4YBMA

Crystal structure of trim24 phd-bromodomain complexed with n-{6-[3-(benzyloxy)phenoxy]-1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl}-3,4-dimethoxybenzene-1-sulfonamide (7b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
177
Chain Sequence
b'PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 52
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ybmA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ybmA01
4FLPA 5DYXA 3I2DA 5C89A 3KV5A 2MJVB 2WP2A 4TS8A 1MM3A 3P1FA 3O36A 5F1LA 3G0LA 2DX8A 5D3LA 2FUUA 1JOCA 4A9FA 5D24A 2ECIA 5D26A 5CY9A 2ECGA 4A9OA 4ZC9A 3U5LA 5EICA 4YYKA 5TDRA 4YY6A 4A9JA 3PURA 2G6QA 1LDKC 2VPBA 5LUUA 4LJNA 4UP0A 5FE9A 4ALGA 5IGMA 5CP5A 5EVAA 5KTUA 1VYXA 5EK9A 4PS5A 5EWDA 4WHUA 5DBMA 5KH3A 1WEOA 5HRWA 5CQ8A 2VJEB 5AMFA 5CQ5A 5B76A 2ECNA 4CUQA 4B7YC 2OO1A 5FFYA 4O75A 4PCEA 4GB0A 4NR6A 4MR3A 3RPGB 4CA1A 1F68A 4NRCA 5E74A 5LKUA 1WEPA 5D1MB 4UIYA 5EPRA 4Q0OA 4TKPB 2VP7A 4J1PA 1F62A 4OUFA 4O71A 2OXQC 4O64A 2R0SA 3Q2EA 4YATA 5F2PA 4A9EA 3NG2A 4LLBA 5CGPA 4UIWA 1FBVA 2LN0A 5EWVA 4KV4A 2G45A 2JMDA 5C85A 5I7YA 5DYCA 4I7BA 5D3RA 4I7CA 5DKHA 4NQMA 5I40A 3N9MA 5J3XA 2QIZA 3DPLR 1G25A 3PUQA 5HEMA 3N9PA 5DINA 5FFWA 1LDJB 4CCGX 5H1UA 4LYSA 4FO9A 2Y43A 3P1DA 4NR9A 4QSWA 3C6WA 4QEWA 3RTRB 5A82A 2E6RA 5TDWA 5IGNA 3N9NA 5EU1A 5HRXA 4WZ0A 1WUGA 3DAIA 4A0CD 2RNYA 5TBNA 5LJ0A 5HRVA 2G4AA 4A9LA 3M99A 5LJ2A 3UV4A 2LGLA 3QZVA 4HBVA 2KWJA 3L1ZB 5LJ1A 1CHCA 4HBXA 4IOQA 5AD3A 4YABA 5F5ZA 5A5OA 4LRGA 2NAAA 2I7KA 3C5KA 4Z93A 5FE8A 4O76A 5CU8A 4Q6FA 5EM3A 4QSVA 4FK5A 4QBMA 4LZRA 5CFWA 2C2VS 2YQLA 4X3GA 5DLZA 5LVRA 3ZNIA 3JVJA 5DKAA 2RNWA 1U6GB 2MA5A 2YEMA 4TU4A 5HENA 5B79A 2ZETC 2LGKA 5A5SA 4A9IA 3M63A 4A4CA 2E6SA 5B75A 4QYDA 4C9ZA 3MULA 5D3NA 2D8SA 2MT5A 3O35A 4WIVA 3V43A 2L43A 1JM7A 4O78A 5DKCA 4XY8A 5F60A 4O77A 4N4IA 5I83A 4NR4A 5CUGA 5FE5A 4XY9A 4LYIA 4HXNA 4BW1A 5I80A 4LR6A 4O7BA 5FE4A 5ENHA 4BJXA 5KH9A 5H85A 5CRMA 5LKZA 5D1LB 1XWHA 2RSDA 2VJFB 5A5QA 2JMIA 4YYJA 4UITA 1FP0A 4X2IA 4UYDA 5FFVA 2YREA 5FE3A 2CKLB 4UYFB 4O7AA 1WEQA 3ONIA 4QZSA 4YH3A 4CLBA 2KWNA 1ZBDB 2YSJA 5EV9A 3KV6A 4QUUA 4NRBA 2MD8C 4CUPA 4IC3A 4KV1A 5EWWA 2H0DB 2QJ0A 4QSPA 5I3LA 5EP7A 4OGIA 2YW8A 4O7EA 3EB6A 1WEMA 2ECTA 4TTEA 3AQAA 5LKTA 3ZPVE 3JVMA 3MB3A 5AD2A 5FG4A 5A5RA 1WENA 5DYAA 2UZGA 5EYAF 3I3JA 2YW5A 2ECJA 5IIDA 4CUUA 3MXFA 3U5NA 5I86A 2FSAA 3KQIA 4NYWA 1N72A 2L75A 3MHHA 2XB1A 4QF2A 4CL9A 2CSYA 4Q0NA 2KGIA 2I8NA 5ETDA 5A5PA 4MEPA 3JVLA 5I89A 3O70A 5F63A 4J3IA 5K29A 3O34A 2R0VA 4QNSA 5F62A 5COIA 2F42A 5CUDA 5CQ7A 5J0DA 3UVYA 4A4BA 4AP4A 4YBTA 2YHNA 1IYMA 4HXMA 4AYCB 4HXSA 4NQNA 5KTXA 4TZ2A 2WP1A 4V3KC 4DONA 4QYLA 4QEVA 4IR5A 3MQMA 4L58A 3RPGC 2YDWA 2RFJA 4TT4A 5CQTA 3QZTA 3TLPA 3ZTGA 3LQJA 3HMEA 5FE6A 2M6MA 5G04B 2MNYA 4PY6A 5H1VA 4NN2A 4IR3A 5EQ1A 5E9IA 1WE9A 2H0DA 1V87A 3ZYUA 2C2LA 4WA6A 4XUBA 3HMHA 5G4SA 5HELA 2HYED 5F61A 3LQHA 3O37A 4QEUA 5FB1A 1Z6UA 2YURA 4IORA 5ETBA 4ALHA 4O7FA 5ENJA 5I88A 3KNVA 2CT2A 4IR4A 4CFLA 5L96A 5AITA 2KR4A 4F52B 3MB4A 5CRZA 4BHWA 3SOXA 4PPEA 1WESA 3IU6A 2KGGA 5D7XA 2KIZA 4NR5A 4HBWA 3JVKA 2JRJA 3FL2A 1X4UA 5JI8A 5F3AA 5AMEA 2LXPC 4AUQB 2R0YA 5FB0A 2KU3A 3HCSA 2JMJA 4CURA 4LDFA 1MM2A 3DWYA 5DYUA 5HQ6A 2YELA 3S92A 4UI9B 4NUCA 2FUIA 5E9LA 2VJEA 5D25A 1EQFA 5D3JA 4R2YA 1ZS5A 4UIXA 5E9KA 2M85A 4WZ3B 5D0CA 2EODA 4CUTA 5I1QA 5EI4A 5TB6A 4NRAA 5LVQA 4MR4A 5E9VA 4QSRA 2DATA 3L11A 4W4UA 3T7LA 5HQ5A 3IHPA 2F6JA 3P1EA 2KE1A 4WZ2A 2KFTA 5EWCA 4YYIA 1K2FA 4GNFA 3LXJA 1DVPA 3GG3A 5AIUA 3K2JA 1E4UA 2L85A 3UV5A 5TABA 5E3DA 3ZVZB 2R10A 3EB5A 4LC2A 5IGLA 4HXPA 5E7DA 4QSTA 2DVQA 5DFDA 5I7XA 4AKNA 5IBNA 5C87A 4NS5A 4QB3A 3HCUA 2RI7A 4QY4A 4TU6A 5CUEA 5A83A 4J0RA 2LGGA 3U5PA 1WGMA 4GNGA 3SHBA 5BT3A 2LDRA 3ZVYA 5CQ3A 4Z1QA 2G43A 5E0RA 5CQAA 5H9MA 5EA1A 5D3SA 2E3KA 2MA6A 4J0SA 4LYWA 3QZSA 2K17A 2VPEA 3UVWA 5CUBA 2M1RA 3G0JA 4N4HA 5ENGA 5C11A 2KWKA 5ENCA 2MNZA 4NYVA 4QR4A 3P5OA 5D3HA 4IC2A 3LJWA 2E7NA 4UIVA 1RMDA 3PHDA 5A81A 2K16A 3ZPV1 3D7CA 4GNDA 4ZDTA 1JM4B 5FE0A 2Y1NA 3ASLA 5FE2A 4V3LC 4UYGA 1WEUA 3MHSA 4YH4A 4LKAA 5CPEA 4MEQA 1Z2QA 4TYLA 3SVFA 5II1A 4S3OC 4UYEA 1HYJA 5FBXA 2KYUA 4GNEA 2DVSA 4UIZA 4YYDA 4YADA 5C7NA 4BBQA 2LSPB 4S3OB 3U5JA 5C13A 4MVTA 5FERA 1WEWA 5I29A 2KWOA 5CS8A 4TT6A 5DY7A 2ECVA 3U5OA 4MR6A 1JSPB 4C66A 5F25A 4A9NA 5KH7A 4XUAA 1BORA 2YYNA 5TRBA 2MIQA 2H60A 3Q2FA 2D82A 5BT5A 2VJFA 3SVHA 4A49A 2L80A 5HLSA 3IU5A 5BT4A 4HBYA 4Y03A 4ZQLA 4UP5A 4MEOA 2CKLA 4NR7A 4UYFA 5B8DA 5DKDA 4R8PK 4MR5A 3N9LA 4MSXA 4OGJA 2KTBB 4QUTA 3LRQA 5CTLA 4YBMA 5ENEA 5HJCA 3O33A 1X0JA 4QC1A 4Z1SA 5FG6A 4XI1A 5L97A 4FJCA 4GPJA 2F6NA 5ENFA 5F36A 5D3PA 5EPBA 5LCWB 5FDZA 1VD4A 2ECWA 4TQNA 2L84A 5E9MA 5ACYA 3SVGA 4WHWA 1WIMA 3NXBA 2EA6A 5C4QA 4NUEA 4LZ2A 2NXBA 4YK0A 5EWHA 5D3TA 4QSQA 5E73A 5EISA 3HTKC 4HXOA 3DQVR 2MUMA 3L1XA 2AN6A 2RNXA 4YYGA 3SOUA 5ENIA 2KREA 5E9YA 5JG6A 5CZGA 2LV9A 5FH8A 5A85A 2OSSA 5DW1A 4AYCA 5G4RA 5FEYA 4QC3A 4QF3A 2LRIC 5CQ6A 5FE1A 3ZYQA 2LQ6A 2Y1MA 1JM7B 3UVDA 5HFRA 4FIPA 4O7CA 3S91A 4BW4A 4BW3A 4Z6IA 5FE7A 5DLXA 3T6RA 5DFBA 4MENA 4LZSA 4UYHA 5LKXA 4O74A 5DFCA 2PNXA 2DVRA 2DVVA 2DKWA 4PCIA 4YC9A 2VPGA 5EGUA 4TT2A 5FH7A 2RS9B 5CUCA 4HXKA 5A5NA 3HMFA 4E96A 2YQDA 1WEVA 3O7AA 2HDPA 5KTWA 2D9EA 4NYXA 4XYAA 3SOWA 1WEEA 2OUOA 2EGPA 2YUCA 5ENBA 4LADB 2RO1A 3N9QA 2VPDA 5E3GA 4N4GA 5L8TA 4NUDA 1HYIA 5G0FA 4C67A 2YSMA 4CFKA 1X4JA 4ZW1A 5B78A 4ZUXU 3UVXA 3UW9A 5HM0A 2N9GA 2E7OA 4O70A 2BAYA 1X4IA 5TCMA 4IOOA 5IGKA 4QR5A 3MUKA 3HCTA 4QSXA 4I7DA 4A9KA 2GRCA 5HQ7A 2K4DA 1N87A 4HXLA 4N3WA 5IG6A 5FH6A 4NXJA 2L5UA 5KU3A 4A9MA 4QSSA 5C8GA 2YT5A 5CQ4A 2IDAA 2LGVA 2QICA 4CUSA 5L99A 4QSUA 1T1HA 4LK9A 4IR6A 4TZ8A 5DW2A 1Z60A 2CSZA 5HCLA 3U5KA 4HXRA 3M62A 5L8UA 2YU4A 4YYMA 1E6IA 3P1CA 4N4FA 2LXHC 1VFYA 2VNFA 1WUMA 2YQMA 5JWMA 5DX4A 5L98A 5KHMA 5D1KB 2L0BA 4P5OB 4B86C 3AADA 5CUAA 5II2A 4Z6HA 3N9OA 4NR8A 2DWWA 4RVRA 4F3IA 2L5EA 2YEKA 4QR3A 5B77A 4L7XA 3VK6A 5FG5A 2XEUA 5G05B 2YYRA 4AVXA 4PKLA 5KO4A 2PUYA 5F1HA 1WFKA 4PTBA 2K1JA 2M3HA 4R7EA 4YAXA 2MD7B 4KCXA 3GL6A 4UIUA 3RCWA 4YY4A 3LQIA 4A9HA 2YHOA 3UV2A 5EPSA 4YBSA 2I50A 3FKMX 3U5MA 5HFQA 4YYNA 5A7CA 4BW2A 5H1TA 1WILA 4YYHA 3GV4A 4O72A
