4YBMA

Crystal structure of trim24 phd-bromodomain complexed with n-{6-[3-(benzyloxy)phenoxy]-1,3-dimethyl-2-oxo-2,3-dihydro-1h-1,3-benzodiazol-5-yl}-3,4-dimethoxybenzene-1-sulfonamide (7b)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
183
structure length
177
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 52
structure length 177
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ybmA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ybmA01
3MQMA 4O75A 5EPSA 3PURA 4C9ZA 2K16A 2JMJA 2YEMA 4IR5A 4LZ2A 4YYJA 5HELA 4KV4A 4QC3A 5CQAA 4NUEA 2L80A 2M6MA 4UIYA 2E6SA 5EWHA 4F3IA 1CHCA 2RSDA 2HYED 5EQ1A 2RO1A 2QJ0A 1F62A 4NQNA 4ALHA 4I7DA 4Q6FA 1JM7A 2M85A 4TZ8A 2FUUA 3PUQA 5A85A 5DYUA 4NYXA 5C4QA 1V87A 1WFKA 5TDWA 2RI7A 4HBWA 5F1HA 5LKZA 3DQVR 5FE4A 4CL9A 4E96A 4CUPA 3N9NA 3P1CA 5FDZA 2MUMA 4QSRA 4O71A 1N87A 2CKLB 3KQIA 4V3KC 4NYWA 1G25A 4YYIA 3EB6A 2RS9B 1ZS5A 5F62A 5B77A 2LV9A 5CRMA 4CFKA 5D3SA 2FSAA 3JVKA 4AKNA 2KTBB 3N9LA 5EYAF 3N9OA 5DY7A 4QF2A 3HMHA 5JWMA 2VJEA 3DPLR 4YBSA 3ZPVE 4UP0A 2LQ6A 2VPGA 5KHMA 3L1ZB 4LRGA 4A9NA 5ENBA 3RTRB 5B76A 5CUCA 2KE1A 2LGGA 4UYGA 5DKHA 5A5OA 5D3RA 2RNXA 4ZC9A 4QSTA 4O72A 5F1LA 1WE9A 5C85A 5C87A 2GRCA 4V3LC 4LZRA 4MENA 3O34A 2XB1A 3G0JA 3UW9A 4P5OB 4KV1A 4NN2A 4Z6HA 4MVTA 4ZQLA 4TYLA 4TZ2A 4NYVA 5EWVA 4AUQB 2VJFA 3RPGC 5L97A 5FE1A 3S92A 3Q2FA 5CUGA 5C7NA 5G04B 2MNZA 5A83A 3SOWA 2EODA 4QBMA 4O77A 1MM3A 2L5EA 4YYKA 5JG6A 4I7BA 5KTWA 2KYUA 1HYJA 1Z60A 1VD4A 5DKCA 3LQIA 3MHSA 1K2FA 3O70A 5FFYA 4QR4A 5II2A 2YURA 5L96A 5FERA 4BW4A 5BT3A 4N4FA 4B86C 5F60A 5E9LA 2KREA 5DINA 4YADA 5AITA 5II1A 3T7LA 3U5NA 4TT6A 2LN0A 5CUAA 3GL6A 5D3HA 4QSQA 5CFWA 5J0DA 5L8TA 3GV4A 5LKUA 2E6RA 3Q2EA 2LSPB 2K4DA 5FE5A 5EU1A 4UIUA 4YYHA 3NXBA 5HJCA 5LJ0A 4IR4A 4I7CA 5ENIA 4UYEA 4O70A 4QC1A 5HQ6A 4NR8A 4IC2A 2KGIA 3MULA 5EWDA 2I7KA 3ASLA 4QSWA 5FE0A 5EISA 5F5ZA 4HXNA 4NS5A 4YYNA 4OUFA 2G4AA 5TB6A 4PKLA 2WP1A 2F42A 5CQ4A 4MR6A 3LQHA 3QZTA 3MB4A 2YREA 5E0RA 4LR6A 5IGNA 4UIWA 4PS5A 4TU4A 4O78A 5KTUA 5IGKA 4QR5A 4QUTA 5L98A 5CS8A 1X4IA 2IDAA 3ONIA 4HXOA 4ALGA 5FFWA 5DW1A 1E6IA 2DVQA 4HXSA 4AYCB 4XUBA 5DYCA 5G4SA 1E4UA 5DLZA 3KNVA 4QSSA 4UIXA 5FG4A 5E74A 3FL2A 2YQDA 4FIPA 4A4BA 3O7AA 3SOXA 5B75A 3M62A 4A9KA 1X4UA 2YYRA 5C13A 4GPJA 5HM0A 5DYXA 2KWOA 3MHHA 5LKTA 2YUCA 4NR9A 3VK6A 4IOOA 5I1QA 4MEQA 4LYIA 3ZYQA 5D3PA 5DYAA 4HBXA 1T1HA 5F25A 2VJFB 3V43A 2VPEA 5B78A 2EA6A 1FP0A 2Y43A 4YBMA 5HCLA 2YSMA 3M99A 2DWWA 1RMDA 4FO9A 4AVXA 5HLSA 2R10A 5ENJA 5CRZA 3UV2A 5CGPA 5CU8A 3L11A 4X2IA 4J0SA 4TQNA 5D1MB 5F2PA 2DKWA 4NR5A 5EA1A 5KH7A 4NR7A 4YH4A 5KTXA 3RCWA 2H0DB 1X0JA 5IGLA 3SVGA 2G45A 3NG2A 5FG5A 4CUTA 5ENFA 2L0BA 3GG3A 3P5OA 4Q0NA 5ENEA 4O7AA 5EPBA 2YW5A 4TS8A 5IIDA 4WZ2A 4YYDA 5I7YA 4LDFA 5I7XA 4NUCA 4QSUA 5H9MA 1WUMA 3AADA 2MD7B 4MEOA 2H0DA 5CUBA 5D3NA 4Z1QA 1WEMA 4DONA 4Z1SA 2OO1A 5CZGA 5DFDA 3DAIA 5HQ7A 4QEUA 4CUSA 2KR4A 4GNGA 4R7EA 3QZSA 3HCSA 5B79A 4HXLA 2PUYA 5DLXA 3P1DA 5EGUA 1WEWA 5BT4A 4WHWA 1WESA 4LZSA 5F36A 5HRVA 3UV5A 4MR3A 4A9HA 4ZDTA 4J3IA 1JSPB 2ECVA 4CFLA 5D3JA 3O37A 4NR6A 3K2JA 5LKXA 2LXHC 2MA5A 2CKLA 4IR3A 2VPDA 4A4CA 2ECWA 4F52B 1HYIA 5B8DA 3G0LA 3IU5A 2E3KA 4CCGX 3AQAA 5AMEA 4XI1A 1N72A 3PHDA 4YY6A 5LVRA 2YW8A 5AIUA 4CUUA 5CUEA 4A0CD 2KGGA 4FLPA 5L8UA 4A9LA 3LJWA 5FB1A 2F6JA 4A9EA 4HXMA 1JM7B 4NRAA 5F3AA 4S3OC 4LADB 5FE6A 2C2LA 5BT5A 3O33A 5E7DA 3U5LA 4QSVA 3HCTA 3QZVA 5IG6A 4J1PA 4TTEA 5E3GA 3HCUA 3L1XA 4O7FA 5HENA 5K29A 5J3XA 4QNSA 3SVHA 5HFQA 5D24A 5I83A 4N4HA 4QZSA 5G0FA 3EB5A 1U6GB 2UZGA 5FBXA 5IBNA 2VP7A 1EQFA 4WZ0A 5A5NA 5LJ2A 2E7NA 5CTLA 5G05B 2OUOA 4X3GA 2L43A 2OXQC 2L5UA 2MNYA 2YHOA 5DKDA 4Z6IA 4LK9A 5CQ7A 4AP4A 5F61A 4NQMA 4LJNA 3U5MA 1VYXA 1XWHA 3DWYA 4A9IA 4FJCA 4UYDA 5AMFA 5HRWA 4QSPA 4N3WA 5DBMA 5F63A 5FH7A 5FE8A 3I3JA 1WEOA 4NR4A 5A5PA 4XY9A 5CQTA 5C89A 2CT2A 4PCIA 2RFJA 4NUDA 5TBNA 5DW2A 4AYCA 4QYDA 2I50A 3HMFA 5KO4A 4WHUA 5E9VA 3ZPV1 4YAXA 5DKAA 4A9OA 1WEQA 5CPEA 5L99A 3C6WA 5CUDA 2KWNA 4TU6A 2OSSA 5EV9A 2ECIA 2XEUA 2LGLA 2YU4A 3T6RA 2MT5A 5CQ5A 3SOUA 2MIQA 1VFYA 4S3OB 4PY6A 2LGVA 4NRBA 2G6QA 5DFBA 4GNEA 2C2VS 2KU3A 2ZETC 5TABA 4RVRA 4ZW1A 3LRQA 2D8SA 1FBVA 4Q0OA 3S91A 3MXFA 4XYAA 5ENHA 4OGJA 3UVDA 2KWJA 3MUKA 2YQMA 3RPGB 4PCEA 4HBVA 4A9FA 5A5QA 5D7XA 2YSJA 4GB0A 4O64A 4O74A 1WUGA 5E73A 3U5OA 5FE2A 2ECNA 3P1EA 5HRXA 3UVYA 3ZYUA 4YABA 2K17A 5D1KB 2CSYA 5A7CA 5CQ3A 2LRIC 4QYLA 4IC3A 4R2YA 4O7BA 2H60A 4UYFA 5ENCA 4PTBA 4UITA 2Y1MA 5IGMA 4FK5A 2RNWA 5FH8A 4CUQA 5ACYA 2MD8C 5H1UA 4BW1A 4BW3A 5COIA 2DX8A 3KV5A 4O7EA 4L58A 1WILA 3U5KA 1WEUA 2FUIA 4QSXA 2L84A 4TT4A 5I29A 5FB0A 4MR4A 5EK9A 4XY8A 5TCMA 4BJXA 5JI8A 2AN6A 3JVMA 2EGPA 2RNYA 4HXPA 4NXJA 5C11A 5KH3A 2DVVA 3M63A 4ZUXU 2QIZA 4UI9B 5LJ1A 1WIMA 1JOCA 2VNFA 3UVXA 2Y1NA 4YY4A 5TRBA 5EWWA 4UIZA 5FFVA 3N9MA 4UYFB 5E3DA 5ETBA 2JRJA 5LCWB 3U5PA 5A81A 2D82A 2YYNA 4CLBA 3U5JA 1WEVA 3ZVZB 4TT2A 5E9YA 2KFTA 4L7XA 4IOQA 2NAAA 2DVSA 3I2DA 4BW2A 5DX4A 4XUAA 5FE7A 3O36A 1LDJB 5C8GA 5CQ6A 2PNXA 3LXJA 4Z93A 2YT5A 5FEYA 5EPRA 3N9QA 5HQ5A 2MA6A 2LXPC 5LVQA 2JMIA 4WZ3B 4NRCA 4UP5A 1WEEA 5CP5A 2KIZA 4LLBA 3ZVYA 2L75A 1Z6UA 3SVFA 2VJEB 1IYMA 2VPBA 3C5KA 5I86A 2R0VA 5H1VA 5E9MA 4MR5A 5H85A 4YC9A 4GNFA 1LDKC 4J0RA 4YYMA 2LDRA 4WIVA 5AD3A 5LUUA 4B7YC 4R8PK 4O7CA 5D0CA 2K1JA 2JMDA 4UIVA 1WGMA 3O35A 4QEWA 4A49A 2WP2A 1X4JA 2ECTA 4HXKA 2DVRA 2YQLA 3P1FA 4YYGA 2NXBA 5HEMA 5I40A 1ZBDB 4HXRA 4BHWA 3ZNIA 5E9KA 4UYHA 2MJVB 4YK0A 2KWKA 2YELA 4HBYA 5ENGA 1DVPA 2R0SA 5D3TA 4QY4A 2L85A 4A9JA 3MB3A 3N9PA 4O76A 4C67A 3LQJA 2M1RA 3SHBA 2M3HA 5KH9A 4CURA 5EI4A 4Y03A 4GNDA 2F6NA 5I80A 4YATA 4TKPB 5A82A 2YEKA 2YHNA 4KCXA 5HFRA 4LYSA 5FE3A 5FE9A 3UVWA 3IU6A 2DATA 3JVJA 5A5SA 5KU3A 5A5RA 5DFCA 5I3LA 4QEVA 1BORA 5D1LB 5TDRA 3IHPA 2E7OA 5ETDA 1WEPA 3HTKC 4QUUA 4IORA 5E9IA 5H1TA 5EVAA 1WENA 3TLPA 5EM3A 4CA1A 4C66A 4MSXA 4N4IA 4WA6A 4QR3A 4PPEA 4IR6A 5I89A 5D25A 2LGKA 3D7CA 3KV6A 2I8NA 4YBTA 2G43A 2QICA 1F68A 5FH6A 2HDPA 3UV4A 5CQ8A 2ECJA 5G4RA 5EWCA 4LYWA 5FG6A 5I88A 1JM4B 2R0YA 4MEPA 5AD2A 4LKAA 4YH3A 3FKMX 4W4UA 5D3LA 2D9EA 1MM2A 4QB3A 4QF3A 4LC2A 3ZTGA 2N9GA 2BAYA 2YDWA 4BBQA 3HMEA 5EICA 2CSZA 5D26A 3JVLA 4OGIA 4A9MA 1Z2QA 5CY9A 2ECGA 5EP7A 4N4GA
