB0 A;  5ENF A;  3DQV R;  4R2Y A;  4QBM A;  3D7C A;  5ENE A;  1G25 A;  3HCU A;  1ZS5 A;  2I8N A;  2R10 A;  3GG3 A;  4QC1 A;  5FG5 A;  1X0J A;  4O7F A;  5KH9 A;  2M6M A;  5F3A A;  2K16 A;  4Q6F A;  2H0D B;  5E9L A;  3DAI A;  3M63 A;  2ZET C;  3SOU A;  4MVT A;  2VPG A;  2DVQ A;  1E6I A;  3EB5 A;  3SVF A;  2L43 A;  3ZVY A;  4XUA A;  4ZW1 A;  5DYC A;  3MUL A;  3V43 A;  3PHD A;  4QSX A;  5HRX A;  5D3H A;  4A9E A;  2G6Q A;  5IGL A;  2L84 A;  2Y1N A;  4YH3 A;  5KH3 A;  2OSS A;  4QSS A;  5DX4 A;  3ZVZ B;  4TT4 A;  5AD3 A;  4O75 A;  4MSX A;  4FLP A;  4N4H A;  5EWH A;  5KTX A;  2YDW A;  4IR5 A;  3I3J A;  4UYD A;  4RVR A;  5D26 A;  5DFC A;  5L97 A;  4CFL A;  5DYX A;  4B86 C;  3NXB A;  5HQ7 A;  2DAT A;  4N4I A;  5IG6 A;  3HTK C;  4BW2 A;  4N4F A;  4TU6 A;  3O35 A;  4Q0N A;  5A5Q A;  4UYF A;  1BOR A;  2C2L A;  4AUQ B;  4FK5 A;  4NS5 A;  4MR6 A;  5EI4 A;  4QEV A;  2YSJ A;  5LKU A;  2IDA A;  4BBQ A;  4NQN A;  4ALH A;  5HFR A;  2NXB A;  3O36 A;  4YAT A;  4YBS A;  2M1R A;  2YU4 A;  4YC9 A;  5ETD A;  4MEN A;  5CU8 A;  4V3L C;  5E73 A;  2VPD A;  4O72 A;  4OGJ A;  3P1E A;  5AMF A;  3MB4 A;  3MUK A;  4NUE A;  4QSQ A;  4YYG A;  2LGL A;  3ASL A;  4IOO A;  4A4B A;  1WE9 A;  4ZDT A;  3N9N A;  5G4R A;  2VPB A;  4MR4 A;  5ACY A;  1WEN A;  5EWW A;  5FBX A;  4WHW A;  3UW9 A;  5EGU A;  4QR5 A;  4PKL A;  5FE4 A;  4NYX A;  5F63 A;  2I7K A;  1N72 A;  5H1T A;  5CQA A;  4BW1 A;  5J3X A;  4O77 A;  2WP2 A;  5F2P A;  5D3L A;  3ZPV 1;  3ONI A;  3U5L A;  4A9F A;  5DLX A;  4O7C A;  3U5O A;  5TAB A;  5EWD A;  4I7B A;  4QSV A;  5II2 A;  2LGK A;  3Q2E A;  4ZQL A;  5HQ5 A;  3SOW A;  3NG2 A;  5CZG A;  5DLZ A;  4FJC A;  4O76 A;  5CUA A;  2H60 A;  2R0V A;  5FH7 A;  1K2F A;  5CQ4 A;  5HJC A;  2ECT A;  1HYI A;  5EA1 A;  4YYI A;  3HMF A;  4PCE A;  4CUP A;  2LGG A;  2YW5 A;  2KTB B;  3G0L A;  2XEU A;  5I86 A;  2LDR A;  4OUF A;  5I7X A;  1WEW A;  3LXJ A;  2XB1 A;  2YQD A;  4QZS A;  4ALG A;  3N9L A;  4NUC A;  4CCG X;  5D3J A;  4F3I A;  2DVS A;  4XYA A;  5I7Y A;  2MUM A;  4QEU A;  4WZ0 A;  2NAA A;  5H1V A;  5I89 A;  4I7C A;  1JM7 B;  4A9O A;  5E9K A;  4O78 A;  5DW1 A;  3C6W A;  2MIQ A;  5CY9 A;  5CQ3 A;  5E0R A;  3U5J A;  2D9E A;  5I1Q A;  3P1C A;  5ENC A;  5ENJ A;  4HBW A;  5BT5 A;  4I7D A;  5D1K B;  1X4U A;  5A5R A;  5EPS A;  2M3H A;  4HXM A;  5EIS A;  2VJE B;  4NRC A;  5F61 A;  4W4U A;  5IGN A;  4PCI A;  2JMD A;  3PUR A;  2DKW A;  4LZR A;  5EIC A;  2K17 A;  5TBN A;  2VJF A;  4A4C A;  2RFJ A;  4QEW A;  2G4A A;  2YQM A;  1IYM A;  3EB6 A;  2L80 A;  5KTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...