chains in the Genus database with same CATH superfamily
4FLPA 5DYXA 3I2DA 5C89A 3KV5A 2MJVB 2WP2A 4TS8A 1MM3A 3P1FA 3O36A 5F1LA 3G0LA 2DX8A 5D3LA 2FUUA 1JOCA 4A9FA 5D24A 2ECIA 5D26A 5CY9A 3E2DA 2ECGA 4A9OA 2XOYA 4ZC9A 3U5LA 5EICA 4YYKA 5TDRA 4YY6A 4A9JA 3PURA 2G6QA 1LDKC 2VPBA 5LUUA 2IQJA 4LJNA 4UP0A 5FE9A 4ALGA 5IGMA 5CP5A 5EVAA 5KTUA 1VYXA 5EK9A 4PS5A 5EWDA 4WHUA 5DBMA 5KH3A 1WEOA 5HRWA 5CQ8A 2VJEB 5AMFA 5CQ5A 5B76A 2ECNA 4CUQA 4B7YC 2OO1A 5FFYA 4O75A 4PCEA 4GB0A 4NR6A 4MR3A 3RPGB 4CA1A 1F68A 4NRCA 5E74A 5LKUA 1WEPA 5D1MB 4UIYA 5EPRA 4Q0OA 4TKPB 4AKGA 2VP7A 4J1PA 1F62A 4OUFA 4O71A 2OXQC 4O64A 2R0SA 3Q2EA 4YATA 5F2PA 4A9EA 3NG2A 4LLBA 5CGPA 4UIWA 1FBVA 2LN0A 5EWVA 2YVRA 4KV4A 2G45A 2JMDA 5C85A 5I7YA 5DYCA 4I7BA 5D3RA 4I7CA 5DKHA 5SVXA 4NQMA 5I40A 3N9MA 5J3XA 2QIZA 3DPLR 1G25A 3PUQA 5HEMA 3N9PA 5DINA 5FFWA 1LDJB 4CCGX 5H1UA 5SVIB 4LYSA 4FO9A 2KKXA 2Y43A 3P1DA 4NR9A 4QSWA 3C6WA 4QEWA 3RTRB 5A82A 2E6RA 5TDWA 5IGNA 2EGMA 2JUNA 3N9NA 5EU1A 3O47A 5HRXA 4WZ0A 1WUGA 3DAIA 4A0CD 2RNYA 5TBNA 2EXUA 5LJ0A 5HRVA 2G4AA 4A9LA 2B0OE 3M99A 5LJ2A 3UV4A 3VKGA 2LGLA 3QZVA 4HBVA 2KWJA 3L1ZB 5LJ1A 1CHCA 4HBXA 4IOQA 5AD3A 4YABA 5F5ZA 5A5OA 4LRGA 2NAAA 3LVQE 2I7KA 3C5KA 4Z93A 5FE8A 4O76A 5CU8A 4OGCA 4Q6FA 5EM3A 4QSVA 4FK5A 4QBMA 4LZRA 5CFWA 2C2VS 2YQLA 4X3GA 5DLZA 5LVRA 3ZNIA 3JVJA 5DKAA 2RNWA 1U6GB 2MA5A 2YEMA 4TU4A 5HENA 2L7PA 5B79A 2ZETC 2LGKA 5A5SA 4A9IA 3M63A 4A4CA 2E6SA 5B75A 4QYDA 4O62A 4C9ZA 3MULA 5D3NA 2DJAA 2D8SA 2MT5A 3O35A 4WIVA 3V43A 2L43A 1JM7A 4O78A 5DKCA 4XY8A 5F60A 4O77A 4N4IA 5I83A 3FJUB 4NR4A 5CUGA 5FE5A 2OWAA 4Z0OA 4XY9A 4LYIA 4HXNA 2CSVA 5SVIA 4BW1A 5I80A 4LR6A 4O7BA 5FE4A 5ENHA 4BJXA 5KH9A 5H85A 5CRMA 5LKZA 5D1LB 1XWHA 2RSDA 3FANA 2VJFB 5A5QA 2JMIA 4YYJA 4UITA 1FP0A 4X2IA 4UYDA 2P57A 5FFVA 2YREA 5FE3A 2CKLB 4UYFB 4O7AA 1WEQA 3ONIA 4QZSA 4YH3A 3D1BA 4CLBA 1ZBDB 2KWNA 2YSJA 5EV9A 3KV6A 4QUUA 4NRBA 2MD8C 4CUPA 4IC3A 4KV1A 5EWWA 2H0DB 2QJ0A 4QSPA 2FD4A 5EP7A 4OGIA 2YW8A 4O7EA 3EB6A 3LJUX 5I3LA 1WEMA 2ECTA 4TTEA 3AQAA 5LKTA 3ZPVE 3D1DA 3JVMA 3MB3A 5AD2A 5FG4A 5A5RA 1WENA 5DYAA 2UZGA 5EYAF 3I3JA 2YW5A 2ECJA 5IIDA 4CUUA 3MXFA 3U5NA 5I86A 2FSAA 3KQIA 4NYWA 1N72A 2L75A 3MHHA 2XB1A 4QF2A 4CL9A 2CSYA 4Q0NA 2KGIA 2I8NA 5ETDA 5A5PA 4MEPA 3JVLA 5I89A 3O70A 5F63A 4J3IA 5K29A 3O34A 2R0VA 4QNSA 5F62A 5COIA 2F42A 5CUDA 5CQ7A 5J0DA 3UVYA 4A4BA 4AP4A 2CRWA 4YBTA 2YHNA 1IYMA 4HXMA 4AYCB 4HXSA 3Q1DA 4NQNA 5KTXA 4TZ2A 2XOCA 2WP1A 4V3KC 4DONA 4QQ4A 4QYLA 4QEVA 4IR5A 3MQMA 3DWDA 4L58A 3RPGC 2YDWA 2RFJA 4TT4A 5CQTA 4Z0RA 3QZTA 3TLPA 3ZTGA 3LQJA 3HMEA 5FE6A 2M6MA 4F1PA 5G04B 2MNYA 4PY6A 5H1VA 4NN2A 4IR3A 5EQ1A 5E9IA 1WE9A 2H0DA 1V87A 3ZYUA 2C2LA 4WA6A 4XUBA 3HMHA 5G4SA 5HELA 2HYED 5F61A 3LQHA 3O37A 4QEUA 5FB1A 1Z6UA 2YURA 4IORA 5ETBA 4ALHA 4O7FA 5ENJA 5I88A 2E61A 3KNVA 3PLWA 2CT2A 4IR4A 4CFLA 5L96A 1DCQA 2JM3A 5AITA 2KR4A 4F52B 3MB4A 5CRZA 4BHWA 3SOXA 4AI6A 3T9KA 4PPEA 3FM8C 1WESA 3IU6A 2KGGA 5D7XA 2KIZA 4NR5A 4HBWA 3JVKA 2JRJA 3FL2A 1X4UA 5JI8A 5F3AA 5AMEA 2LXPC 4AKIA 4AUQB 2R0YA 5FB0A 3KDEC 2KU3A 3HCSA 2JMJA 4CURA 4LDFA 1MM2A 3DWYA 5DYUA 5HQ6A 2YELA 3S92A 4UI9B 4NUCA 2FUIA 5E9LA 2VJEA 3MDBC 5D25A 1EQFA 5D3JA 4R2YA 1ZS5A 4UIXA 5E9KA 2M85A 4WZ3B 5D0CA 2EODA 4CUTA 5I1QA 5EI4A 5TB6A 4NRAA 5LVQA 4MR4A 5E9VA 4QSRA 2DATA 3L11A 4AKHA 5SVYA 4W4UA 2CONA 5HQ5A 3T7LA 3IHPA 2F6JA 3P1EA 2KE1A 4WZ2A 2KFTA 5EWCA 4YYIA 1K2FA 4GNFA 3LXJA 1DVPA 3GG3A 5AIUA 3K2JA 1E4UA 2L85A 3UV5A 5TABA 5E3DA 2XP0A 3ZVZB 2R10A 3EB5A 4LC2A 5IGLA 4HXPA 5E7DA 4QSTA 2DVQA 5DFDA 5I7XA 2D8UA 4AKNA 5IBNA 5C87A 4NS5A 4QB3A 3HCUA 2RI7A 4QY4A 4TU6A 5CUEA 5A83A 4J0RA 2LGGA 3U5PA 1WGMA 4GNGA 3SHBA 5BT3A 2LDRA 3ZVYA 5CQ3A 4Z1QA 2G43A 5E0RA 1PUOA 5CQAA 5H9MA 5EA1A 5D3SA 2E3KA 2MA6A 4J0SA 4LYWA 3QZSA 2K17A 2VPEA 3UVWA 5CUBA 2M1RA 3G0JA 4N4HA 5ENGA 5C11A 2KWKA 5ENCA 2DSMA 2MNZA 4NYVA 4QR4A 3P5OA 5D3HA 4IC2A 3LJWA 2E7NA 4UIVA 1RMDA 3PHDA 5A81A 2K16A 3ZPV1 3D7CA 4GNDA 4ZDTA 1JM4B 5FE0A 2Y1NA 2XOZA 5FE2A 3ASLA 4V3LC 4UYGA 1WEUA 3MHSA 4YH4A 4LKAA 5CPEA 4MEQA 1Z2QA 4TYLA 3SVFA 4OGEA 5II1A 4S3OC 3VKHA 4UYEA 1HYJA 5FBXA 2KYUA 4GNEA 2DVSA 4UIZA 4YYDA 4YADA 3FEHA 5C7NA 4BBQA 2LSPB 4S3OB 3U5JA 5C13A 4MVTA 5FERA 1WEWA 5I29A 2KWOA 5CS8A 4TT6A 5DY7A 2ECVA 3U5OA 4MR6A 1JSPB 4C66A 5F25A 4A9NA 5KH7A 4XUAA 1BORA 2YYNA 5TRBA 2MIQA 2H60A 3Q2FA 2D82A 5BT5A 2VJFA 3SVHA 4A49A 2L80A 2M13A 5HLSA 3IU5A 5BT4A 4HBYA 4Y03A 4ZQLA 4UP5A 4MEOA 2CKLA 4NR7A 4UYFA 5B8DA 5DKDA 4R8PK 4MR5A 3N9LA 4MSXA 4OGJA 2KTBB 4QUTA 3LRQA 5CTLA 4YBMA 5ENEA 5HJCA 3O33A 1X0JA 2MKEA 4QC1A 4Z1SA 5FG6A 4XI1A 5L97A 4FJCA 4GPJA 2F6NA 5ENFA 5F36A 5D3PA 5EPBA 5LCWB 5FDZA 1VD4A 2ECWA 2KKYA 4TQNA 2L84A 5E9MA 5ACYA 3SVGA 4WHWA 1WIMA 3NXBA 2EA6A 5C4QA 2EJNA 4NUEA 4LZ2A 2NXBA 4YK0A 5EWHA 5D3TA 4QSQA 5E73A 5EISA 3HTKC 4HXOA 3DQVR 2MUMA 3JUEA 3L1XA 3ERRA 2AN6A 3M7KA 2RNXA 4YYGA 3SOUA 5ENIA 2KREA 5E9YA 5JG6A 5CZGA 2LV9A 5FH8A 5A85A 2OSSA 5DW1A 4AYCA 5G4RA 5FEYA 4QC3A 4QF3A 2LRIC 5CQ6A 5FE1A 2FFWA 2LQ6A 2LAUA 2Y1MA 3ZYQA 1JM7B 3UVDA 5HFRA 4FIPA 4O7CA 3S91A 4BW4A 