chains in the Genus database with same CATH superfamily
3ERRA 3MQMA 4O75A 5EPSA 3PURA 4C9ZA 2K16A 2JMJA 2YEMA 4IR5A 4LZ2A 4YYJA 5HELA 4KV4A 4QC3A 5CQAA 4NUEA 2FD4A 2L80A 2M6MA 3DDTA 4UIYA 2E6SA 5EWHA 4F3IA 1CHCA 2RSDA 2HYED 2FFWA 5EQ1A 2RO1A 2QJ0A 1F62A 4NQNA 4ALHA 4I7DA 4Q6FA 3M7KA 1JM7A 2M85A 4TZ8A 2FUUA 3PUQA 5A85A 5DYUA 4OGEA 4NYXA 5C4QA 1V87A 1WFKA 2YVRA 5TDWA 2DSMA 2RI7A 4HBWA 5F1HA 5LKZA 3DQVR 5FE4A 4CL9A 4E96A 4CUPA 3N9NA 3P1CA 5FDZA 3PLWA 2MUMA 4QSRA 4O71A 1N87A 2CKLB 2JUNA 3KQIA 4V3KC 4NYWA 1G25A 2CRRA 4YYIA 2EJNA 2RS9B 3EB6A 1ZS5A 5F62A 5B77A 2LV9A 5CRMA 4CFKA 5D3SA 2FSAA 3JVKA 4AKNA 2RR4A 2KTBB 3N9LA 5EYAF 3N9OA 4QQ4A 5DY7A 4QF2A 3HMHA 3FAOA 5JWMA 2VJEA 3DPLR 4YBSA 3ZPVE 4UP0A 2LQ6A 2VPGA 5KHMA 3L1ZB 4LRGA 4A9NA 5ENBA 3RTRB 5B76A 5CUCA 2KE1A 2LGGA 4UYGA 5DKHA 5A5OA 5D3RA 2RNXA 4ZC9A 4QSTA 5SVIB 4O72A 5F1LA 1WE9A 5C85A 5C87A 2GRCA 4V3LC 4LZRA 4MENA 3O34A 2XB1A 3G0JA 3UW9A 4P5OB 4KV1A 4NN2A 4Z6HA 3D1BA 2XP0A 4MVTA 4O62A 4ZQLA 4TYLA 4TZ2A 4NYVA 5EWVA 3H7HA 4AUQB 2VJFA 3RPGC 5L97A 5FE1A 3S92A 3Q2FA 5CUGA 5C7NA 5G04B 2MNZA 5A83A 1ZKRA 3SOWA 2EODA 4QBMA 4O77A 1MM3A 2L5EA 4YYKA 5JG6A 4I7BA 5KTWA 2KYUA 1HYJA 1Z60A 1VD4A 2CSVA 5DKCA 3LQIA 3JUEA 3MHSA 1K2FA 3O70A 5FFYA 4QR4A 5II2A 2YURA 5L96A 5FERA 4BW4A 5BT3A 4N4FA 1PUOA 4B86C 5F60A 5E9LA 4AI6A 2KREA 5DINA 3SHBA 4YADA 5AITA 5II1A 3T7LA 2CRWA 3U5NA 4TT6A 2LN0A 5CUAA 3GL6A 5D3HA 4QSQA 5CFWA 5J0DA 5L8TA 3GV4A 5LKUA 2E6RA 3Q2EA 2LSPB 2K4DA 5FE5A 5EU1A 4UIUA 4YYHA 3NXBA 5HJCA 5LJ0A 4IR4A 2OWAA 4I7CA 4Z0RA 5ENIA 4UYEA 4O70A 4QC1A 5HQ6A 4NR8A 4IC2A 2KGIA 3MULA 5EWDA 2I7KA 3ASLA 4QSWA 2L7PA 5FE0A 2B0OE 5EISA 5F5ZA 4HXNA 4NS5A 4YYNA 4OUFA 2G4AA 5TB6A 4PKLA 2WP1A 2F42A 5CQ4A 4MR6A 3LQHA 1DCQA 3QZTA 3MB4A 2YREA 5E0RA 4LR6A 5IGNA 4UIWA 4PS5A 4TU4A 4O78A 5KTUA 5IGKA 4QR5A 4QUTA 5L98A 5CS8A 1X4IA 2IDAA 3ONIA 4HXOA 4ALGA 5FFWA 5DW1A 1E6IA 2DVQA 3VKHA 4HXSA 4AYCB 2JM3A 4XUBA 5DYCA 5G4SA 2XOCA 1E4UA 5DLZA 3KNVA 4QSSA 4UIXA 5FG4A 5E74A 3FL2A 2YQDA 4FIPA 4A4BA 2CONA 3O7AA 3FEHA 3SOXA 5B75A 3M62A 3LDYA 4A9KA 1X4UA 2YYRA 5C13A 4GPJA 5HM0A 5DYXA 2KWOA 3MHHA 5LKTA 2YUCA 4NR9A 3VK6A 4IOOA 5I1QA 4MEQA 4LYIA 3ZYQA 5D3PA 5DYAA 4HBXA 1T1HA 5F25A 2VJFB 3V43A 2VPEA 5B78A 2D8UA 2EA6A 1FP0A 2Y43A 4YBMA 5HCLA 2YSMA 3M99A 2DWWA 1RMDA 4FO9A 4AVXA 5HLSA 2R10A 5ENJA 5CRZA 3UV2A 5CGPA 5CU8A 3L11A 4X2IA 4J0SA 4TQNA 5D1MB 5F2PA 2DKWA 4NR5A 5EA1A 5KH7A 4NR7A 4YH4A 5KTXA 3RCWA 2H0DB 1X0JA 5IGLA 3SVGA 2G45A 3NG2A 3D1DA 5FG5A 5ENFA 4CUTA 2L0BA 3GG3A 3P5OA 4Q0NA 5ENEA 4O7AA 5EPBA 2YW5A 4TS8A 5IIDA 4WZ2A 4YYDA 5I7YA 4LDFA 5I7XA 4NUCA 4QSUA 5H9MA 1WUMA 3AADA 2MD7B 4MEOA 3FJUB 2H0DA 5CUBA 5D3NA 4Z1QA 1WEMA 4DONA 4Z1SA 2OO1A 5CZGA 5DFDA 3DAIA 5HQ7A 4QEUA 4CUSA 2KR4A 3E2DA 4GNGA 3QZSA 3HCSA 3LVQE 4R7EA 3DWDA 5B79A 4HXLA 2PUYA 5DLXA 3P1DA 5EGUA 1WEWA 5BT4A 4WHWA 1WESA 4LZSA 5F36A 5HRVA 3UV5A 4MR3A 4A9HA 4ZDTA 3FANA 4J3IA 1JSPB 2ECVA 4CFLA 5D3JA 3O37A 4NR6A 3K2JA 5LKXA 2LXHC 2MA5A 2CKLA 4IR3A 2VPDA 3MDBC 4A4CA 2ECWA 4F52B 1HYIA 5B8DA 4H9DA 3G0LA 3IU5A 2E3KA 4CCGX 3AQAA 5AMEA 4XI1A 1N72A 3PHDA 4YY6A 5LVRA 2YW8A 5AIUA 4CUUA 5CUEA 4A0CD 2KGGA 4FLPA 5L8UA 4A9LA 3LJWA 5FB1A 2F6JA 4A9EA 4HXMA 1JM7B 4NRAA 5F3AA 4AKIA 4S3OC 4LADB 5FE6A 2C2LA 5BT5A 3O33A 5E7DA 3U5LA 4QSVA 3HCTA 3QZVA 5IG6A 4J1PA 4TTEA 5E3GA 3HCUA 3L1XA 4O7FA 5HENA 5K29A 5J3XA 4QNSA 3SVHA 5HFQA 5D24A 5I83A 4N4HA 2EXUA 3Q1DA 2KKYA 4QZSA 5G0FA 3EB5A 1U6GB 2UZGA 5FBXA 5IBNA 2VP7A 1EQFA 4WZ0A 5A5NA 5LJ2A 2E7NA 5CTLA 5G05B 2OUOA 4X3GA 2L43A 2OXQC 2L5UA 2MNYA 2YHOA 5DKDA 4Z6IA 4LK9A 5CQ7A 4AP4A 5F61A 4NQMA 4LJNA 3U5MA 1VYXA 1XWHA 3DWYA 4A9IA 4FJCA 4UYDA 5AMFA 5HRWA 4QSPA 4N3WA 5DBMA 5F63A 5FH7A 5FE8A 3I3JA 1WEOA 4NR4A 5A5PA 4XY9A 5CQTA 5C89A 2CT2A 4PCIA 3KDEC 2RFJA 4NUDA 5TBNA 5DW2A 4AYCA 4QYDA 2I50A 2DJAA 3HMFA 5KO4A 4WHUA 5E9VA 3ZPV1 4YAXA 5DKAA 4A9OA 1WEQA 5CPEA 5L99A 3C6WA 5CUDA 2KWNA 4TU6A 2OSSA 5EV9A 2ECIA 2XEUA 2LGLA 2YU4A 3T6RA 2MT5A 5CQ5A 3SOUA 2MIQA 1VFYA 4S3OB 4PY6A 2LGVA 4NRBA 2G6QA 5DFBA 4GNEA 2C2VS 2KU3A 2ZETC 5TABA 4RVRA 4ZW1A 3LRQA 2D8SA 1FBVA 4Q0OA 3S91A 3MXFA 4XYAA 5ENHA 4OGJA 3UVDA 2KWJA 3MUKA 2YQMA 3RPGB 4PCEA 4HBVA 4A9FA 5A5QA 5D7XA 2YSJA 4GB0A 4O64A 4O74A 1WUGA 5E73A 3U5OA 5FE2A 2ECNA 3P1EA 5HRXA 3UVYA 3ZYUA 4YABA 2K17A 5D1KB 2CSYA 5A7CA 5CQ3A 5K3QA 2LRIC 4QYLA 4OGCA 4IC3A 4R2YA 4O7BA 2H60A 4UYFA 5ENCA 4PTBA 5SVXA 4UITA 2Y1MA 5IGMA 4FK5A 2RNWA 5FH8A 4CUQA 5ACYA 2MD8C 5H1UA 4BW1A 4BW3A 5COIA 2DX8A 3KV5A 4O7EA 4L58A 1WILA 3U5KA 1WEUA 2FUIA 4QSXA 2L84A 4TT4A 5I29A 3T9KA 5FB0A 4MR4A 5EK9A 4XY8A 3LJUX 5TCMA 4BJXA 5JI8A 2AN6A 3JVMA 2EGPA 2RNYA 4HXPA 4NXJA 5C11A 5KH3A 2DVVA 3M63A 4ZUXU 2QIZA 2XOZA 4UI9B 5LJ1A 3VKGA 1JOCA 1WIMA 3UVXA 2VNFA 2Y1NA 4YY4A 5TRBA 5EWWA 4UIZA 5FFVA 3N9MA 4UYFB 5E3DA 5ETBA 2JRJA 5LCWB 3U5PA 5A81A 2D82A 2YYNA 4CLBA 3U5JA 1WEVA 3ZVZB 4TT2A 5E9YA 2KFTA 3FM8C 4L7XA 