4BW3A 3SUBA 4Z6IA 5FE7A 5DLXA 3T6RA 5DFBA 4MENA 4LZSA 4UYHA 5LKXA 4O74A 5DFCA 2PNXA 2DVRA 2DVVA 2DKWA 4PCIA 4YC9A 2VPGA 5EGUA 4TT2A 5FH7A 2RS9B 5CUCA 4HXKA 5A5NA 3HMFA 4E96A 2YQDA 1WEVA 3O7AA 2HDPA 5KTWA 2D9EA 4NYXA 4XYAA 3SOWA 1WEEA 2OUOA 2EGPA 2YUCA 5ENBA 4LADB 2RO1A 3N9QA 2VPDA 5E3GA 4N4GA 5L8TA 4NUDA 1HYIA 5G0FA 4C67A 2YSMA 4CFKA 1X4JA 4ZW1A 2RR4A 5B78A 4ZUXU 3UVXA 3UW9A 5HM0A 2N9GA 2E7OA 4O70A 2BAYA 1X4IA 5TCMA 4IOOA 5IGKA 4QR5A 3MUKA 3HCTA 4QSXA 4I7DA 4A9KA 2GRCA 5HQ7A 3H7HA 2K4DA 1N87A 4HXLA 4N3WA 5IG6A 5FH6A 4NXJA 2L5UA 5KU3A 4A9MA 4QSSA 5C8GA 2YT5A 5CQ4A 2IDAA 2LGVA 1MBMA 2QICA 3DDTA 4CUSA 5L99A 4QSUA 1T1HA 4LK9A 4IR6A 4TZ8A 5DW2A 1Z60A 2CSZA 5HCLA 3U5KA 4HXRA 3M62A 5L8UA 2YU4A 4YYMA 1E6IA 3P1CA 4N4FA 2LXHC 3LDYA 1VFYA 2VNFA 1WUMA 2YQMA 5JWMA 5DX4A 5L98A 5KHMA 5D1KB 2L0BA 2CRRA 4P5OB 4B86C 4H9DA 3AADA 5CUAA 5II2A 4Z6HA 3N9OA 4NR8A 5K3QA 2DWWA 4RVRA 4F3IA 2L5EA 2YEKA 4QR3A 5B77A 4L7XA 3VK6A 5FG5A 2XEUA 5G05B 2YYRA 4AVXA 4PKLA 5KO4A 2PUYA 5F1HA 1WFKA 4PTBA 2K1JA 2M3HA 4R7EA 4YAXA 2MD7B 4KCXA 3FAOA 3GL6A 3LVRE 4UIUA 3RCWA 4YY4A 3LQIA 4A9HA 2YHOA 3UV2A 5EPSA 4YBSA 2I50A 3FKMX 3U5MA 5HFQA 4YYNA 5A7CA 4BW2A 1ZKRA 5H1TA 1WILA 4YYHA 3GV4A 4O72A
chains in the Genus database with same CATH topology
4FLPA 5DYXA 3I2DA 5C89A 3KV5A 2MJVB 2WP2A 4TS8A 1MM3A 3P1FA 3O36A 5F1LA 3G0LA 2DX8A 5D3LA 2FUUA 1JOCA 4A9FA 5D24A 2ECIA 5D26A 5CY9A 2ECGA 4A9OA 4ZC9A 3U5LA 5EICA 4YYKA 5TDRA 4YY6A 4A9JA 3PURA 2G6QA 1LDKC 2VPBA 5LUUA 4LJNA 4UP0A 5FE9A 4ALGA 5IGMA 5CP5A 5EVAA 5KTUA 1VYXA 5EK9A 4PS5A 5EWDA 4WHUA 5DBMA 5KH3A 1WEOA 5HRWA 5CQ8A 2VJEB 5AMFA 5CQ5A 5B76A 2ECNA 4CUQA 4B7YC 2OO1A 5FFYA 4O75A 4PCEA 4GB0A 4NR6A 4MR3A 3RPGB 4CA1A 1F68A 4NRCA 5E74A 5LKUA 1WEPA 5D1MB 4UIYA 5EPRA 4Q0OA 4TKPB 2VP7A 4J1PA 1F62A 4OUFA 4O71A 2OXQC 4O64A 2R0SA 3Q2EA 4YATA 5F2PA 4A9EA 3NG2A 4LLBA 5CGPA 4UIWA 1FBVA 2LN0A 5EWVA 4KV4A 2G45A 2JMDA 5C85A 5I7YA 5DYCA 4I7BA 5D3RA 4I7CA 5DKHA 4NQMA 5I40A 3N9MA 5J3XA 2QIZA 3DPLR 1G25A 3PUQA 5HEMA 3N9PA 5DINA 5FFWA 1LDJB 4CCGX 5H1UA 4LYSA 4FO9A 2Y43A 3P1DA 4NR9A 4QSWA 3C6WA 4QEWA 3RTRB 5A82A 2E6RA 5TDWA 5IGNA 3N9NA 5EU1A 5HRXA 4WZ0A 1WUGA 3DAIA 4A0CD 2RNYA 5TBNA 5LJ0A 5HRVA 2G4AA 4A9LA 3M99A 5LJ2A 3UV4A 2LGLA 3QZVA 4HBVA 2KWJA 3L1ZB 5LJ1A 1CHCA 4HBXA 4IOQA 5AD3A 4YABA 5F5ZA 5A5OA 4LRGA 2NAAA 2I7KA 3C5KA 4Z93A 5FE8A 4O76A 5CU8A 4Q6FA 5EM3A 4QSVA 4FK5A 4QBMA 4LZRA 5CFWA 2C2VS 2YQLA 4X3GA 5DLZA 5LVRA 3ZNIA 3JVJA 5DKAA 2RNWA 1U6GB 2MA5A 2YEMA 4TU4A 5HENA 5B79A 2ZETC 2LGKA 5A5SA 4A9IA 3M63A 4A4CA 2E6SA 5B75A 4QYDA 4C9ZA 3MULA 5D3NA 2D8SA 2MT5A 3O35A 4WIVA 3V43A 2L43A 1JM7A 4O78A 5DKCA 4XY8A 5F60A 4O77A 4N4IA 5I83A 4NR4A 5CUGA 5FE5A 4XY9A 4LYIA 4HXNA 4BW1A 5I80A 4LR6A 4O7BA 5FE4A 5ENHA 4BJXA 5KH9A 5H85A 5CRMA 5LKZA 5D1LB 1XWHA 2RSDA 2VJFB 5A5QA 2JMIA 4YYJA 4UITA 1FP0A 4X2IA 4UYDA 5FFVA 2YREA 5FE3A 2CKLB 4UYFB 4O7AA 1WEQA 3ONIA 4QZSA 4YH3A 4CLBA 2KWNA 1ZBDB 2YSJA 5EV9A 3KV6A 4QUUA 4NRBA 2MD8C 4CUPA 4IC3A 4KV1A 5EWWA 2H0DB 2QJ0A 4QSPA 5I3LA 5EP7A 4OGIA 2YW8A 4O7EA 3EB6A 1WEMA 2ECTA 4TTEA 3AQAA 5LKTA 3ZPVE 3JVMA 3MB3A 5AD2A 5FG4A 5A5RA 1WENA 5DYAA 2UZGA 5EYAF 3I3JA 2YW5A 2ECJA 5IIDA 4CUUA 3MXFA 3U5NA 5I86A 2FSAA 3KQIA 4NYWA 1N72A 2L75A 3MHHA 2XB1A 4QF2A 4CL9A 2CSYA 4Q0NA 2KGIA 2I8NA 5ETDA 5A5PA 4MEPA 3JVLA 5I89A 3O70A 5F63A 4J3IA 5K29A 3O34A 2R0VA 4QNSA 5F62A 5COIA 2F42A 5CUDA 5CQ7A 5J0DA 3UVYA 4A4BA 4AP4A 4YBTA 2YHNA 1IYMA 4HXMA 4AYCB 4HXSA 4NQNA 5KTXA 4TZ2A 2WP1A 4V3KC 4DONA 4QYLA 4QEVA 4IR5A 3MQMA 4L58A 3RPGC 2YDWA 2RFJA 4TT4A 5CQTA 3QZTA 3TLPA 3ZTGA 3LQJA 3HMEA 5FE6A 2M6MA 5G04B 2MNYA 4PY6A 5H1VA 4NN2A 4IR3A 5EQ1A 5E9IA 1WE9A 2H0DA 1V87A 3ZYUA 2C2LA 4WA6A 4XUBA 3HMHA 5G4SA 5HELA 2HYED 5F61A 3LQHA 3O37A 4QEUA 5FB1A 1Z6UA 2YURA 4IORA 5ETBA 4ALHA 4O7FA 5ENJA 5I88A 3KNVA 2CT2A 4IR4A 4CFLA 5L96A 5AITA 2KR4A 4F52B 3MB4A 5CRZA 4BHWA 3SOXA 4PPEA 1WESA 3IU6A 2KGGA 5D7XA 2KIZA 4NR5A 4HBWA 3JVKA 2JRJA 3FL2A 1X4UA 5JI8A 5F3AA 5AMEA 2LXPC 4AUQB 2R0YA 5FB0A 2KU3A 3HCSA 2JMJA 4CURA 4LDFA 1MM2A 3DWYA 5DYUA 5HQ6A 2YELA 3S92A 4UI9B 4NUCA 2FUIA 5E9LA 2VJEA 5D25A 1EQFA 5D3JA 4R2YA 1ZS5A 4UIXA 5E9KA 2M85A 4WZ3B 5D0CA 2EODA 4CUTA 5I1QA 5EI4A 5TB6A 4NRAA 5LVQA 4MR4A 5E9VA 4QSRA 2DATA 3L11A 4W4UA 3T7LA 5HQ5A 3IHPA 2F6JA 3P1EA 2KE1A 4WZ2A 2KFTA 5EWCA 4YYIA 1K2FA 4GNFA 3LXJA 1DVPA 3GG3A 5AIUA 3K2JA 1E4UA 2L85A 3UV5A 5TABA 5E3DA 3ZVZB 2R10A 3EB5A 4LC2A 5IGLA 4HXPA 5E7DA 4QSTA 2DVQA 5DFDA 5I7XA 4AKNA 5IBNA 5C87A 4NS5A 4QB3A 3HCUA 2RI7A 4QY4A 4TU6A 5CUEA 5A83A 4J0RA 2LGGA 3U5PA 1WGMA 4GNGA 3SHBA 5BT3A 2LDRA 3ZVYA 5CQ3A 4Z1QA 2G43A 5E0RA 5CQAA 5H9MA 5EA1A 5D3SA 2E3KA 2MA6A 4J0SA 4LYWA 3QZSA 2K17A 2VPEA 3UVWA 5CUBA 2M1RA 3G0JA 4N4HA 5ENGA 5C11A 2KWKA 5ENCA 2MNZA 4NYVA 4QR4A 3P5OA 5D3HA 4IC2A 3LJWA 2E7NA 4UIVA 1RMDA 3PHDA 5A81A 2K16A 3ZPV1 3D7CA 4GNDA 4ZDTA 1JM4B 5FE0A 2Y1NA 3ASLA 5FE2A 4V3LC 4UYGA 1WEUA 3MHSA 4YH4A 4LKAA 5CPEA 4MEQA 1Z2QA 4TYLA 3SVFA 5II1A 4S3OC 4UYEA 1HYJA 5FBXA 2KYUA 4GNEA 2DVSA 4UIZA 4YYDA 4YADA 5C7NA 4BBQA 2LSPB 4S3OB 3U5JA 5C13A 4MVTA 5FERA 1WEWA 5I29A 2KWOA 5CS8A 4TT6A 5DY7A 2ECVA 3U5OA 4MR6A 1JSPB 4C66A 5F25A 4A9NA 5KH7A 4XUAA 1BORA 2YYNA 5TRBA 2MIQA 2H60A 3Q2FA 2D82A 5BT5A 2VJFA 3SVHA 4A49A 2L80A 5HLSA 3IU5A 5BT4A 4HBYA 4Y03A 4ZQLA 4UP5A 4MEOA 2CKLA 4NR7A 4UYFA 5B8DA 5DKDA 4R8PK 4MR5A 3N9LA 4MSXA 4OGJA 2KTBB 4QUTA 3LRQA 5CTLA 4YBMA 5ENEA 5HJCA 3O33A 1X0JA 4QC1A 4Z1SA 5FG6A 4XI1A 5L97A 4FJCA 4GPJA 2F6NA 5ENFA 5F36A 5D3PA 5EPBA 5LCWB 5FDZA 1VD4A 2ECWA 4TQNA 2L84A 5E9MA 5ACYA 3SVGA 4WHWA 1WIMA 3NXBA 2EA6A 5C4QA 4NUEA 4LZ2A 2NXBA 4YK0A 5EWHA 5D3TA 4QSQA 5E73A 5EISA 3HTKC 4HXOA 3DQVR 2MUMA 3L1XA 2AN6A 2RNXA 4YYGA 3SOUA 5ENIA 2KREA 5E9YA 5JG6A 5CZGA 2LV9A 5FH8A 5A85A 2OSSA 5DW1A 4AYCA 5G4RA 5FEYA 4QC3A 4QF3A 2LRIC 5CQ6A 5FE1A 3ZYQA 2LQ6A 2Y1MA 1JM7B 3UVDA 5HFRA 4FIPA 4O7CA 3S91A 4BW4A 4BW3A 4Z6IA 5FE7A 5DLXA 3T6RA 5DFBA 4MENA 4LZSA 4UYHA 5LKXA 4O74A 5DFCA 2PNXA 2DVRA 2DVVA 2DKWA 4PCIA 4YC9A 2VPGA 5EGUA 4TT2A 5FH7A 2RS9B 5CUCA 4HXKA 5A5NA 3HMFA 4E96A 2YQDA 1WEVA 3O7AA 2HDPA 5KTWA 2D9EA 4NYXA 4XYAA 3SOWA 1WEEA 2OUOA 2EGPA 2YUCA 5ENBA 4LADB 2RO1A 3N9QA 2VPDA 5E3GA 4N4GA 5L8TA 4NUDA 1HYIA 5G0FA 4C67A 2YSMA 4CFKA 1X4JA 4ZW1A 5B78A 4ZUXU 3UVXA 3UW9A 5HM0A 2N9GA 2E7OA 4O70A 2BAYA 1X4IA 5TCMA 4IOOA 5IGKA 4QR5A 3MUKA 3HCTA 4QSXA 4I7DA 4A9KA 2GRCA 5HQ7A 2K4DA 1N87A 4HXLA 4N3WA 5IG6A 5FH6A 4NXJA 2L5UA 5KU3A 4A9MA 4QSSA 5C8GA 2YT5A 5CQ4A 2IDAA 2LGVA 2QICA 4CUSA 5L99A 4QSUA 1T1HA 4LK9A 4IR6A 4TZ8A 5DW2A 1Z60A 2CSZA 5HCLA 3U5KA 4HXRA 3M62A 5L8UA 2YU4A 4YYMA 1E6IA 3P1CA 4N4FA 2LXHC 1VFYA 2VNFA 1WUMA 2YQMA 5JWMA 5DX4A 5L98A 5KHMA 5D1KB 2L0BA 4P5OB 4B86C 3AADA 5CUAA 5II2A 4Z6HA 3N9OA 4NR8A 2DWWA 4RVRA 4F3IA 2L5EA 2YEKA 4QR3A 5B77A 4L7XA 3VK6A 5FG5A 2XEUA 5G05B 2YYRA 4AVXA 4PKLA 5KO4A 2PUYA 5F1HA 1WFKA 4PTBA 2K1JA 2M3HA 4R7EA 4YAXA 2MD7B 4KCXA 3GL6A 4UIUA 3RCWA 4YY4A 3LQIA 4A9HA 2YHOA 3UV2A 5EPSA 4YBSA 2I50A 3FKMX 3U5MA 5HFQA 4YYNA 5A7CA 4BW2A 5H1TA 1WILA 4YYHA 3GV4A 4O72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLP A;  5DYX A;  3I2D A;  5C89 A;  3KV5 A;  2MJV B;  2WP2 A;  4TS8 A;  1MM3 A;  3P1F A;  3O36 A;  5F1L A;  3G0L A;  2DX8 A;  5D3L A;  2FUU A;  1JOC A;  4A9F A;  5D24 A;  2ECI A;  5D26 A;  5CY9 A;  2ECG A;  4A9O A;  4ZC9 A;  3U5L A;  5EIC A;  4YYK A;  5TDR A;  4YY6 A;  4A9J A;  3PUR A;  2G6Q A;  1LDK C;  2VPB A;  5LUU A;  4LJN A;  4UP0 A;  5FE9 A;  4ALG A;  5IGM A;  5CP5 A;  5EVA A;  5KTU A;  1VYX A;  5EK9 A;  4PS5 A;  5EWD A;  4WHU A;  5DBM A;  5KH3 A;  1WEO A;  5HRW A;  5CQ8 A;  2VJE B;  5AMF A;  5CQ5 A;  5B76 A;  2ECN A;  4CUQ A;  4B7Y C;  2OO1 A;  5FFY A;  4O75 A;  4PCE A;  4GB0 A;  4NR6 A;  4MR3 A;  3RPG B;  4CA1 A;  1F68 A;  4NRC A;  5E74 A;  5LKU A;  1WEP A;  5D1M B;  4UIY A;  5EPR A;  4Q0O A;  4TKP B;  2VP7 A;  4J1P A;  1F62 A;  4OUF A;  4O71 A;  2OXQ C;  4O64 A;  2R0S A;  3Q2E A;  4YAT A;  5F2P A;  4A9E A;  3NG2 A;  4LLB A;  5CGP A;  4UIW A;  1FBV A;  2LN0 A;  5EWV A;  4KV4 A;  2G45 A;  2JMD A;  5C85 A;  5I7Y A;  5DYC A;  4I7B A;  5D3R A;  4I7C A;  5DKH A;  4NQM A;  5I40 A;  3N9M A;  5J3X A;  2QIZ A;  3DPL R;  1G25 A;  3PUQ A;  5HEM A;  3N9P A;  5DIN A;  5FFW A;  1LDJ B;  4CCG X;  5H1U A;  4LYS A;  4FO9 A;  2Y43 A;  3P1D A;  4NR9 A;  4QSW A;  3C6W A;  4QEW A;  3RTR B;  5A82 A;  2E6R A;  5TDW A;  5IGN A;  3N9N A;  5EU1 A;  5HRX A;  4WZ0 A;  1WUG A;  3DAI A;  4A0C D;  2RNY A;  5TBN A;  5LJ0 A;  5HRV A;  2G4A A;  4A9L A;  3M99 A;  5LJ2 A;  3UV4 A;  2LGL A;  3QZV A;  4HBV A;  2KWJ A;  3L1Z B;  5LJ1 A;  1CHC A;  4HBX A;  4IOQ A;  5AD3 A;  4YAB A;  5F5Z A;  5A5O A;  4LRG A;  2NAA A;  2I7K A;  3C5K A;  4Z93 A;  5FE8 A;  4O76 A;  5CU8 A;  4Q6F A;  5EM3 A;  4QSV A;  4FK5 A;  4QBM A;  4LZR A;  5CFW A;  2C2V S;  2YQL A;  4X3G A;  5DLZ A;  5LVR A;  3ZNI A;  3JVJ A;  5DKA A;  2RNW A;  1U6G B;  2MA5 A;  2YEM A;  4TU4 A;  5HEN A;  5B79 A;  2ZET C;  2LGK A;  5A5S A;  4A9I A;  3M63 A;  4A4C A;  2E6S A;  5B75 A;  4QYD A;  4C9Z A;  3MUL A;  5D3N A;  2D8S A;  2MT5 A;  3O35 A;  4WIV A;  3V43 A;  2L43 A;  1JM7 A;  4O78 A;  5DKC A;  4XY8 A;  5F60 A;  4O77 A;  4N4I A;  5I83 A;  4NR4 A;  5CUG A;  5FE5 A;  4XY9 A;  4LYI A;  4HXN A;  4BW1 A;  5I80 A;  4LR6 A;  4O7B A;  5FE4 A;  5ENH A;  4BJX A;  5KH9 A;  5H85 A;  5CRM A;  5LKZ A;  5D1L B;  1XWH A;  2RSD A;  2VJF B;  5A5Q A;  2JMI A;  4YYJ A;  4UIT A;  1FP0 A;  4X2I A;  4UYD A;  5FFV A;  2YRE A;  5FE3 A;  2CKL B;  4UYF B;  4O7A A;  1WEQ A;  3ONI A;  4QZS A;  4YH3 A;  4CLB A;  2KWN A;  1ZBD B;  2YSJ A;  5EV9 A;  3KV6 A;  4QUU A;  4NRB A;  2MD8 C;  4CUP A;  4IC3 A;  4KV1 A;  5EWW A;  2H0D B;  2QJ0 A;  4QSP A;  5I3L A;  5EP7 A;  4OGI A;  2YW8 A;  4O7E A;  3EB6 A;  1WEM A;  2ECT A;  4TTE A;  3AQA A;  5LKT A;  3ZPV E;  3JVM A;  3MB3 A;  5AD2 A;  5FG4 A;  5A5R A;  1WEN A;  5DYA A;  2UZG A;  5EYA F;  3I3J A;  2YW5 A;  2ECJ A;  5IID A;  4CUU A;  3MXF A;  3U5N A;  5I86 A;  2FSA A;  3KQI A;  4NYW A;  1N72 A;  2L75 A;  3MHH A;  2XB1 A;  4QF2 A;  4CL9 A;  2CSY A;  4Q0N A;  2KGI A;  2I8N A;  5ETD A;  5A5P A;  4MEP A;  3JVL A;  5I89 A;  3O70 A;  5F63 A;  4J3I A;  5K29 A;  3O34 A;  2R0V A;  4QNS A;  5F62 A;  5COI A;  2F42 A;  5CUD A;  5CQ7 A;  5J0D A;  3UVY A;  4A4B A;  4AP4 A;  4YBT A;  2YHN A;  1IYM A;  4HXM A;  4AYC B;  4HXS A;  4NQN A;  5KTX A;  4TZ2 A;  2WP1 A;  4V3K C;  4DON A;  4QYL A;  4QEV A;  4IR5 A;  3MQM A;  4L58 A;  3RPG C;  2YDW A;  2RFJ A;  4TT4 A;  5CQT A;  3QZT A;  3TLP A;  3ZTG A;  3LQJ A;  3HME A;  5FE6 A;  2M6M A;  5G04 B;  2MNY A;  4PY6 A;  5H1V A;  4NN2 A;  4IR3 A;  5EQ1 A;  5E9I A;  1WE9 A;  2H0D A;  1V87 A;  3ZYU A;  2C2L A;  4WA6 A;  4XUB A;  3HMH A;  5G4S A;  5HEL A;  2HYE D;  5F61 A;  3LQH A;  3O37 A;  4QEU A;  5FB1 A;  1Z6U A;  2YUR A;  4IOR A;  5ETB A;  4ALH A;  4O7F A;  5ENJ A;  5I88 A;  3KNV A;  2CT2 A;  4IR4 A;  4CFL A;  5L96 A;  5AIT A;  2KR4 A;  4F52 B;  3MB4 A;  5CRZ A;  4BHW A;  3SOX A;  4PPE A;  1WES A;  3IU6 A;  2KGG A;  5D7X A;  2KIZ A;  4NR5 A;  4HBW A;  3JVK A;  2JRJ A;  3FL2 A;  1X4U A;  5JI8 A;  5F3A A;  5AME A;  2LXP C;  4AUQ B;  2R0Y A;  5FB0 A;  2KU3 A;  3HCS A;  2JMJ A;  4CUR A;  4LDF A;  1MM2 A;  3DWY A;  5DYU A;  5HQ6 A;  2YEL A;  3S92 A;  4UI9 