4IOQA 2NAAA 2DVSA 3I2DA 4BW2A 5SVYA 5DX4A 4XUAA 5FE7A 3O36A 1LDJB 1MBMA 5C8GA 5CQ6A 2PNXA 3LXJA 4Z93A 2YT5A 5FEYA 5EPRA 3N9QA 5HQ5A 2MA6A 2LXPC 5LVQA 2JMIA 4WZ3B 4NRCA 4UP5A 1WEEA 5CP5A 2KIZA 4LLBA 3LVRE 2L75A 3ZVYA 4AKHA 1Z6UA 3SVFA 2VJEB 1IYMA 2VPBA 3C5KA 5I86A 2R0VA 5H1VA 5E9MA 4MR5A 5H85A 4YC9A 4GNFA 1LDKC 4J0RA 2P57A 4YYMA 2LDRA 4WIVA 5AD3A 5LUUA 4B7YC 4R8PK 4O7CA 5D0CA 2K1JA 2JMDA 4UIVA 1WGMA 3O35A 4QEWA 4A49A 4F1PA 2WP2A 1X4JA 2KKXA 2ECTA 4HXKA 2DVRA 2YQLA 3P1FA 4YYGA 2NXBA 5HEMA 5I40A 1ZBDB 4HXRA 2XOYA 4BHWA 5SVIA 3ZNIA 5E9KA 4UYHA 2LAUA 2MJVB 4YK0A 2KWKA 2YELA 4HBYA 5ENGA 1DVPA 2R0SA 5D3TA 4QY4A 2L85A 4A9JA 3MB3A 3N9PA 4O76A 4C67A 3LQJA 2M1RA 2MKEA 2M3HA 4Z0OA 5KH9A 4CURA 5EI4A 4Y03A 4GNDA 2F6NA 5I80A 4YATA 2EGMA 4TKPB 5A82A 2YEKA 2YHNA 4KCXA 5HFRA 4LYSA 5FE3A 5FE9A 3UVWA 3IU6A 2DATA 3JVJA 5A5SA 5KU3A 5A5RA 5DFCA 5I3LA 4QEVA 1BORA 5D1LB 5TDRA 3IHPA 2E7OA 5ETDA 1WEPA 3HTKC 4QUUA 2IQJA 4AKGA 4IORA 5E9IA 5H1TA 5EVAA 1WENA 3TLPA 5EM3A 3SUBA 4CA1A 4C66A 4MSXA 4N4IA 4WA6A 4QR3A 4PPEA 4IR6A 5I89A 5D25A 2LGKA 3D7CA 3KV6A 2I8NA 4YBTA 2G43A 2QICA 1F68A 2M13A 5FH6A 2HDPA 3UV4A 5CQ8A 2ECJA 5G4RA 5EWCA 4LYWA 5FG6A 5I88A 1JM4B 2R0YA 4MEPA 5AD2A 4LKAA 4YH3A 3FKMX 4W4UA 5D3LA 2D9EA 1MM2A 4QB3A 2E61A 4QF3A 4LC2A 3ZTGA 2N9GA 2BAYA 2YDWA 4BBQA 3HMEA 3O47A 5EICA 2CSZA 5D26A 3JVLA 4OGIA 4A9MA 1Z2QA 5CY9A 2ECGA 5EP7A 4N4GA
chains in the Genus database with same CATH topology
3MQMA 4O75A 5EPSA 3PURA 4C9ZA 2K16A 2JMJA 2YEMA 4IR5A 4LZ2A 4YYJA 5HELA 4KV4A 4QC3A 5CQAA 4NUEA 2L80A 2M6MA 4UIYA 2E6SA 5EWHA 4F3IA 1CHCA 2RSDA 2HYED 5EQ1A 2RO1A 2QJ0A 1F62A 4NQNA 4ALHA 4I7DA 4Q6FA 1JM7A 2M85A 4TZ8A 2FUUA 3PUQA 5A85A 5DYUA 4NYXA 5C4QA 1V87A 1WFKA 5TDWA 2RI7A 4HBWA 5F1HA 5LKZA 3DQVR 5FE4A 4CL9A 4E96A 4CUPA 3N9NA 3P1CA 5FDZA 2MUMA 4QSRA 4O71A 1N87A 2CKLB 3KQIA 4V3KC 4NYWA 1G25A 4YYIA 3EB6A 2RS9B 1ZS5A 5F62A 5B77A 2LV9A 5CRMA 4CFKA 5D3SA 2FSAA 3JVKA 4AKNA 2KTBB 3N9LA 5EYAF 3N9OA 5DY7A 4QF2A 3HMHA 5JWMA 2VJEA 3DPLR 4YBSA 3ZPVE 4UP0A 2LQ6A 2VPGA 5KHMA 3L1ZB 4LRGA 4A9NA 5ENBA 3RTRB 5B76A 5CUCA 2KE1A 2LGGA 4UYGA 5DKHA 5A5OA 5D3RA 2RNXA 4ZC9A 4QSTA 4O72A 5F1LA 1WE9A 5C85A 5C87A 2GRCA 4V3LC 4LZRA 4MENA 3O34A 2XB1A 3G0JA 3UW9A 4P5OB 4KV1A 4NN2A 4Z6HA 4MVTA 4ZQLA 4TYLA 4TZ2A 4NYVA 5EWVA 4AUQB 2VJFA 3RPGC 5L97A 5FE1A 3S92A 3Q2FA 5CUGA 5C7NA 5G04B 2MNZA 5A83A 3SOWA 2EODA 4QBMA 4O77A 1MM3A 2L5EA 4YYKA 5JG6A 4I7BA 5KTWA 2KYUA 1HYJA 1Z60A 1VD4A 5DKCA 3LQIA 3MHSA 1K2FA 3O70A 5FFYA 4QR4A 5II2A 2YURA 5L96A 5FERA 4BW4A 5BT3A 4N4FA 4B86C 5F60A 5E9LA 2KREA 5DINA 4YADA 5AITA 5II1A 3T7LA 3U5NA 4TT6A 2LN0A 5CUAA 3GL6A 5D3HA 4QSQA 5CFWA 5J0DA 5L8TA 3GV4A 5LKUA 2E6RA 3Q2EA 2LSPB 2K4DA 5FE5A 5EU1A 4UIUA 4YYHA 3NXBA 5HJCA 5LJ0A 4IR4A 4I7CA 5ENIA 4UYEA 4O70A 4QC1A 5HQ6A 4NR8A 4IC2A 2KGIA 3MULA 5EWDA 2I7KA 3ASLA 4QSWA 5FE0A 5EISA 5F5ZA 4HXNA 4NS5A 4YYNA 4OUFA 2G4AA 5TB6A 4PKLA 2WP1A 2F42A 5CQ4A 4MR6A 3LQHA 3QZTA 3MB4A 2YREA 5E0RA 4LR6A 5IGNA 4UIWA 4PS5A 4TU4A 4O78A 5KTUA 5IGKA 4QR5A 4QUTA 5L98A 5CS8A 1X4IA 2IDAA 3ONIA 4HXOA 4ALGA 5FFWA 5DW1A 1E6IA 2DVQA 4HXSA 4AYCB 4XUBA 5DYCA 5G4SA 1E4UA 5DLZA 3KNVA 4QSSA 4UIXA 5FG4A 5E74A 3FL2A 2YQDA 4FIPA 4A4BA 3O7AA 3SOXA 5B75A 3M62A 4A9KA 1X4UA 2YYRA 5C13A 4GPJA 5HM0A 5DYXA 2KWOA 3MHHA 5LKTA 2YUCA 4NR9A 3VK6A 4IOOA 5I1QA 4MEQA 4LYIA 3ZYQA 5D3PA 5DYAA 4HBXA 1T1HA 5F25A 2VJFB 3V43A 2VPEA 5B78A 2EA6A 1FP0A 2Y43A 4YBMA 5HCLA 2YSMA 3M99A 2DWWA 1RMDA 4FO9A 4AVXA 5HLSA 2R10A 5ENJA 5CRZA 3UV2A 5CGPA 5CU8A 3L11A 4X2IA 4J0SA 4TQNA 5D1MB 5F2PA 2DKWA 4NR5A 5EA1A 5KH7A 4NR7A 4YH4A 5KTXA 3RCWA 2H0DB 1X0JA 5IGLA 3SVGA 2G45A 3NG2A 5FG5A 4CUTA 5ENFA 2L0BA 3GG3A 3P5OA 4Q0NA 5ENEA 4O7AA 5EPBA 2YW5A 4TS8A 5IIDA 4WZ2A 4YYDA 5I7YA 4LDFA 5I7XA 4NUCA 4QSUA 5H9MA 1WUMA 3AADA 2MD7B 4MEOA 2H0DA 5CUBA 5D3NA 4Z1QA 1WEMA 4DONA 4Z1SA 2OO1A 5CZGA 5DFDA 3DAIA 5HQ7A 4QEUA 4CUSA 2KR4A 4GNGA 4R7EA 3QZSA 3HCSA 5B79A 4HXLA 2PUYA 5DLXA 3P1DA 5EGUA 1WEWA 5BT4A 4WHWA 1WESA 4LZSA 5F36A 5HRVA 3UV5A 4MR3A 4A9HA 4ZDTA 4J3IA 1JSPB 2ECVA 4CFLA 5D3JA 3O37A 4NR6A 3K2JA 5LKXA 2LXHC 2MA5A 2CKLA 4IR3A 2VPDA 4A4CA 2ECWA 4F52B 1HYIA 5B8DA 3G0LA 3IU5A 2E3KA 4CCGX 3AQAA 5AMEA 4XI1A 1N72A 3PHDA 4YY6A 5LVRA 2YW8A 5AIUA 4CUUA 5CUEA 4A0CD 2KGGA 4FLPA 5L8UA 4A9LA 3LJWA 5FB1A 2F6JA 4A9EA 4HXMA 1JM7B 4NRAA 5F3AA 4S3OC 4LADB 5FE6A 2C2LA 5BT5A 3O33A 5E7DA 3U5LA 4QSVA 3HCTA 3QZVA 5IG6A 4J1PA 4TTEA 5E3GA 3HCUA 3L1XA 4O7FA 5HENA 5K29A 5J3XA 4QNSA 3SVHA 5HFQA 5D24A 5I83A 4N4HA 4QZSA 5G0FA 3EB5A 1U6GB 2UZGA 5FBXA 5IBNA 2VP7A 1EQFA 4WZ0A 5A5NA 5LJ2A 2E7NA 5CTLA 5G05B 2OUOA 4X3GA 2L43A 2OXQC 2L5UA 2MNYA 2YHOA 5DKDA 4Z6IA 4LK9A 5CQ7A 4AP4A 5F61A 4NQMA 4LJNA 3U5MA 1VYXA 1XWHA 3DWYA 4A9IA 4FJCA 4UYDA 5AMFA 5HRWA 4QSPA 4N3WA 5DBMA 5F63A 5FH7A 5FE8A 3I3JA 1WEOA 4NR4A 5A5PA 4XY9A 5CQTA 5C89A 2CT2A 4PCIA 2RFJA 4NUDA 5TBNA 5DW2A 4AYCA 4QYDA 2I50A 3HMFA 5KO4A 4WHUA 5E9VA 3ZPV1 4YAXA 5DKAA 4A9OA 1WEQA 5CPEA 5L99A 3C6WA 5CUDA 2KWNA 4TU6A 2OSSA 5EV9A 2ECIA 2XEUA 2LGLA 2YU4A 3T6RA 2MT5A 5CQ5A 3SOUA 2MIQA 1VFYA 4S3OB 4PY6A 2LGVA 4NRBA 2G6QA 5DFBA 4GNEA 2C2VS 2KU3A 2ZETC 5TABA 4RVRA 4ZW1A 3LRQA 2D8SA 1FBVA 4Q0OA 3S91A 3MXFA 4XYAA 5ENHA 4OGJA 3UVDA 2KWJA 3MUKA 2YQMA 3RPGB 4PCEA 4HBVA 4A9FA 5A5QA 5D7XA 2YSJA 4GB0A 4O64A 4O74A 1WUGA 5E73A 3U5OA 5FE2A 2ECNA 3P1EA 5HRXA 3UVYA 3ZYUA 4YABA 2K17A 5D1KB 2CSYA 5A7CA 5CQ3A 2LRIC 4QYLA 4IC3A 4R2YA 4O7BA 2H60A 4UYFA 5ENCA 4PTBA 4UITA 2Y1MA 5IGMA 4FK5A 2RNWA 5FH8A 4CUQA 5ACYA 2MD8C 5H1UA 4BW1A 4BW3A 5COIA 2DX8A 3KV5A 4O7EA 4L58A 1WILA 3U5KA 