B;  4NUC A;  2FUI A;  5E9L A;  2VJE A;  5D25 A;  1EQF A;  5D3J A;  4R2Y A;  1ZS5 A;  4UIX A;  5E9K A;  2M85 A;  4WZ3 B;  5D0C A;  2EOD A;  4CUT A;  5I1Q A;  5EI4 A;  5TB6 A;  4NRA A;  5LVQ A;  4MR4 A;  5E9V A;  4QSR A;  2DAT A;  3L11 A;  4W4U A;  3T7L A;  5HQ5 A;  3IHP A;  2F6J A;  3P1E A;  2KE1 A;  4WZ2 A;  2KFT A;  5EWC A;  4YYI A;  1K2F A;  4GNF A;  3LXJ A;  1DVP A;  3GG3 A;  5AIU A;  3K2J A;  1E4U A;  2L85 A;  3UV5 A;  5TAB A;  5E3D A;  3ZVZ B;  2R10 A;  3EB5 A;  4LC2 A;  5IGL A;  4HXP A;  5E7D A;  4QST A;  2DVQ A;  5DFD A;  5I7X A;  4AKN A;  5IBN A;  5C87 A;  4NS5 A;  4QB3 A;  3HCU A;  2RI7 A;  4QY4 A;  4TU6 A;  5CUE A;  5A83 A;  4J0R A;  2LGG A;  3U5P A;  1WGM A;  4GNG A;  3SHB A;  5BT3 A;  2LDR A;  3ZVY A;  5CQ3 A;  4Z1Q A;  2G43 A;  5E0R A;  5CQA A;  5H9M A;  5EA1 A;  5D3S A;  2E3K A;  2MA6 A;  4J0S A;  4LYW A;  3QZS A;  2K17 A;  2VPE A;  3UVW A;  5CUB A;  2M1R A;  3G0J A;  4N4H A;  5ENG A;  5C11 A;  2KWK A;  5ENC A;  2MNZ A;  4NYV A;  4QR4 A;  3P5O A;  5D3H A;  4IC2 A;  3LJW A;  2E7N A;  4UIV A;  1RMD A;  3PHD A;  5A81 A;  2K16 A;  3ZPV 1;  3D7C A;  4GND A;  4ZDT A;  1JM4 B;  5FE0 A;  2Y1N A;  3ASL A;  5FE2 A;  4V3L C;  4UYG A;  1WEU A;  3MHS A;  4YH4 A;  4LKA A;  5CPE A;  4MEQ A;  1Z2Q A;  4TYL A;  3SVF A;  5II1 A;  4S3O C;  4UYE A;  1HYJ A;  5FBX A;  2KYU A;  4GNE A;  2DVS A;  4UIZ A;  4YYD A;  4YAD A;  5C7N A;  4BBQ A;  2LSP B;  4S3O B;  3U5J A;  5C13 A;  4MVT A;  5FER A;  1WEW A;  5I29 A;  2KWO A;  5CS8 A;  4TT6 A;  5DY7 A;  2ECV A;  3U5O A;  4MR6 A;  1JSP B;  4C66 A;  5F25 A;  4A9N A;  5KH7 A;  4XUA A;  1BOR A;  2YYN A;  5TRB A;  2MIQ A;  2H60 A;  3Q2F A;  2D82 A;  5BT5 A;  2VJF A;  3SVH A;  4A49 A;  2L80 A;  5HLS A;  3IU5 A;  5BT4 A;  4HBY A;  4Y03 A;  4ZQL A;  4UP5 A;  4MEO A;  2CKL A;  4NR7 A;  4UYF A;  5B8D A;  5DKD A;  4R8P K;  4MR5 A;  3N9L A;  4MSX A;  4OGJ A;  2KTB B;  4QUT A;  3LRQ A;  5CTL A;  4YBM A;  5ENE A;  5HJC A;  3O33 A;  1X0J A;  4QC1 A;  4Z1S A;  5FG6 A;  4XI1 A;  5L97 A;  4FJC A;  4GPJ A;  2F6N A;  5ENF A;  5F36 A;  5D3P A;  5EPB A;  5LCW B;  5FDZ A;  1VD4 A;  2ECW A;  4TQN A;  2L84 A;  5E9M A;  5ACY A;  3SVG A;  4WHW A;  1WIM A;  3NXB A;  2EA6 A;  5C4Q A;  4NUE A;  4LZ2 A;  2NXB A;  4YK0 A;  5EWH A;  5D3T A;  4QSQ A;  5E73 A;  5EIS A;  3HTK C;  4HXO A;  3DQV R;  2MUM A;  3L1X A;  2AN6 A;  2RNX A;  4YYG A;  3SOU A;  5ENI A;  2KRE A;  5E9Y A;  5JG6 A;  5CZG A;  2LV9 A;  5FH8 A;  5A85 A;  2OSS A;  5DW1 A;  4AYC A;  5G4R A;  5FEY A;  4QC3 A;  4QF3 A;  2LRI C;  5CQ6 A;  5FE1 A;  3ZYQ A;  2LQ6 A;  2Y1M A;  1JM7 B;  3UVD A;  5HFR A;  4FIP A;  4O7C A;  3S91 A;  4BW4 A;  4BW3 A;  4Z6I A;  5FE7 A;  5DLX A;  3T6R A;  5DFB A;  4MEN A;  4LZS A;  4UYH A;  5LKX A;  4O74 A;  5DFC A;  2PNX A;  2DVR A;  2DVV A;  2DKW A;  4PCI A;  4YC9 A;  2VPG A;  5EGU A;  4TT2 A;  5FH7 A;  2RS9 B;  5CUC A;  4HXK A;  5A5N A;  3HMF A;  4E96 A;  2YQD A;  1WEV A;  3O7A A;  2HDP A;  5KTW A;  2D9E A;  4NYX A;  4XYA A;  3SOW A;  1WEE A;  2OUO A;  2EGP A;  2YUC A;  5ENB A;  4LAD B;  2RO1 A;  3N9Q A;  2VPD A;  5E3G A;  4N4G A;  5L8T A;  4NUD A;  1HYI A;  5G0F A;  4C67 A;  2YSM A;  4CFK A;  1X4J A;  4ZW1 A;  5B78 A;  4ZUX U;  3UVX A;  3UW9 A;  5HM0 A;  2N9G A;  2E7O A;  4O70 A;  2BAY A;  1X4I A;  5TCM A;  4IOO A;  5IGK A;  4QR5 A;  3MUK A;  3HCT A;  4QSX A;  4I7D A;  4A9K A;  2GRC A;  5HQ7 A;  2K4D A;  1N87 A;  4HXL A;  4N3W A;  5IG6 A;  5FH6 A;  4NXJ A;  2L5U A;  5KU3 A;  4A9M A;  4QSS A;  5C8G A;  2YT5 A;  5CQ4 A;  2IDA A;  2LGV A;  2QIC A;  4CUS A;  5L99 A;  4QSU A;  1T1H A;  4LK9 A;  4IR6 A;  4TZ8 A;  5DW2 A;  1Z60 A;  2CSZ A;  5HCL A;  3U5K A;  4HXR A;  3M62 A;  5L8U A;  2YU4 A;  4YYM A;  1E6I A;  3P1C A;  4N4F A;  2LXH C;  1VFY A;  2VNF A;  1WUM A;  2YQM A;  5JWM A;  5DX4 A;  5L98 A;  5KHM A;  5D1K B;  2L0B A;  4P5O B;  4B86 C;  3AAD A;  5CUA A;  5II2 A;  4Z6H A;  3N9O A;  4NR8 A;  2DWW A;  4RVR A;  4F3I A;  2L5E A;  2YEK A;  4QR3 A;  5B77 A;  4L7X A;  3VK6 A;  5FG5 A;  2XEU A;  5G05 B;  2YYR A;  4AVX A;  4PKL A;  5KO4 A;  2PUY A;  5F1H A;  1WFK A;  4PTB A;  2K1J A;  2M3H A;  4R7E A;  4YAX A;  2MD7 B;  4KCX A;  3GL6 A;  4UIU A;  3RCW A;  4YY4 A;  3LQI A;  4A9H A;  2YHO A;  3UV2 A;  5EPS A;  4YBS A;  2I50 A;  3FKM X;  3U5M A;  5HFQ A;  4YYN A;  5A7C A;  4BW2 A;  5H1T A;  1WIL A;  4YYH A;  3GV4 A;  4O72 A; 
#chains in the Genus database with same CATH topology
 4FLP A;  5DYX A;  3I2D A;  5C89 A;  3KV5 A;  2MJV B;  2WP2 A;  4TS8 A;  1MM3 A;  3P1F A;  3O36 A;  5F1L A;  3G0L A;  2DX8 A;  5D3L A;  2FUU A;  1JOC A;  4A9F A;  5D24 A;  2ECI A;  5D26 A;  5CY9 A;  3E2D A;  2ECG A;  4A9O A;  2XOY A;  4ZC9 A;  3U5L A;  5EIC A;  4YYK A;  5TDR A;  4YY6 A;  4A9J A;  3PUR A;  2G6Q A;  1LDK C;  2VPB A;  5LUU A;  2IQJ A;  4LJN A;  4UP0 A;  5FE9 A;  4ALG A;  5IGM A;  5CP5 A;  5EVA A;  5KTU A;  1VYX A;  5EK9 A;  4PS5 A;  5EWD A;  4WHU A;  5DBM A;  5KH3 A;  1WEO A;  5HRW A;  5CQ8 A;  2VJE B;  5AMF A;  5CQ5 A;  5B76 A;  2ECN A;  4CUQ A;  4B7Y C;  2OO1 A;  5FFY A;  4O75 A;  4PCE A;  4GB0 A;  4NR6 A;  4MR3 A;  3RPG B;  4CA1 A;  1F68 A;  4NRC A;  5E74 A;  5LKU A;  1WEP A;  5D1M B;  4UIY A;  5EPR A;  4Q0O A;  4TKP B;  4AKG A;  2VP7 A;  4J1P A;  1F62 A;  4OUF A;  4O71 A;  2OXQ C;  4O64 A;  2R0S A;  3Q2E A;  4YAT A;  5F2P A;  4A9E A;  3NG2 A;  4LLB A;  5CGP A;  4UIW A;  1FBV A;  2LN0 A;  5EWV A;  2YVR A;  4KV4 A;  2G45 A;  2JMD A;  5C85 A;  5I7Y A;  5DYC A;  4I7B A;  5D3R A;  4I7C A;  5DKH A;  5SVX A;  4NQM A;  5I40 A;  3N9M A;  5J3X A;  2QIZ A;  3DPL R;  1G25 A;  3PUQ A;  5HEM A;  3N9P A;  5DIN A;  5FFW A;  1LDJ B;  4CCG X;  5H1U A;  5SVI B;  4LYS A;  4FO9 A;  2KKX A;  2Y43 A;  3P1D A;  4NR9 A;  4QSW A;  3C6W A;  4QEW A;  3RTR B;  5A82 A;  2E6R A;  5TDW A;  5IGN A;  2EGM A;  2JUN A;  3N9N A;  5EU1 A;  3O47 A;  5HRX A;  4WZ0 A;  1WUG A;  3DAI A;  4A0C D;  2RNY A;  5TBN A;  2EXU A;  5LJ0 A;  5HRV A;  2G4A A;  4A9L A;  2B0O E;  3M99 A;  5LJ2 A;  3UV4 A;  3VKG A;  2LGL A;  3QZV A;  4HBV A;  2KWJ A;  3L1Z B;  5LJ1 A;  1CHC A;  4HBX A;  4IOQ A;  5AD3 A;  4YAB A;  5F5Z A;  5A5O A;  4LRG A;  2NAA A;  3LVQ E;  2I7K A;  3C5K A;  4Z93 A;  5FE8 A;  4O76 A;  5CU8 A;  4OGC A;  4Q6F A;  5EM3 A;  4QSV A;  4FK5 A;  4QBM A;  4LZR A;  5CFW A;  2C2V S;  2YQL A;  4X3G A;  5DLZ A;  5LVR A;  3ZNI A;  3JVJ A;  5DKA A;  2RNW A;  1U6G B;  2MA5 A;  2YEM A;  4TU4 A;  5HEN A;  2L7P A;  5B79 A;  2ZET C;  2LGK A;  5A5S A;  4A9I A;  3M63 A;  4A4C A;  2E6S A;  5B75 A;  4QYD A;  4O62 A;  4C9Z A;  3MUL A;  5D3N A;  2DJA A;  2D8S A;  2MT5 A;  3O35 A;  4WIV A;  3V43 A;  2L43 A;  1JM7 A;  4O78 A;  5DKC A;  4XY8 A;  5F60 A;  4O77 A;  4N4I A;  5I83 A;  3FJU B;  4NR4 A;  5CUG A;  5FE5 A;  2OWA A;  4Z0O A;  4XY9 A;  4LYI A;  4HXN A;  2CSV A;  5SVI A;  4BW1 A;  5I80 A;  4LR6 A;  4O7B A;  5FE4 A;  5ENH A;  4BJX A;  5KH9 A;  5H85 A;  5CRM A;  5LKZ A;  5D1L B;  1XWH A;  2RSD A;  3FAN A;  2VJF B;  5A5Q A;  2JMI A;  4YYJ A;  4UIT A;  1FP0 A;  4X2I A;  4UYD A;  2P57 A;  5FFV A;  2YRE A;  5FE3 A;  2CKL B;  4UYF B;  4O7A A;  1WEQ A;  3ONI A;  4QZS A;  4YH3 A;  3D1B A;  4CLB A;  1ZBD B;  2KWN A;  2YSJ A;  5EV9 A;  3KV6 A;  4QUU A;  4NRB A;  2MD8 C;  4CUP A;  4IC3 A;  4KV1 A;  5EWW A;  2H0D B;  2QJ0 A;  4QSP A;  2FD4 A;  5EP7 A;  4OGI A;  2YW8 A;  4O7E A;  3EB6 A;  3LJU X;  5I3L A;  1WEM A;  2ECT A;  4TTE A;  3AQA A;  5LKT A;  3ZPV E;  3D1D A;  3JVM A;  3MB3 A;  5AD2 A;  5FG4 A;  5A5R A;  1WEN A;  5DYA A;  2UZG A;  5EYA F;  3I3J A;  2YW5 A;  2ECJ A;  5IID A;  4CUU A;  3MXF A;  3U5N A;  5I86 A;  2FSA A;  3KQI A;  4NYW A;  1N72 A;  2L75 A;  3MHH A;  2XB1 A;  4QF2 A;  4CL9 A;  2CSY A;  4Q0N A;  2KGI A;  2I8N A;  5ETD A;  5A5P A;  4MEP A;  3JVL A;  5I89 A;  3O70 A;  5F63 A;  4J3I A;  5K29 A;  3O34 A;  2R0V A;  4QNS A;  5F62 A;  5COI A;  2F42 A;  5CUD A;  5CQ7 A;  5J0D A;  3UVY A;  4A4B A;  4AP4 A;  2CRW A;  4YBT A;  2YHN A;  1IYM A;  4HXM A;  4AYC B;  4HXS A;  3Q1D A;  4NQN A;  5KTX A;  4TZ2 A;  2XOC A;  2WP1 A;  4V3K C;  4DON A;  4QQ4 A;  4QYL A;  4QEV A;  4IR5 A;  3MQM A;  3DWD A;  4L58 A;  3RPG C;  2YDW A;  2RFJ A;  4TT4 A;  5CQT A;  4Z0R A;  3QZT A;  3TLP A;  3ZTG A;  3LQJ A;  3HME A;  5FE6 A;  2M6M A;  4F1P A;  5G04 B;  2MNY A;  4PY6 A;  5H1V A;  4NN2 A;  4IR3 A;  5EQ1 A;  5E9I A;  1WE9 A;  2H0D A;  1V87 A;  3ZYU A;  2C2L A;  4WA6 A;  4XUB A;  3HMH A;  5G4S A;  5HEL A;  2HYE D;  5F61 A;  3LQH A;  3O37 A;  4QEU A;  5FB1 A;  1Z6U A;  2YUR A;  4IOR A;  5ETB A;  4ALH A;  4O7F A;  5ENJ A;  5I88 A;  2E61 A;  3KNV A;  3PLW A;  2CT2 A;  4IR4 A;  4CFL A;  5L96 A;  1DCQ A;  2JM3 A;  5AIT A;  2KR4 A;  4F52 B;  3MB4 A;  5CRZ A;  4BHW A;  3SOX A;  4AI6 A;  3T9K A;  4PPE A;  3FM8 C;  1WES A;  3IU6 A;  2KGG A;  5D7X A;  2KIZ A;  4NR5 A;  4HBW A;  3JVK A;  2JRJ A;  3FL2 A;  1X4U A;  5JI8 A;  5F3A A;  5AME A;  2LXP C;  4AKI A;  4AUQ B;  2R0Y A;  5FB0 A;  3KDE C;  2KU3 A;  3HCS A;  2JMJ A;  4CUR A;  4LDF A;  1MM2 A;  3DWY A;  5DYU A;  5HQ6 A;  2YEL A;  3S92 A;  4UI9 B;  4NUC A;  2FUI A;  5E9L A;  2VJE A;  3MDB C;  5D25 A;  1EQF A;  5D3J A;  4R2Y A;  1ZS5 A;  4UIX A;  5E9K A;  2M85 A;  4WZ3 B;  5D0C A;  2EOD A;  4CUT A;  5I1Q A;  5EI4 A;  5TB6 A;  4NRA A;  5LVQ A;  4MR4 A;  5E9V A;  4QSR A;  2DAT A;  3L11 A;  4AKH A;  5SVY A;  4W4U A;  2CON A;  5HQ5 A;  3T7L A;  3IHP A;  2F6J A;  3P1E A;  2KE1 A;  4WZ2 A;  2KFT A;  5EWC A;  4YYI A;  1K2F A;  4GNF A;  3LXJ A;  1DVP A;  3GG3 A;  5AIU A;  3K2J A;  1E4U A;  2L85 A;  3UV5 A;  5TAB A;  5E3D A;  2XP0 A;  3ZVZ B;  2R10 A;  3EB5 A;  4LC2 A;  5IGL A;  4HXP A;  5E7D A;  4QST A;  2DVQ A;  5DFD A;  5I7X A;  2D8U A;  4AKN A;  5IBN A;  5C87 A;  4NS5 A;  4QB3 A;  3HCU A;  2RI7 A;  4QY4 A;  4TU6 A;  5CUE A;  5A83 A;  4J0R A;  2LGG A;  3U5P A;  1WGM A;  4GNG A;  3SHB A;  5BT3 A;  2LDR A;  3ZVY A;  5CQ3 A;  4Z1Q A;  2G43 A;  5E0R A;  1PUO A;  5CQA A;  5H9M A;  5EA1 A;  5D3S A;  2E3K A;  2MA6 A;  4J0S A;  4LYW A;  3QZS A;  2K17 A;  2VPE A;  3UVW A;  5CUB A;  2M1R A;  3G0J A;  4N4H A;  5ENG A;  5C11 A;  2KWK A;  5ENC A;  2DSM A;  2MNZ A;  4NYV A;  4QR4 A;  3P5O A;  5D3H A;  4IC2 A;  3LJW A;  2E7N A;  4UIV A;  1RMD A;  3PHD A;  5A81 A;  2K16 A;  3ZPV 1;  3D7C A;  4GND A;  4ZDT A;  1JM4 B;  5FE0 A;  2Y1N A;  2XOZ A;  5FE2 A;  3ASL A;  4V3L C;  4UYG A;  1WEU A;  3MHS A;  4YH4 A;  4LKA A;  5CPE A;  4MEQ A;  1Z2Q A;  4TYL A;  3SVF A;  4OGE A;  5II1 A;  4S3O C;  3VKH A;  4UYE A;  1HYJ A;  5FBX A;  2KYU A;  4GNE A;  2DVS A;  4UIZ A;  4YYD A;  4YAD A;  3FEH A;  5C7N A;  4BBQ A;  2LSP B;  4S3O B;  3U5J A;  5C13 A;  4MVT A;  5FER A;  1WEW A;  5I29 A;  2KWO A;  5CS8 A;  4TT6 A;  5DY7 A;  2ECV A;  3U5O A;  4MR6 A;  1JSP B;  4C66 A;  5F25 A;  4A9N A;  5KH7 A;  4XUA A;  1BOR A;  2YYN A;  5TRB A;  2MIQ A;  2H60 A;  3Q2F A;  2D82 A;  5BT5 A;  2VJF A;  3SVH A;  4A49 A;  2L80 A;  2M13 A;  5HLS A;  3IU5 A;  5BT4 A;  4HBY A;  4Y03 A;  4ZQL A;  4UP5 A;  4MEO A;  2CKL A;  4NR7 A;  4UYF A;  5B8D A;  5DKD A;  4R8P K;  4MR5 A;  3N9L A;  4MSX A;  4OGJ A;  2KTB B;  4QUT A;  3LRQ A;  5CTL A;  4YBM A;  5ENE A;  5HJC A;  3O33 A;  1X0J A;  2MKE A;  4QC1 A;  4Z1S A;  5FG6 A;  4XI1 A;  