1WEUA 2FUIA 4QSXA 2L84A 4TT4A 5I29A 5FB0A 4MR4A 5EK9A 4XY8A 5TCMA 4BJXA 5JI8A 2AN6A 3JVMA 2EGPA 2RNYA 4HXPA 4NXJA 5C11A 5KH3A 2DVVA 3M63A 4ZUXU 2QIZA 4UI9B 5LJ1A 1WIMA 1JOCA 2VNFA 3UVXA 2Y1NA 4YY4A 5TRBA 5EWWA 4UIZA 5FFVA 3N9MA 4UYFB 5E3DA 5ETBA 2JRJA 5LCWB 3U5PA 5A81A 2D82A 2YYNA 4CLBA 3U5JA 1WEVA 3ZVZB 4TT2A 5E9YA 2KFTA 4L7XA 4IOQA 2NAAA 2DVSA 3I2DA 4BW2A 5DX4A 4XUAA 5FE7A 3O36A 1LDJB 5C8GA 5CQ6A 2PNXA 3LXJA 4Z93A 2YT5A 5FEYA 5EPRA 3N9QA 5HQ5A 2MA6A 2LXPC 5LVQA 2JMIA 4WZ3B 4NRCA 4UP5A 1WEEA 5CP5A 2KIZA 4LLBA 3ZVYA 2L75A 1Z6UA 3SVFA 2VJEB 1IYMA 2VPBA 3C5KA 5I86A 2R0VA 5H1VA 5E9MA 4MR5A 5H85A 4YC9A 4GNFA 1LDKC 4J0RA 4YYMA 2LDRA 4WIVA 5AD3A 5LUUA 4B7YC 4R8PK 4O7CA 5D0CA 2K1JA 2JMDA 4UIVA 1WGMA 3O35A 4QEWA 4A49A 2WP2A 1X4JA 2ECTA 4HXKA 2DVRA 2YQLA 3P1FA 4YYGA 2NXBA 5HEMA 5I40A 1ZBDB 4HXRA 4BHWA 3ZNIA 5E9KA 4UYHA 2MJVB 4YK0A 2KWKA 2YELA 4HBYA 5ENGA 1DVPA 2R0SA 5D3TA 4QY4A 2L85A 4A9JA 3MB3A 3N9PA 4O76A 4C67A 3LQJA 2M1RA 3SHBA 2M3HA 5KH9A 4CURA 5EI4A 4Y03A 4GNDA 2F6NA 5I80A 4YATA 4TKPB 5A82A 2YEKA 2YHNA 4KCXA 5HFRA 4LYSA 5FE3A 5FE9A 3UVWA 3IU6A 2DATA 3JVJA 5A5SA 5KU3A 5A5RA 5DFCA 5I3LA 4QEVA 1BORA 5D1LB 5TDRA 3IHPA 2E7OA 5ETDA 1WEPA 3HTKC 4QUUA 4IORA 5E9IA 5H1TA 5EVAA 1WENA 3TLPA 5EM3A 4CA1A 4C66A 4MSXA 4N4IA 4WA6A 4QR3A 4PPEA 4IR6A 5I89A 5D25A 2LGKA 3D7CA 3KV6A 2I8NA 4YBTA 2G43A 2QICA 1F68A 5FH6A 2HDPA 3UV4A 5CQ8A 2ECJA 5G4RA 5EWCA 4LYWA 5FG6A 5I88A 1JM4B 2R0YA 4MEPA 5AD2A 4LKAA 4YH3A 3FKMX 4W4UA 5D3LA 2D9EA 1MM2A 4QB3A 4QF3A 4LC2A 3ZTGA 2N9GA 2BAYA 2YDWA 4BBQA 3HMEA 5EICA 2CSZA 5D26A 3JVLA 4OGIA 4A9MA 1Z2QA 5CY9A 2ECGA 5EP7A 4N4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQM A;  4O75 A;  5EPS A;  3PUR A;  4C9Z A;  2K16 A;  2JMJ A;  2YEM A;  4IR5 A;  4LZ2 A;  4YYJ A;  5HEL A;  4KV4 A;  4QC3 A;  5CQA A;  4NUE A;  2L80 A;  2M6M A;  4UIY A;  2E6S A;  5EWH A;  4F3I A;  1CHC A;  2RSD A;  2HYE D;  5EQ1 A;  2RO1 A;  2QJ0 A;  1F62 A;  4NQN A;  4ALH A;  4I7D A;  4Q6F A;  1JM7 A;  2M85 A;  4TZ8 A;  2FUU A;  3PUQ A;  5A85 A;  5DYU A;  4NYX A;  5C4Q A;  1V87 A;  1WFK A;  5TDW A;  2RI7 A;  4HBW A;  5F1H A;  5LKZ A;  3DQV R;  5FE4 A;  4CL9 A;  4E96 A;  4CUP A;  3N9N A;  3P1C A;  5FDZ A;  2MUM A;  4QSR A;  4O71 A;  1N87 A;  2CKL B;  3KQI A;  4V3K C;  4NYW A;  1G25 A;  4YYI A;  3EB6 A;  2RS9 B;  1ZS5 A;  5F62 A;  5B77 A;  2LV9 A;  5CRM A;  4CFK A;  5D3S A;  2FSA A;  3JVK A;  4AKN A;  2KTB B;  3N9L A;  5EYA F;  3N9O A;  5DY7 A;  4QF2 A;  3HMH A;  5JWM A;  2VJE A;  3DPL R;  4YBS A;  3ZPV E;  4UP0 A;  2LQ6 A;  2VPG A;  5KHM A;  3L1Z B;  4LRG A;  4A9N A;  5ENB A;  3RTR B;  5B76 A;  5CUC A;  2KE1 A;  2LGG A;  4UYG A;  5DKH A;  5A5O A;  5D3R A;  2RNX A;  4ZC9 A;  4QST A;  4O72 A;  5F1L A;  1WE9 A;  5C85 A;  5C87 A;  2GRC A;  4V3L C;  4LZR A;  4MEN A;  3O34 A;  2XB1 A;  3G0J A;  3UW9 A;  4P5O B;  4KV1 A;  4NN2 A;  4Z6H A;  4MVT A;  4ZQL A;  4TYL A;  4TZ2 A;  4NYV A;  5EWV A;  4AUQ B;  2VJF A;  3RPG C;  5L97 A;  5FE1 A;  3S92 A;  3Q2F A;  5CUG A;  5C7N A;  5G04 B;  2MNZ A;  5A83 A;  3SOW A;  2EOD A;  4QBM A;  4O77 A;  1MM3 A;  2L5E A;  4YYK A;  5JG6 A;  4I7B A;  5KTW A;  2KYU A;  1HYJ A;  1Z60 A;  1VD4 A;  5DKC A;  3LQI A;  3MHS A;  1K2F A;  3O70 A;  5FFY A;  4QR4 A;  5II2 A;  2YUR A;  5L96 A;  5FER A;  4BW4 A;  5BT3 A;  4N4F A;  4B86 C;  5F60 A;  5E9L A;  2KRE A;  5DIN A;  4YAD A;  5AIT A;  5II1 A;  3T7L A;  3U5N A;  4TT6 A;  2LN0 A;  5CUA A;  3GL6 A;  5D3H A;  4QSQ A;  5CFW A;  5J0D A;  5L8T A;  3GV4 A;  5LKU A;  2E6R A;  3Q2E A;  2LSP B;  2K4D A;  5FE5 A;  5EU1 A;  4UIU A;  4YYH A;  3NXB A;  5HJC A;  5LJ0 A;  4IR4 A;  4I7C A;  5ENI A;  4UYE A;  4O70 A;  4QC1 A;  5HQ6 A;  4NR8 A;  4IC2 A;  2KGI A;  3MUL A;  5EWD A;  2I7K A;  3ASL A;  4QSW A;  5FE0 A;  5EIS A;  5F5Z A;  4HXN A;  4NS5 A;  4YYN A;  4OUF A;  2G4A A;  5TB6 A;  4PKL A;  2WP1 A;  2F42 A;  5CQ4 A;  4MR6 A;  3LQH A;  3QZT A;  3MB4 A;  2YRE A;  5E0R A;  4LR6 A;  5IGN A;  4UIW A;  4PS5 A;  4TU4 A;  4O78 A;  5KTU A;  5IGK A;  4QR5 A;  4QUT A;  5L98 A;  5CS8 A;  1X4I A;  2IDA A;  3ONI A;  4HXO A;  4ALG A;  5FFW A;  5DW1 A;  1E6I A;  2DVQ A;  4HXS A;  4AYC B;  4XUB A;  5DYC A;  5G4S A;  1E4U A;  5DLZ A;  3KNV A;  4QSS A;  4UIX A;  5FG4 A;  5E74 A;  3FL2 A;  2YQD A;  4FIP A;  4A4B A;  3O7A A;  3SOX A;  5B75 A;  3M62 A;  4A9K A;  1X4U A;  2YYR A;  5C13 A;  4GPJ A;  5HM0 A;  5DYX A;  2KWO A;  3MHH A;  5LKT A;  2YUC A;  4NR9 A;  3VK6 A;  4IOO A;  5I1Q A;  4MEQ A;  4LYI A;  3ZYQ A;  5D3P A;  5DYA A;  4HBX A;  1T1H A;  5F25 A;  2VJF B;  3V43 A;  2VPE A;  5B78 A;  2EA6 A;  1FP0 A;  2Y43 A;  4YBM A;  5HCL A;  2YSM A;  3M99 A;  2DWW A;  1RMD A;  4FO9 A;  4AVX A;  5HLS A;  2R10 A;  5ENJ A;  5CRZ A;  3UV2 A;  5CGP A;  5CU8 A;  3L11 A;  4X2I A;  4J0S A;  4TQN A;  5D1M B;  5F2P A;  2DKW A;  4NR5 A;  5EA1 A;  5KH7 A;  4NR7 A;  4YH4 A;  5KTX A;  3RCW A;  2H0D B;  1X0J A;  5IGL A;  3SVG A;  2G45 A;  3NG2 A;  5FG5 A;  4CUT A;  5ENF A;  2L0B A;  3GG3 A;  3P5O A;  4Q0N A;  5ENE A;  4O7A A;  5EPB A;  2YW5 A;  4TS8 A;  5IID A;  4WZ2 A;  4YYD A;  5I7Y A;  4LDF A;  5I7X A;  4NUC A;  4QSU A;  5H9M A;  1WUM A;  3AAD A;  2MD7 B;  4MEO A;  2H0D A;  5CUB A;  5D3N A;  4Z1Q A;  1WEM A;  4DON A;  4Z1S A;  2OO1 A;  5CZG A;  5DFD A;  3DAI A;  5HQ7 A;  4QEU A;  4CUS A;  2KR4 A;  4GNG A;  4R7E A;  3QZS A;  3HCS A;  5B79 A;  4HXL A;  2PUY A;  5DLX A;  3P1D A;  5EGU A;  1WEW A;  5BT4 A;  4WHW A;  1WES A;  4LZS A;  5F36 A;  5HRV A;  3UV5 A;  4MR3 A;  4A9H A;  4ZDT A;  4J3I A;  