5L97 A;  4FJC A;  4GPJ A;  2F6N A;  5ENF A;  5F36 A;  5D3P A;  5EPB A;  5LCW B;  5FDZ A;  1VD4 A;  2ECW A;  2KKY A;  4TQN A;  2L84 A;  5E9M A;  5ACY A;  3SVG A;  4WHW A;  1WIM A;  3NXB A;  2EA6 A;  5C4Q A;  2EJN A;  4NUE A;  4LZ2 A;  2NXB A;  4YK0 A;  5EWH A;  5D3T A;  4QSQ A;  5E73 A;  5EIS A;  3HTK C;  4HXO A;  3DQV R;  2MUM A;  3JUE A;  3L1X A;  3ERR A;  2AN6 A;  3M7K A;  2RNX A;  4YYG A;  3SOU A;  5ENI A;  2KRE A;  5E9Y A;  5JG6 A;  5CZG A;  2LV9 A;  5FH8 A;  5A85 A;  2OSS A;  5DW1 A;  4AYC A;  5G4R A;  5FEY A;  4QC3 A;  4QF3 A;  2LRI C;  5CQ6 A;  5FE1 A;  2FFW A;  2LQ6 A;  2LAU A;  2Y1M A;  3ZYQ A;  1JM7 B;  3UVD A;  5HFR A;  4FIP A;  4O7C A;  3S91 A;  4BW4 A;  4BW3 A;  3SUB A;  4Z6I A;  5FE7 A;  5DLX A;  3T6R A;  5DFB A;  4MEN A;  4LZS A;  4UYH A;  5LKX A;  4O74 A;  5DFC A;  2PNX A;  2DVR A;  2DVV A;  2DKW A;  4PCI A;  4YC9 A;  2VPG A;  5EGU A;  4TT2 A;  5FH7 A;  2RS9 B;  5CUC A;  4HXK A;  5A5N A;  3HMF A;  4E96 A;  2YQD A;  1WEV A;  3O7A A;  2HDP A;  5KTW A;  2D9E A;  4NYX A;  4XYA A;  3SOW A;  1WEE A;  2OUO A;  2EGP A;  2YUC A;  5ENB A;  4LAD B;  2RO1 A;  3N9Q A;  2VPD A;  5E3G A;  4N4G A;  5L8T A;  4NUD A;  1HYI A;  5G0F A;  4C67 A;  2YSM A;  4CFK A;  1X4J A;  4ZW1 A;  2RR4 A;  5B78 A;  4ZUX U;  3UVX A;  3UW9 A;  5HM0 A;  2N9G A;  2E7O A;  4O70 A;  2BAY A;  1X4I A;  5TCM A;  4IOO A;  5IGK A;  4QR5 A;  3MUK A;  3HCT A;  4QSX A;  4I7D A;  4A9K A;  2GRC A;  5HQ7 A;  3H7H A;  2K4D A;  1N87 A;  4HXL A;  4N3W A;  5IG6 A;  5FH6 A;  4NXJ A;  2L5U A;  5KU3 A;  4A9M A;  4QSS A;  5C8G A;  2YT5 A;  5CQ4 A;  2IDA A;  2LGV A;  1MBM A;  2QIC A;  3DDT A;  4CUS A;  5L99 A;  4QSU A;  1T1H A;  4LK9 A;  4IR6 A;  4TZ8 A;  5DW2 A;  1Z60 A;  2CSZ A;  5HCL A;  3U5K A;  4HXR A;  3M62 A;  5L8U A;  2YU4 A;  4YYM A;  1E6I A;  3P1C A;  4N4F A;  2LXH C;  3LDY A;  1VFY A;  2VNF A;  1WUM A;  2YQM A;  5JWM A;  5DX4 A;  5L98 A;  5KHM A;  5D1K B;  2L0B A;  2CRR A;  4P5O B;  4B86 C;  4H9D A;  3AAD A;  5CUA A;  5II2 A;  4Z6H A;  3N9O A;  4NR8 A;  5K3Q A;  2DWW A;  4RVR A;  4F3I A;  2L5E A;  2YEK A;  4QR3 A;  5B77 A;  4L7X A;  3VK6 A;  5FG5 A;  2XEU A;  5G05 B;  2YYR A;  4AVX A;  4PKL A;  5KO4 A;  2PUY A;  5F1H A;  1WFK A;  4PTB A;  2K1J A;  2M3H A;  4R7E A;  4YAX A;  2MD7 B;  4KCX A;  3FAO A;  3GL6 A;  3LVR E;  4UIU A;  3RCW A;  4YY4 A;  3LQI A;  4A9H A;  2YHO A;  3UV2 A;  5EPS A;  4YBS A;  2I50 A;  3FKM X;  3U5M A;  5HFQ A;  4YYN A;  5A7C A;  4BW2 A;  1ZKR A;  5H1T A;  1WIL A;  4YYH A;  3GV4 A;  4O72 A; 
#chains in the Genus database with same CATH homology
 4FLP A;  5DYX A;  3I2D A;  5C89 A;  3KV5 A;  2MJV B;  2WP2 A;  4TS8 A;  1MM3 A;  3P1F A;  3O36 A;  5F1L A;  3G0L A;  2DX8 A;  5D3L A;  2FUU A;  1JOC A;  4A9F A;  5D24 A;  2ECI A;  5D26 A;  5CY9 A;  2ECG A;  4A9O A;  4ZC9 A;  3U5L A;  5EIC A;  4YYK A;  5TDR A;  4YY6 A;  4A9J A;  3PUR A;  2G6Q A;  1LDK C;  2VPB A;  5LUU A;  4LJN A;  4UP0 A;  5FE9 A;  4ALG A;  5IGM A;  5CP5 A;  5EVA A;  5KTU A;  1VYX A;  5EK9 A;  4PS5 A;  5EWD A;  4WHU A;  5DBM A;  5KH3 A;  1WEO A;  5HRW A;  5CQ8 A;  2VJE B;  5AMF A;  5CQ5 A;  5B76 A;  2ECN A;  4CUQ A;  4B7Y C;  2OO1 A;  5FFY A;  4O75 A;  4PCE A;  4GB0 A;  4NR6 A;  4MR3 A;  3RPG B;  4CA1 A;  1F68 A;  4NRC A;  5E74 A;  5LKU A;  1WEP A;  5D1M B;  4UIY A;  5EPR A;  4Q0O A;  4TKP B;  2VP7 A;  4J1P A;  1F62 A;  4OUF A;  4O71 A;  2OXQ C;  4O64 A;  2R0S A;  3Q2E A;  4YAT A;  5F2P A;  4A9E A;  3NG2 A;  4LLB A;  5CGP A;  4UIW A;  1FBV A;  2LN0 A;  5EWV A;  4KV4 A;  2G45 A;  2JMD A;  5C85 A;  5I7Y A;  5DYC A;  4I7B A;  5D3R A;  4I7C A;  5DKH A;  4NQM A;  5I40 A;  3N9M A;  5J3X A;  2QIZ A;  3DPL R;  1G25 A;  3PUQ A;  5HEM A;  3N9P A;  5DIN A;  5FFW A;  1LDJ B;  4CCG X;  5H1U A;  4LYS A;  4FO9 A;  2Y43 A;  3P1D A;  4NR9 A;  4QSW A;  3C6W A;  4QEW A;  3RTR B;  5A82 A;  2E6R A;  5TDW A;  5IGN A;  3N9N A;  5EU1 A;  5HRX A;  4WZ0 A;  1WUG A;  3DAI A;  4A0C D;  2RNY A;  5TBN A;  5LJ0 A;  5HRV A;  2G4A A;  4A9L A;  3M99 A;  5LJ2 A;  3UV4 A;  2LGL A;  3QZV A;  4HBV A;  2KWJ A;  3L1Z B;  5LJ1 A;  1CHC A;  4HBX A;  4IOQ A;  5AD3 A;  4YAB A;  5F5Z A;  5A5O A;  4LRG A;  2NAA A;  2I7K A;  3C5K A;  4Z93 A;  5FE8 A;  4O76 A;  5CU8 A;  4Q6F A;  5EM3 A;  4QSV A;  4FK5 A;  4QBM A;  4LZR A;  5CFW A;  2C2V S;  2YQL A;  4X3G A;  5DLZ A;  5LVR A;  3ZNI A;  3JVJ A;  5DKA A;  2RNW A;  1U6G B;  2MA5 A;  2YEM A;  4TU4 A;  5HEN A;  5B79 A;  2ZET C;  2LGK A;  5A5S A;  4A9I A;  3M63 A;  4A4C A;  2E6S A;  5B75 A;  4QYD A;  4C9Z A;  3MUL A;  5D3N A;  2D8S A;  2MT5 A;  3O35 A;  4WIV A;  3V43 A;  2L43 A;  1JM7 A;  4O78 A;  5DKC A;  4XY8 A;  5F60 A;  4O77 A;  4N4I A;  5I83 A;  4NR4 A;  5CUG A;  5FE5 A;  4XY9 A;  4LYI A;  4HXN A;  4BW1 A;  5I80 A;  4LR6 A;  4O7B A;  5FE4 A;  5ENH A;  4BJX A;  5KH9 A;  5H85 A;  5CRM A;  5LKZ A;  5D1L B;  1XWH A;  2RSD A;  2VJF B;  5A5Q A;  2JMI A;  4YYJ A;  4UIT A;  1FP0 A;  4X2I A;  4UYD A;  5FFV A;  2YRE A;  5FE3 A;  2CKL B;  4UYF B;  4O7A A;  1WEQ A;  3ONI A;  4QZS A;  4YH3 A;  4CLB A;  2KWN A;  1ZBD B;  2YSJ A;  5EV9 A;  3KV6 A;  4QUU A;  4NRB A;  2MD8 C;  4CUP A;  4IC3 A;  4KV1 A;  5EWW A;  2H0D B;  2QJ0 A;  4QSP A;  5I3L A;  5EP7 A;  4OGI A;  2YW8 A;  4O7E A;  3EB6 A;  1WEM A;  2ECT A;  4TTE A;  3AQA A;  5LKT A;  3ZPV E;  3JVM A;  3MB3 A;  5AD2 A;  5FG4 A;  5A5R A;  1WEN A;  5DYA A;  2UZG A;  5EYA F;  3I3J A;  2YW5 A;  2ECJ A;  5IID A;  4CUU A;  3MXF A;  3U5N A;  5I86 A;  2FSA A;  3KQI A;  4NYW A;  1N72 A;  2L75 A;  3MHH A;  2XB1 A;  4QF2 A;  4CL9 A;  2CSY A;  4Q0N A;  2KGI A;  2I8N A;  5ETD A;  5A5P A;  4MEP A;  3JVL A;  5I89 A;  3O70 A;  5F63 A;  4J3I A;  5K29 A;  3O34 A;  2R0V A;  4QNS A;  5F62 A;  5COI A;  2F42 A;  5CUD A;  5CQ7 A;  5J0D A;  3UVY A;  4A4B A;  4AP4 A;  4YBT A;  2YHN A;  1IYM A;  4HXM A;  4AYC B;  4HXS A;  4NQN A;  5KTX A;  4TZ2 A;  2WP1 A;  4V3K C;  4DON A;  4QYL A;  4QEV A;  4IR5 A;  3MQM A;  4L58 A;  3RPG C;  2YDW A;  2RFJ A;  4TT4 A;  5CQT A;  3QZT A;  3TLP A;  3ZTG A;  3LQJ A;  3HME A;  5FE6 A;  2M6M A;  5G04 B;  2MNY A;  4PY6 A;  5H1V A;  4NN2 A;  4IR3 A;  5EQ1 A;  5E9I A;  1WE9 A;  2H0D A;  1V87 A;  3ZYU A;  2C2L A;  4WA6 A;  4XUB A;  3HMH A;  5G4S A;  5HEL A;  2HYE D;  5F61 A;  3LQH A;  3O37 A;  4QEU A;  5FB1 A;  1Z6U A;  2YUR A;  4IOR A;  5ETB A;  4ALH A;  4O7F A;  5ENJ A;  5I88 A;  3KNV A;  2CT2 A;  4IR4 A;  4CFL A;  5L96 A;  5AIT A;  2KR4 A;  4F52 B;  3MB4 A;  5CRZ A;  4BHW A;  3SOX A;  4PPE A;  1WES A;  3IU6 A;  2KGG A;  5D7X A;  2KIZ A;  4NR5 A;  4HBW A;  3JVK A;  2JRJ A;  3FL2 A;  1X4U A;  5JI8 A;  5F3A A;  5AME A;  2LXP C;  4AUQ B;  2R0Y A;  5FB0 A;  2KU3 A;  3HCS A;  2JMJ A;  4CUR A;  4LDF A;  1MM2 A;  3DWY A;  5DYU A;  5HQ6 A;  2YEL A;  3S92 A;  4UI9 B;  4NUC A;  2FUI A;  5E9L A;  2VJE A;  5D25 A;  1EQF A;  5D3J A;  4R2Y A;  1ZS5 A;  4UIX A;  5E9K A;  2M85 A;  4WZ3 B;  5D0C A;  2EOD A;  4CUT A;  5I1Q A;  5EI4 A;  5TB6 A;  4NRA A;  5LVQ A;  4MR4 A;  5E9V A;  4QSR A;  2DAT A;  3L11 A;  4W4U A;  3T7L A;  5HQ5 A;  3IHP A;  2F6J A;  3P1E A;  2KE1 A;  4WZ2 A;  2KFT A;  5EWC A;  4YYI A;  1K2F A;  4GNF A;  3LXJ A;  1DVP A;  3GG3 A;  5AIU A;  3K2J A;  1E4U A;  2L85 A;  3UV5 A;  5TAB A;  5E3D A;  3ZVZ B;  2R10 A;  3EB5 A;  4LC2 A;  5IGL A;  4HXP A;  5E7D A;  4QST A;  2DVQ A;  5DFD A;  5I7X A;  4AKN A;  5IBN A;  5C87 A;  4NS5 A;  4QB3 A;  3HCU A;  2RI7 A;  4QY4 A;  4TU6 A;  5CUE A;  5A83 A;  4J0R A;  2LGG A;  3U5P A;  1WGM A;  4GNG A;  3SHB A;  5BT3 A;  2LDR A;  3ZVY A;  5CQ3 A;  4Z1Q A;  2G43 A;  5E0R A;  5CQA A;  5H9M A;  5EA1 A;  5D3S A;  2E3K A;  2MA6 A;  4J0S A;  4LYW A;  3QZS A;  2K17 A;  2VPE A;  3UVW A;  5CUB A;  2M1R A;  3G0J A;  4N4H A;  5ENG A;  5C11 A;  2KWK A;  5ENC A;  2MNZ A;  4NYV A;  4QR4 A;  3P5O A;  5D3H A;  4IC2 A;  3LJW A;  2E7N A;  4UIV A;  1RMD A;  3PHD A;  5A81 A;  2K16 A;  3ZPV 1;  3D7C A;  4GND A;  4ZDT A;  1JM4 B;  5FE0 A;  2Y1N A;  3ASL A;  5FE2 A;  4V3L C;  4UYG A;  1WEU A;  3MHS A;  4YH4 A;  4LKA A;  5CPE A;  4MEQ A;  1Z2Q A;  4TYL A;  3SVF A;  5II1 A;  4S3O C;  4UYE A;  1HYJ A;  5FBX A;  2KYU A;  4GNE A;  2DVS A;  4UIZ A;  4YYD A;  4YAD A;  5C7N A;  4BBQ A;  2LSP B;  4S3O B;  3U5J A;  5C13 A;  4MVT A;  5FER A;  1WEW A;  5I29 A;  2KWO A;  5CS8 A;  4TT6 A;  5DY7 A;  2ECV A;  3U5O A;  4MR6 A;  1JSP B;  4C66 A;  5F25 A;  4A9N A;  5KH7 A;  4XUA A;  1BOR A;  2YYN A;  5TRB A;  2MIQ A;  2H60 A;  3Q2F A;  2D82 A;  5BT5 A;  2VJF A;  3SVH A;  4A49 A;  2L80 A;  5HLS A;  3IU5 A;  5BT4 A;  4HBY A;  4Y03 A;  4ZQL A;  4UP5 A;  4MEO A;  2CKL A;  4NR7 A;  4UYF A;  5B8D A;  5DKD A;  4R8P K;  4MR5 A;  3N9L A;  4MSX A;  4OGJ A;  2KTB B;  4QUT A;  3LRQ A;  5CTL A;  4YBM A;  5ENE A;  5HJC A;  3O33 A;  1X0J A;  4QC1 A;  4Z1S A;  5FG6 A;  4XI1 A;  5L97 A;  4FJC A;  4GPJ A;  2F6N A;  5ENF A;  5F36 A;  5D3P A;  5EPB A;  5LCW B;  5FDZ A;  1VD4 A;  2ECW A;  4TQN A;  2L84 A;  5E9M A;  5ACY A;  3SVG A;  4WHW A;  1WIM A;  3NXB A;  2EA6 A;  5C4Q A;  4NUE A;  4LZ2 A;  2NXB A;  4YK0 A;  5EWH A;  5D3T A;  4QSQ A;  5E73 A;  5EIS A;  3HTK C;  4HXO A;  3DQV R;  2MUM A;  3L1X A;  2AN6 A;  2RNX A;  4YYG A;  3SOU A;  5ENI A;  2KRE A;  5E9Y A;  5JG6 A;  5CZG A;  2LV9 A;  5FH8 A;  5A85 A;  2OSS A;  5DW1 A;  4AYC A;  5G4R A;  5FEY A;  4QC3 A;  4QF3 A;  2LRI C;  5CQ6 A;  5FE1 A;  3ZYQ A;  2LQ6 A;  2Y1M A;  1JM7 B;  3UVD A;  5HFR A;  4FIP A;  4O7C A;  3S91 A;  4BW4 A;  4BW3 A;  4Z6I A;  5FE7 A;  5DLX A;  3T6R A;  5DFB A;  4MEN A;  4LZS A;  4UYH A;  5LKX A;  4O74 A;  5DFC A;  2PNX A;  2DVR A;  2DVV A;  2DKW A;  4PCI A;  4YC9 A;  2VPG A;  5EGU A;  4TT2 A;  5FH7 A;  2RS9 B;  5CUC A;  4HXK A;  5A5N A;  3HMF A;  4E96 A;  2YQD A;  1WEV A;  3O7A A;  2HDP A;  5KTW A;  2D9E A;  4NYX A;  4XYA A;  3SOW A;  1WEE A;  2OUO A;  2EGP A;  2YUC A;  5ENB A;  4LAD B;  2RO1 A;  3N9Q A;  2VPD A;  5E3G A;  4N4G A;  5L8T A;  4NUD A;  1HYI A;  5G0F A;  4C67 A;  2YSM A;  4CFK A;  1X4J A;  4ZW1 A;  5B78 A;  4ZUX U;  3UVX A;  3UW9 A;  5HM0 A;  2N9G A;  2E7O A;  4O70 A;  2BAY A;  1X4I A;  5TCM A;  4IOO A;  5IGK A;  4QR5 A;  3MUK A;  3HCT A;  4QSX A;  4I7D A;  4A9K A;  2GRC A;  5HQ7 A;  2K4D A;  1N87 A;  4HXL A;  4N3W A;  5IG6 A;  5FH6 A;  4NXJ A;  2L5U A;  5KU3 A;  4A9M A;  4QSS A;  5C8G A;  2YT5 A;  5CQ4 A;  2IDA A;  2LGV A;  2QIC A;  4CUS A;  5L99 A;  4QSU A;  1T1H A;  4LK9 A;  4IR6 A;  4TZ8 A;  5DW2 A;  1Z60 A;  2CSZ A;  5HCL A;  3U5K A;  4HXR A;  3M62 A;  5L8U A;  2YU4 A;  4YYM A;  1E6I A;  3P1C A;  4N4F A;  2LXH C;  1VFY A;  2VNF A;  1WUM A;  2YQM A;  5JWM A;  5DX4 A;  5L98 A;  5KHM A;  5D1K B;  2L0B A;  4P5O B;  4B86 C;  3AAD A;  5CUA A;  5II2 A;  4Z6H A;  3N9O A;  4NR8 A;  2DWW A;  4RVR A;  4F3I A;  2L5E A;  2YEK A;  4QR3 A;  5B77 A;  4L7X A;  3VK6 A;  5FG5 A;  2XEU A;  5G05 B;  2YYR A;  4AVX A;  4PKL A;  5KO4 A;  2PUY A;  5F1H A;  1WFK A;  4PTB A;  2K1J A;  2M3H A;  4R7E A;  4YAX A;  2MD7 B;  4KCX A;  3GL6 A;  4UIU A;  3RCW A;  4YY4 A;  3LQI A;  4A9H A;  2YHO A;  3UV2 A;  5EPS A;  4YBS A;  2I50 A;  3FKM X;  3U5M A;  5HFQ A;  4YYN A;  5A7C A;  4BW2 A;  5H1T A;  1WIL A;  4YYH A;  3GV4 A;  4O72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...