1JSP B;  2ECV A;  4CFL A;  5D3J A;  3O37 A;  4NR6 A;  3K2J A;  5LKX A;  2LXH C;  2MA5 A;  2CKL A;  4IR3 A;  2VPD A;  4A4C A;  2ECW A;  4F52 B;  1HYI A;  5B8D A;  3G0L A;  3IU5 A;  2E3K A;  4CCG X;  3AQA A;  5AME A;  4XI1 A;  1N72 A;  3PHD A;  4YY6 A;  5LVR A;  2YW8 A;  5AIU A;  4CUU A;  5CUE A;  4A0C D;  2KGG A;  4FLP A;  5L8U A;  4A9L A;  3LJW A;  5FB1 A;  2F6J A;  4A9E A;  4HXM A;  1JM7 B;  4NRA A;  5F3A A;  4S3O C;  4LAD B;  5FE6 A;  2C2L A;  5BT5 A;  3O33 A;  5E7D A;  3U5L A;  4QSV A;  3HCT A;  3QZV A;  5IG6 A;  4J1P A;  4TTE A;  5E3G A;  3HCU A;  3L1X A;  4O7F A;  5HEN A;  5K29 A;  5J3X A;  4QNS A;  3SVH A;  5HFQ A;  5D24 A;  5I83 A;  4N4H A;  4QZS A;  5G0F A;  3EB5 A;  1U6G B;  2UZG A;  5FBX A;  5IBN A;  2VP7 A;  1EQF A;  4WZ0 A;  5A5N A;  5LJ2 A;  2E7N A;  5CTL A;  5G05 B;  2OUO A;  4X3G A;  2L43 A;  2OXQ C;  2L5U A;  2MNY A;  2YHO A;  5DKD A;  4Z6I A;  4LK9 A;  5CQ7 A;  4AP4 A;  5F61 A;  4NQM A;  4LJN A;  3U5M A;  1VYX A;  1XWH A;  3DWY A;  4A9I A;  4FJC A;  4UYD A;  5AMF A;  5HRW A;  4QSP A;  4N3W A;  5DBM A;  5F63 A;  5FH7 A;  5FE8 A;  3I3J A;  1WEO A;  4NR4 A;  5A5P A;  4XY9 A;  5CQT A;  5C89 A;  2CT2 A;  4PCI A;  2RFJ A;  4NUD A;  5TBN A;  5DW2 A;  4AYC A;  4QYD A;  2I50 A;  3HMF A;  5KO4 A;  4WHU A;  5E9V A;  3ZPV 1;  4YAX A;  5DKA A;  4A9O A;  1WEQ A;  5CPE A;  5L99 A;  3C6W A;  5CUD A;  2KWN A;  4TU6 A;  2OSS A;  5EV9 A;  2ECI A;  2XEU A;  2LGL A;  2YU4 A;  3T6R A;  2MT5 A;  5CQ5 A;  3SOU A;  2MIQ A;  1VFY A;  4S3O B;  4PY6 A;  2LGV A;  4NRB A;  2G6Q A;  5DFB A;  4GNE A;  2C2V S;  2KU3 A;  2ZET C;  5TAB A;  4RVR A;  4ZW1 A;  3LRQ A;  2D8S A;  1FBV A;  4Q0O A;  3S91 A;  3MXF A;  4XYA A;  5ENH A;  4OGJ A;  3UVD A;  2KWJ A;  3MUK A;  2YQM A;  3RPG B;  4PCE A;  4HBV A;  4A9F A;  5A5Q A;  5D7X A;  2YSJ A;  4GB0 A;  4O64 A;  4O74 A;  1WUG A;  5E73 A;  3U5O A;  5FE2 A;  2ECN A;  3P1E A;  5HRX A;  3UVY A;  3ZYU A;  4YAB A;  2K17 A;  5D1K B;  2CSY A;  5A7C A;  5CQ3 A;  2LRI C;  4QYL A;  4IC3 A;  4R2Y A;  4O7B A;  2H60 A;  4UYF A;  5ENC A;  4PTB A;  4UIT A;  2Y1M A;  5IGM A;  4FK5 A;  2RNW A;  5FH8 A;  4CUQ A;  5ACY A;  2MD8 C;  5H1U A;  4BW1 A;  4BW3 A;  5COI A;  2DX8 A;  3KV5 A;  4O7E A;  4L58 A;  1WIL A;  3U5K A;  1WEU A;  2FUI A;  4QSX A;  2L84 A;  4TT4 A;  5I29 A;  5FB0 A;  4MR4 A;  5EK9 A;  4XY8 A;  5TCM A;  4BJX A;  5JI8 A;  2AN6 A;  3JVM A;  2EGP A;  2RNY A;  4HXP A;  4NXJ A;  5C11 A;  5KH3 A;  2DVV A;  3M63 A;  4ZUX U;  2QIZ A;  4UI9 B;  5LJ1 A;  1WIM A;  1JOC A;  2VNF A;  3UVX A;  2Y1N A;  4YY4 A;  5TRB A;  5EWW A;  4UIZ A;  5FFV A;  3N9M A;  4UYF B;  5E3D A;  5ETB A;  2JRJ A;  5LCW B;  3U5P A;  5A81 A;  2D82 A;  2YYN A;  4CLB A;  3U5J A;  1WEV A;  3ZVZ B;  4TT2 A;  5E9Y A;  2KFT A;  4L7X A;  4IOQ A;  2NAA A;  2DVS A;  3I2D A;  4BW2 A;  5DX4 A;  4XUA A;  5FE7 A;  3O36 A;  1LDJ B;  5C8G A;  5CQ6 A;  2PNX A;  3LXJ A;  4Z93 A;  2YT5 A;  5FEY A;  5EPR A;  3N9Q A;  5HQ5 A;  2MA6 A;  2LXP C;  5LVQ A;  2JMI A;  4WZ3 B;  4NRC A;  4UP5 A;  1WEE A;  5CP5 A;  2KIZ A;  4LLB A;  3ZVY A;  2L75 A;  1Z6U A;  3SVF A;  2VJE B;  1IYM A;  2VPB A;  3C5K A;  5I86 A;  2R0V A;  5H1V A;  5E9M A;  4MR5 A;  5H85 A;  4YC9 A;  4GNF A;  1LDK C;  4J0R A;  4YYM A;  2LDR A;  4WIV A;  5AD3 A;  5LUU A;  4B7Y C;  4R8P K;  4O7C A;  5D0C A;  2K1J A;  2JMD A;  4UIV A;  1WGM A;  3O35 A;  4QEW A;  4A49 A;  2WP2 A;  1X4J A;  2ECT A;  4HXK A;  2DVR A;  2YQL A;  3P1F A;  4YYG A;  2NXB A;  5HEM A;  5I40 A;  1ZBD B;  4HXR A;  4BHW A;  3ZNI A;  5E9K A;  4UYH A;  2MJV B;  4YK0 A;  2KWK A;  2YEL A;  4HBY A;  5ENG A;  1DVP A;  2R0S A;  5D3T A;  4QY4 A;  2L85 A;  4A9J A;  3MB3 A;  3N9P A;  4O76 A;  4C67 A;  3LQJ A;  2M1R A;  3SHB A;  2M3H A;  5KH9 A;  4CUR A;  5EI4 A;  4Y03 A;  4GND A;  2F6N A;  5I80 A;  4YAT A;  4TKP B;  5A82 A;  2YEK A;  2YHN A;  4KCX A;  5HFR A;  4LYS A;  5FE3 A;  5FE9 A;  3UVW A;  3IU6 A;  2DAT A;  3JVJ A;  5A5S A;  5KU3 A;  5A5R A;  5DFC A;  5I3L A;  4QEV A;  1BOR A;  5D1L B;  5TDR A;  3IHP A;  2E7O A;  5ETD A;  1WEP A;  3HTK C;  4QUU A;  4IOR A;  5E9I A;  5H1T A;  5EVA A;  1WEN A;  3TLP A;  5EM3 A;  4CA1 A;  4C66 A;  4MSX A;  4N4I A;  4WA6 A;  4QR3 A;  4PPE A;  4IR6 A;  5I89 A;  5D25 A;  2LGK A;  3D7C A;  3KV6 A;  2I8N A;  4YBT A;  2G43 A;  2QIC A;  1F68 A;  5FH6 A;  2HDP A;  3UV4 A;  5CQ8 A;  2ECJ A;  5G4R A;  5EWC A;  4LYW A;  5FG6 A;  5I88 A;  1JM4 B;  2R0Y A;  4MEP A;  5AD2 A;  4LKA A;  4YH3 A;  3FKM X;  4W4U A;  5D3L A;  2D9E A;  1MM2 A;  4QB3 A;  4QF3 A;  4LC2 A;  3ZTG A;  2N9G A;  2BAY A;  2YDW A;  4BBQ A;  3HME A;  5EIC A;  2CSZ A;  5D26 A;  3JVL A;  4OGI A;  4A9M A;  1Z2Q A;  5CY9 A;  2ECG A;  5EP7 A;  4N4G A; 
#chains in the Genus database with same CATH topology
 3ERR A;  3MQM A;  4O75 A;  5EPS A;  3PUR A;  4C9Z A;  2K16 A;  2JMJ A;  2YEM A;  4IR5 A;  4LZ2 A;  4YYJ A;  5HEL A;  4KV4 A;  4QC3 A;  5CQA A;  4NUE A;  2FD4 A;  2L80 A;  2M6M A;  3DDT A;  4UIY A;  2E6S A;  5EWH A;  4F3I A;  1CHC A;  2RSD A;  2HYE D;  2FFW A;  5EQ1 A;  2RO1 A;  2QJ0 A;  1F62 A;  4NQN A;  4ALH A;  4I7D A;  4Q6F A;  3M7K A;  1JM7 A;  2M85 A;  4TZ8 A;  2FUU A;  3PUQ A;  5A85 A;  5DYU A;  4OGE A;  4NYX A;  5C4Q A;  1V87 A;  1WFK A;  2YVR A;  5TDW A;  2DSM A;  2RI7 A;  4HBW A;  5F1H A;  5LKZ A;  3DQV R;  5FE4 A;  4CL9 A;  4E96 A;  4CUP A;  3N9N A;  3P1C A;  5FDZ A;  3PLW A;  2MUM A;  4QSR A;  4O71 A;  1N87 A;  2CKL B;  2JUN A;  3KQI A;  4V3K C;  4NYW A;  1G25 A;  2CRR A;  4YYI A;  2EJN A;  2RS9 B;  3EB6 A;  1ZS5 A;  5F62 A;  5B77 A;  2LV9 A;  5CRM A;  4CFK A;  5D3S A;  2FSA A;  3JVK A;  4AKN A;  2RR4 A;  2KTB B;  3N9L A;  5EYA F;  3N9O A;  4QQ4 A;  5DY7 A;  4QF2 A;  3HMH A;  3FAO A;  5JWM A;  2VJE A;  3DPL R;  4YBS A;  3ZPV E;  4UP0 A;  2LQ6 A;  2VPG A;  5KHM A;  3L1Z B;  4LRG A;  4A9N A;  5ENB A;  3RTR B;  5B76 A;  5CUC A;  2KE1 A;  2LGG A;  4UYG A;  5DKH A;  5A5O A;  5D3R A;  2RNX A;  4ZC9 A;  4QST A;  5SVI B;  4O72 A;  5F1L A;  1WE9 A;  5C85 A;  5C87 A;  2GRC A;  4V3L C;  4LZR A;  4MEN A;  3O34 A;  2XB1 A;  3G0J A;  3UW9 A;  4P5O B;  4KV1 A;  4NN2 A;  4Z6H A;  3D1B A;  2XP0 A;  4MVT A;  4O62 A;  4ZQL A;  4TYL A;  4TZ2 A;  4NYV A;  5EWV A;  3H7H A;  4AUQ B;  2VJF A;  3RPG C;  5L97 A;  5FE1 A;  3S92 A;  3Q2F A;  5CUG A;  5C7N A;  5G04 B;  2MNZ A;  5A83 A;  1ZKR A;  3SOW A;  2EOD A;  4QBM A;  4O77 A;  1MM3 A;  2L5E A;  4YYK A;  5JG6 A;  4I7B A;  5KTW A;  2KYU A;  1HYJ A;  1Z60 A;  1VD4 A;  2CSV A;  5DKC A;  3LQI A;  3JUE A;  3MHS A;  1K2F A;  3O70 A;  5FFY A;  4QR4 A;  5II2 A;  2YUR A;  5L96 A;  5FER A;  4BW4 A;  5BT3 A;  4N4F A;  1PUO A;  4B86 C;  5F60 A;  5E9L A;  4AI6 A;  2KRE A;  5DIN A;  3SHB A;  4YAD A;  5AIT A;  5II1 A;  3T7L A;  2CRW A;  3U5N A;  4TT6 A;  2LN0 A;  5CUA A;  3GL6 A;  5D3H A;  4QSQ A;  5CFW A;  5J0D A;  5L8T A;  3GV4 A;  5LKU A;  2E6R A;  3Q2E A;  2LSP B;  2K4D A;  5FE5 A;  5EU1 A;  4UIU A;  4YYH A;  3NXB A;  5HJC A;  5LJ0 A;  4IR4 A;  2OWA A;  4I7C A;  4Z0R A;  5ENI A;  4UYE A;  4O70 A;  4QC1 A;  5HQ6 A;  4NR8 A;  4IC2 A;  2KGI A;  3MUL A;  5EWD A;  2I7K A;  3ASL A;  4QSW A;  2L7P A;  5FE0 A;  2B0O E;  5EIS A;  5F5Z A;  4HXN A;  4NS5 A;  4YYN A;  4OUF A;  2G4A A;  5TB6 A;  4PKL A;  2WP1 A;  2F42 A;  5CQ4 A;  4MR6 A;  3LQH A;  1DCQ A;  3QZT A;  3MB4 A;  2YRE A;  5E0R A;  4LR6 A;  5IGN A;  4UIW A;  4PS5 A;  4TU4 A;  4O78 A;  5KTU A;  5IGK A;  4QR5 A;  4QUT A;  5L98 A;  5CS8 A;  1X4I A;  2IDA A;  3ONI A;  4HXO A;  4ALG A;  5FFW A;  5DW1 A;  1E6I A;  2DVQ A;  3VKH A;  4HXS A;  4AYC B;  2JM3 A;  4XUB A;  5DYC A;  5G4S A;  2XOC A;  1E4U A;  5DLZ A;  3KNV A;  4QSS A;  4UIX A;  5FG4 A;  5E74 A;  3FL2 A;  2YQD A;  4FIP A;  4A4B A;  2CON A;  3O7A A;  3FEH A;  3SOX A;  5B75 A;  3M62 A;  3LDY A;  4A9K A;  1X4U A;  2YYR A;  5C13 A;  4GPJ A;  5HM0 A;  5DYX A;  2KWO A;  3MHH A;  5LKT A;  2YUC A;  4NR9 A;  3VK6 A;  4IOO A;  5I1Q A;  4MEQ A;  4LYI A;  3ZYQ A;  5D3P A;  5DYA A;  4HBX A;  1T1H A;  5F25 A;  2VJF B;  3V43 A;  2VPE A;  5B78 A;  2D8U A;  2EA6 A;  1FP0 A;  2Y43 A;  4YBM A;  5HCL A;  2YSM A;  3M99 A;  2DWW A;  1RMD A;  4FO9 A;  4AVX A;  5HLS A;  2R10 A;  5ENJ A;  5CRZ A;  3UV2 A;  5CGP A;  5CU8 A;  3L11 A;  4X2I A;  4J0S A;  4TQN A;  5D1M B;  5F2P A;  2DKW A;  4NR5 A;  5EA1 A;  5KH7 A;  4NR7 A;  4YH4 A;  5KTX A;  3RCW A;  2H0D B;  1X0J A;  5IGL A;  3SVG A;  2G45 A;  3NG2 A;  3D1D A;  5FG5 A;  5ENF A;  4CUT A;  2L0B A;  3GG3 A;  3P5O A;  4Q0N A;  5ENE A;  4O7A A;  5EPB A;  2YW5 A;  4TS8 A;  5IID A;  4WZ2 A;  4YYD A;  5I7Y A;  4LDF A;  5I7X A;  4NUC A;  4QSU A;  5H9M A;  1WUM A;  3AAD A;  2MD7 B;  4MEO A;  3FJU B;  2H0D A;  5CUB A;  5D3N A;  4Z1Q A;  1WEM A;  4DON A;  4Z1S A;  2OO1 A;  5CZG A;  5DFD A;  3DAI A;  5HQ7 A;  4QEU A;  4CUS A;  2KR4 A;  3E2D A;  4GNG A;  3QZS A;  3HCS A;  3LVQ E;  4R7E A;  3DWD A;  5B79 A;  4HXL A;  2PUY A;  5DLX A;  3P1D A;  5EGU A;  1WEW A;  5BT4 A;  4WHW A;  1WES A;  4LZS A;  5F36 A;  5HRV A;  3UV5 A;  4MR3 A;  4A9H A;  4ZDT A;  3FAN A;  4J3I A;  1JSP B;  2ECV A;  4CFL A;  5D3J A;  3O37 A;  4NR6 A;  3K2J A;  5LKX A;  2LXH C;  2MA5 A;  2CKL A;  4IR3 A;  2VPD A;  3MDB C;  4A4C A;  2ECW A;  4F52 B;  1HYI A;  5B8D A;  4H9D A;  3G0L A;  3IU5 A;  2E3K A;  4CCG X;  3AQA A;  5AME A;  4XI1 A;  1N72 A;  3PHD A;  4YY6 A;  5LVR A;  2YW8 A;  5AIU A;  4CUU A;  5CUE A;  4A0C D;  2KGG A;  4FLP A;  5L8U A;  4A9L A;  3LJW A;  5FB1 A;  2F6J A;  4A9E A;  4HXM A;  1JM7 B;  4NRA A;  5F3A A;  4AKI A;  4S3O C;  4LAD B;  5FE6 A;  2C2L A;  5BT5 A;  3O33 A;  5E7D A;  3U5L A;  4QSV A;  3HCT A;  3QZV A;  5IG6 A;  4J1P A;  4TTE A;  5E3G A;  3HCU A;  3L1X A;  4O7F A;  5HEN A;  5K29 A;  5J3X A;  4QNS A;  3SVH A;  5HFQ A;  5D24 A;  5I83 A;  4N4H A;  2EXU A;  3Q1D A;  2KKY A;  4QZS A;  5G0F A;  3EB5 A;  1U6G B;  2UZG A;  5FBX A;  5IBN A;  2VP7 A;  1EQF A;  4WZ0 A;  5A5N A;  5LJ2 A;  2E7N A;  5CTL A;  5G05 B;  2OUO A;  4X3G A;  2L43 A;  2OXQ C;  2L5U A;  2MNY A;  2YHO A;  5DKD A;  4Z6I A;  4LK9 A;  5CQ7 A;  4AP4 A;  5F61 A;  4NQM A;  4LJN A;  3U5M A;  1VYX A;  1XWH A;  3DWY A;  4A9I A;  4FJC A;  4UYD A;  5AMF A;  5HRW A;  4QSP A;  4N3W A;  5DBM A;  5F63 A;  5FH7 A;  5FE8 A;  3I3J A;  1WEO A;  4NR4 A;  5A5P A;  4XY9 A;  5CQT A;  5C89 A;  2CT2 A;  4PCI A;  3KDE C;  2RFJ A;  4NUD A;  5TBN A;  5DW2 A;  4AYC A;  4QYD A;  2I50 A;  2DJA A;  3HMF A;  5KO4 A;  4WHU A;  5E9V A;  3ZPV 1;  4YAX A;  5DKA A;  4A9O A;  1WEQ A;  5CPE A;  5L99 A;  3C6W A;  5CUD A;  2KWN A;  4TU6 A;  2OSS A;  5EV9 A;  2ECI A;  2XEU A;  2LGL A;  2YU4 A;  3T6R A;  2MT5 A;  5CQ5 A;  3SOU A;  2MIQ A;  1VFY A;  4S3O B;  4PY6 A;  2LGV A;  4NRB A;  2G6Q A;  5DFB A;  4GNE A;  2C2V S;  2KU3 A;  2ZET C;  5TAB A;  4RVR A;  4ZW1 A;  3LRQ A;  2D8S A;  1FBV A;  4Q0O A;  3S91 A;  3MXF A;  4XYA A;  5ENH A;  4OGJ A;  3UVD A;  2KWJ A;  3MUK A;  2YQM A;  3RPG B;  4PCE A;  4HBV A;  4A9F A;  5A5Q A;  5D7X A;  2YSJ A;  4GB0 A;  4O64 A;  4O74 A;  1WUG A;  5E73 A;  3U5O A;  5FE2 A;  2ECN A;  3P1E A;  5HRX A;  3UVY A;  3ZYU A;  4YAB A;  2K17 A;  5D1K B;  2CSY A;  5A7C A;  5CQ3 A;  5K3Q A;  2LRI C;  4QYL A;  4OGC A;  4IC3 A;  4R2Y A;  4O7B A;  2H60 A;  4UYF A;  5ENC A;  4PTB A;  5SVX A;  4UIT A;  2Y1M A;  5IGM A;  4FK5 A;  2RNW A;  5FH8 A;  4CUQ A;  5ACY A;  2MD8 C;  5H1U A;  4BW1 A;  4BW3 A;  5COI A;  2DX8 A;  3KV5 A;  4O7E A;  4L58 A;  1WIL A;  3U5K A;  1WEU A;  2FUI A;  4QSX A;  2L84 A;  4TT4 A;  5I29 A;  3T9K A;  5FB0 A;  4MR4 A;  5EK9 A;  4XY8 A;  3LJU X;  5TCM A;  4BJX A;  5JI8 A;  2AN6 A;  3JVM A;  2EGP A;  2RNY A;  4HXP A;  4NXJ A;  5C11 A;  5KH3 A;  2DVV A;  3M63 A;  4ZUX U;  2QIZ A;  2XOZ A;  4UI9 B;  5LJ1 A;  3VKG A;  1JOC A;  1WIM A;  3UVX A;  2VNF A;  2Y1N A;  4YY4 A;  5TRB A;  5EWW A;  4UIZ A;  5FFV A;  3N9M A;  4UYF B;  5E3D A;  5ETB A;  2JRJ A;  5LCW B;  3U5P A;  5A81 A;  2D82 A;  2YYN A;  4CLB A;  3U5J A;  1WEV A;  3ZVZ B;  4TT2 A;  5E9Y A;  2KFT A;  3FM8 C;  4L7X A;  4IOQ A;  2NAA A;  2DVS A;  3I2D A;  4BW2 A;  5SVY A;  5DX4 A;  4XUA A;  5FE7 A;  3O36 A;  1LDJ B;  1MBM A;  5C8G A;  5CQ6 A;  2PNX A;  3LXJ A;  4Z93 A;  2YT5 A;  5FEY A;  5EPR A;  3N9Q A;  5HQ5 A;  2MA6 A;  2LXP C;  5LVQ A;  2JMI A;  4WZ3 B;  4NRC A;  4UP5 A;  1WEE A;  5CP5 A;  2KIZ A;  4LLB A;  3LVR E;  2L75 A;  3ZVY A;  4AKH A;  1Z6U A;  3SVF A;  2VJE B;  1IYM A;  2VPB A;  3C5K A;  5I86 A;  2R0V A;  5H1V A;  5E9M A;  4MR5 A;  5H85 A;  4YC9 A;  4GNF A;  1LDK C;  4J0R A;  2P57 A;  4YYM A;  2LDR A;  4WIV A;  5AD3 A;  5LUU A;  4B7Y C;  4R8P K;  4O7C A;  5D0C A;  2K1J A;  2JMD A;  4UIV A;  1WGM A;  3O35 A;  4QEW A;  4A49 A;  4F1P A;  2WP2 A;  1X4J A;  2KKX A;  2ECT A;  4HXK A;  2DVR A;  2YQL A;  3P1F A;  4YYG A;  2NXB A;  5HEM A;  5I40 A;  1ZBD B;  4HXR A;  2XOY A;  4BHW A;  5SVI A;  3ZNI A;  5E9K A;  4UYH A;  2LAU A;  2MJV B;  4YK0 A;  2KWK A;  2YEL A;  4HBY A;  5ENG A;  1DVP A;  2R0S A;  5D3T A;  4QY4 A;  2L85 A;  4A9J A;  3MB3 A;  3N9P A;  4O76 A;  4C67 A;  3LQJ A;  2M1R A;  2MKE A;  2M3H A;  4Z0O A;  5KH9 A;  4CUR A;  5EI4 A;  4Y03 A;  4GND A;  2F6N A;  5I80 A;  4YAT A;  2EGM A;  4TKP B;  5A82 A;  2YEK A;  2YHN A;  4KCX A;  5HFR A;  4LYS A;  5FE3 A;  5FE9 A;  3UVW A;  3IU6 A;  2DAT A;  3JVJ A;  5A5S A;  5KU3 A;  5A5R A;  5DFC A;  5I3L A;  4QEV A;  1BOR A;  5D1L B;  5TDR A;  3IHP A;  2E7O A;  5ETD A;  1WEP A;  3HTK C;  4QUU A;  2IQJ A;  4AKG A;  4IOR A;  5E9I A;  5H1T A;  5EVA A;  1WEN A;  3TLP A;  5EM3 A;  3SUB A;  4CA1 A;  4C66 A;  4MSX A;  4N4I A;  4WA6 A;  4QR3 A;  4PPE A;  4IR6 A;  5I89 A;  5D25 A;  2LGK A;  3D7C A;  3KV6 A;  2I8N A;  4YBT A;  2G43 A;  2QIC A;  1F68 A;  2M13 A;  5FH6 A;  2HDP A;  3UV4 A;  5CQ8 A;  2ECJ A;  5G4R A;  5EWC A;  4LYW A;  5FG6 A;  5I88 A;  1JM4 B;  2R0Y A;  4MEP A;  5AD2 A;  4LKA A;  4YH3 A;  3FKM X;  4W4U A;  5D3L A;  2D9E A;  1MM2 A;  4QB3 A;  2E61 A;  4QF3 A;  4LC2 A;  3ZTG A;  2N9G A;  2BAY A;  2YDW A;  4BBQ A;  3HME A;  3O47 A;  5EIC A;  2CSZ A;  5D26 A;  3JVL A;  4OGI A;  4A9M A;  1Z2Q A;  5CY9 A;  2ECG A;  5EP7 A;  4N4G A; 
#chains in the Genus database with same CATH homology
 3MQM A;  4O75 A;  5EPS A;  3PUR A;  4C9Z A;  2K16 A;  2JMJ A;  2YEM A;  4IR5 A;  4LZ2 A;  4YYJ A;  5HEL A;  4KV4 A;  4QC3 A;  5CQA A;  4NUE A;  2L80 A;  2M6M A;  4UIY A;  2E6S A;  5EWH A;  4F3I A;  1CHC A;  2RSD A;  2HYE D;  5EQ1 A;  2RO1 A;  2QJ0 A;  1F62 A;  4NQN A;  4ALH A;  4I7D A;  4Q6F A;  1JM7 A;  2M85 A;  4TZ8 A;  2FUU A;  3PUQ A;  5A85 A;  5DYU A;  4NYX A;  5C4Q A;  1V87 A;  1WFK A;  5TDW A;  2RI7 A;  4HBW A;  5F1H A;  5LKZ A;  3DQV R;  5FE4 A;  4CL9 A;  4E96 A;  4CUP A;  3N9N A;  3P1C A;  5FDZ A;  2MUM A;  4QSR A;  4O71 A;  1N87 A;  2CKL B;  3KQI A;  4V3K C;  4NYW A;  1G25 A;  4YYI A;  3EB6 A;  2RS9 B;  1ZS5 A;  5F62 A;  5B77 A;  2LV9 A;  5CRM A;  4CFK A;  5D3S A;  2FSA A;  3JVK A;  4AKN A;  2KTB B;  3N9L A;  5EYA F;  3N9O A;  5DY7 A;  4QF2 A;  3HMH A;  5JWM A;  2VJE A;  3DPL R;  4YBS A;  3ZPV E;  4UP0 A;  2LQ6 A;  2VPG A;  5KHM A;  3L1Z B;  4LRG A;  4A9N A;  5ENB A;  3RTR B;  5B76 A;  5CUC A;  2KE1 A;  2LGG A;  4UYG A;  5DKH A;  5A5O A;  5D3R A;  2RNX A;  4ZC9 A;  4QST A;  4O72 A;  5F1L A;  1WE9 A;  5C85 A;  5C87 A;  2GRC A;  4V3L C;  4LZR A;  4MEN A;  3O34 A;  2XB1 A;  3G0J A;  3UW9 A;  4P5O B;  4KV1 A;  4NN2 A;  4Z6H A;  4MVT A;  4ZQL A;  4TYL A;  4TZ2 A;  4NYV A;  5EWV A;  4AUQ B;  2VJF A;  3RPG C;  5L97 A;  5FE1 A;  3S92 A;  3Q2F A;  5CUG A;  5C7N A;  5G04 B;  2MNZ A;  5A83 A;  3SOW A;  2EOD A;  4QBM A;  4O77 A;  1MM3 A;  2L5E A;  4YYK A;  5JG6 A;  4I7B A;  5KTW A;  2KYU A;  1HYJ A;  1Z60 A;  1VD4 A;  5DKC A;  3LQI A;  3MHS A;  1K2F A;  3O70 A;  5FFY A;  4QR4 A;  5II2 A;  2YUR A;  5L96 A;  5FER A;  4BW4 A;  5BT3 A;  4N4F A;  4B86 C;  5F60 A;  5E9L A;  2KRE A;  5DIN A;  4YAD A;  5AIT A;  5II1 A;  3T7L A;  3U5N A;  4TT6 A;  2LN0 A;  5CUA A;  3GL6 A;  5D3H A;  4QSQ A;  5CFW A;  5J0D A;  5L8T A;  3GV4 A;  5LKU A;  2E6R A;  3Q2E A;  2LSP B;  2K4D A;  5FE5 A;  5EU1 A;  4UIU A;  4YYH A;  3NXB A;  5HJC A;  5LJ0 A;  4IR4 A;  4I7C A;  5ENI A;  4UYE A;  4O70 A;  4QC1 A;  5HQ6 A;  4NR8 A;  4IC2 A;  2KGI A;  3MUL A;  5EWD A;  2I7K A;  3ASL A;  4QSW A;  5FE0 A;  5EIS A;  5F5Z A;  4HXN A;  4NS5 A;  4YYN A;  4OUF A;  2G4A A;  5TB6 A;  4PKL A;  2WP1 A;  2F42 A;  5CQ4 A;  4MR6 A;  3LQH A;  3QZT A;  3MB4 A;  2YRE A;  5E0R A;  4LR6 A;  5IGN A;  4UIW A;  4PS5 A;  4TU4 A;  4O78 A;  5KTU A;  5IGK A;  4QR5 A;  4QUT A;  5L98 A;  5CS8 A;  1X4I A;  2IDA A;  3ONI A;  4HXO A;  4ALG A;  5FFW A;  5DW1 A;  1E6I A;  2DVQ A;  4HXS A;  4AYC B;  4XUB A;  5DYC A;  5G4S A;  1E4U A;  5DLZ A;  3KNV A;  4QSS A;  4UIX A;  5FG4 A;  5E74 A;  3FL2 A;  2YQD A;  4FIP A;  4A4B A;  3O7A A;  3SOX A;  5B75 A;  3M62 A;  4A9K A;  1X4U A;  2YYR A;  5C13 A;  4GPJ A;  5HM0 A;  5DYX A;  2KWO A;  3MHH A;  5LKT A;  2YUC A;  4NR9 A;  3VK6 A;  4IOO A;  5I1Q A;  4MEQ A;  4LYI A;  3ZYQ A;  5D3P A;  5DYA A;  4HBX A;  1T1H A;  5F25 A;  2VJF B;  3V43 A;  2VPE A;  5B78 A;  2EA6 A;  1FP0 A;  2Y43 A;  4YBM A;  5HCL A;  2YSM A;  3M99 A;  2DWW A;  1RMD A;  4FO9 A;  4AVX A;  5HLS A;  2R10 A;  5ENJ A;  5CRZ A;  3UV2 A;  5CGP A;  5CU8 A;  3L11 A;  4X2I A;  4J0S A;  4TQN A;  5D1M B;  5F2P A;  2DKW A;  4NR5 A;  5EA1 A;  5KH7 A;  4NR7 A;  4YH4 A;  5KTX A;  3RCW A;  2H0D B;  1X0J A;  5IGL A;  3SVG A;  2G45 A;  3NG2 A;  5FG5 A;  4CUT A;  5ENF A;  2L0B A;  3GG3 A;  3P5O A;  4Q0N A;  5ENE A;  4O7A A;  5EPB A;  2YW5 A;  4TS8 A;  5IID A;  4WZ2 A;  4YYD A;  5I7Y A;  4LDF A;  5I7X A;  4NUC A;  4QSU A;  5H9M A;  1WUM A;  3AAD A;  2MD7 B;  4MEO A;  2H0D A;  5CUB A;  5D3N A;  4Z1Q A;  1WEM A;  4DON A;  4Z1S A;  2OO1 A;  5CZG A;  5DFD A;  3DAI A;  5HQ7 A;  4QEU A;  4CUS A;  2KR4 A;  4GNG A;  4R7E A;  3QZS A;  3HCS A;  5B79 A;  4HXL A;  2PUY A;  5DLX A;  3P1D A;  5EGU A;  1WEW A;  5BT4 A;  4WHW A;  1WES A;  4LZS A;  5F36 A;  5HRV A;  3UV5 A;  4MR3 A;  4A9H A;  4ZDT A;  4J3I A;  1JSP B;  2ECV A;  4CFL A;  5D3J A;  3O37 A;  4NR6 A;  3K2J A;  5LKX A;  2LXH C;  2MA5 A;  2CKL A;  4IR3 A;  2VPD A;  4A4C A;  2ECW A;  4F52 B;  1HYI A;  5B8D A;  3G0L A;  3IU5 A;  2E3K A;  4CCG X;  3AQA A;  5AME A;  4XI1 A;  1N72 A;  3PHD A;  4YY6 A;  5LVR A;  2YW8 A;  5AIU A;  4CUU A;  5CUE A;  4A0C D;  2KGG A;  4FLP A;  5L8U A;  4A9L A;  3LJW A;  5FB1 A;  2F6J A;  4A9E A;  4HXM A;  1JM7 B;  4NRA A;  5F3A A;  4S3O C;  4LAD B;  5FE6 A;  2C2L A;  5BT5 A;  3O33 A;  5E7D A;  3U5L A;  4QSV A;  3HCT A;  3QZV A;  5IG6 A;  4J1P A;  4TTE A;  5E3G A;  3HCU A;  3L1X A;  4O7F A;  5HEN A;  5K29 A;  5J3X A;  4QNS A;  3SVH A;  5HFQ A;  5D24 A;  5I83 A;  4N4H A;  4QZS A;  5G0F A;  3EB5 A;  1U6G B;  2UZG A;  5FBX A;  5IBN A;  2VP7 A;  1EQF A;  4WZ0 A;  5A5N A;  5LJ2 A;  2E7N A;  5CTL A;  5G05 B;  2OUO A;  4X3G A;  2L43 A;  2OXQ C;  2L5U A;  2MNY A;  2YHO A;  5DKD A;  4Z6I A;  4LK9 A;  5CQ7 A;  4AP4 A;  5F61 A;  4NQM A;  4LJN A;  3U5M A;  1VYX A;  1XWH A;  3DWY A;  4A9I A;  4FJC A;  4UYD A;  5AMF A;  5HRW A;  4QSP A;  4N3W A;  5DBM A;  5F63 A;  5FH7 A;  5FE8 A;  3I3J A;  1WEO A;  4NR4 A;  5A5P A;  4XY9 A;  5CQT A;  5C89 A;  2CT2 A;  4PCI A;  2RFJ A;  4NUD A;  5TBN A;  5DW2 A;  4AYC A;  4QYD A;  2I50 A;  3HMF A;  5KO4 A;  4WHU A;  5E9V A;  3ZPV 1;  4YAX A;  5DKA A;  4A9O A;  1WEQ A;  5CPE A;  5L99 A;  3C6W A;  5CUD A;  2KWN A;  4TU6 A;  2OSS A;  5EV9 A;  2ECI A;  2XEU A;  2LGL A;  2YU4 A;  3T6R A;  2MT5 A;  5CQ5 A;  3SOU A;  2MIQ A;  1VFY A;  4S3O B;  4PY6 A;  2LGV A;  4NRB A;  2G6Q A;  5DFB A;  4GNE A;  2C2V S;  2KU3 A;  2ZET C;  5TAB A;  4RVR A;  4ZW1 A;  3LRQ A;  2D8S A;  1FBV A;  4Q0O A;  3S91 A;  3MXF A;  4XYA A;  5ENH A;  4OGJ A;  3UVD A;  2KWJ A;  3MUK A;  2YQM A;  3RPG B;  4PCE A;  4HBV A;  4A9F A;  5A5Q A;  5D7X A;  2YSJ A;  4GB0 A;  4O64 A;  4O74 A;  1WUG A;  5E73 A;  3U5O A;  5FE2 A;  2ECN A;  3P1E A;  5HRX A;  3UVY A;  3ZYU A;  4YAB A;  2K17 A;  5D1K B;  2CSY A;  5A7C A;  5CQ3 A;  2LRI C;  4QYL A;  4IC3 A;  4R2Y A;  4O7B A;  2H60 A;  4UYF A;  5ENC A;  4PTB A;  4UIT A;  2Y1M A;  5IGM A;  4FK5 A;  2RNW A;  5FH8 A;  4CUQ A;  5ACY A;  2MD8 C;  5H1U A;  4BW1 A;  4BW3 A;  5COI A;  2DX8 A;  3KV5 A;  4O7E A;  4L58 A;  1WIL A;  3U5K A;  1WEU A;  2FUI A;  4QSX A;  2L84 A;  4TT4 A;  5I29 A;  5FB0 A;  4MR4 A;  5EK9 A;  4XY8 A;  5TCM A;  4BJX A;  5JI8 A;  2AN6 A;  3JVM A;  2EGP A;  2RNY A;  4HXP A;  4NXJ A;  5C11 A;  5KH3 A;  2DVV A;  3M63 A;  4ZUX U;  2QIZ A;  4UI9 B;  5LJ1 A;  1WIM A;  1JOC A;  2VNF A;  3UVX A;  2Y1N A;  4YY4 A;  5TRB A;  5EWW A;  4UIZ A;  5FFV A;  3N9M A;  4UYF B;  5E3D A;  5ETB A;  2JRJ A;  5LCW B;  3U5P A;  5A81 A;  2D82 A;  2YYN A;  4CLB A;  3U5J A;  1WEV A;  3ZVZ B;  4TT2 A;  5E9Y A;  2KFT A;  4L7X A;  4IOQ A;  2NAA A;  2DVS A;  3I2D A;  4BW2 A;  5DX4 A;  4XUA A;  5FE7 A;  3O36 A;  1LDJ B;  5C8G A;  5CQ6 A;  2PNX A;  3LXJ A;  4Z93 A;  2YT5 A;  5FEY A;  5EPR A;  3N9Q A;  5HQ5 A;  2MA6 A;  2LXP C;  5LVQ A;  2JMI A;  4WZ3 B;  4NRC A;  4UP5 A;  1WEE A;  5CP5 A;  2KIZ A;  4LLB A;  3ZVY A;  2L75 A;  1Z6U A;  3SVF A;  2VJE B;  1IYM A;  2VPB A;  3C5K A;  5I86 A;  2R0V A;  5H1V A;  5E9M A;  4MR5 A;  5H85 A;  4YC9 A;  4GNF A;  1LDK C;  4J0R A;  4YYM A;  2LDR A;  4WIV A;  5AD3 A;  5LUU A;  4B7Y C;  4R8P K;  4O7C A;  5D0C A;  2K1J A;  2JMD A;  4UIV A;  1WGM A;  3O35 A;  4QEW A;  4A49 A;  2WP2 A;  1X4J A;  2ECT A;  4HXK A;  2DVR A;  2YQL A;  3P1F A;  4YYG A;  2NXB A;  5HEM A;  5I40 A;  1ZBD B;  4HXR A;  4BHW A;  3ZNI A;  5E9K A;  4UYH A;  2MJV B;  4YK0 A;  2KWK A;  2YEL A;  4HBY A;  5ENG A;  1DVP A;  2R0S A;  5D3T A;  4QY4 A;  2L85 A;  4A9J A;  3MB3 A;  3N9P A;  4O76 A;  4C67 A;  3LQJ A;  2M1R A;  3SHB A;  2M3H A;  5KH9 A;  4CUR A;  5EI4 A;  4Y03 A;  4GND A;  2F6N A;  5I80 A;  4YAT A;  4TKP B;  5A82 A;  2YEK A;  2YHN A;  4KCX A;  5HFR A;  4LYS A;  5FE3 A;  5FE9 A;  3UVW A;  3IU6 A;  2DAT A;  3JVJ A;  5A5S A;  5KU3 A;  5A5R A;  5DFC A;  5I3L A;  4QEV A;  1BOR A;  5D1L B;  5TDR A;  3IHP A;  2E7O A;  5ETD A;  1WEP A;  3HTK C;  4QUU A;  4IOR A;  5E9I A;  5H1T A;  5EVA A;  1WEN A;  3TLP A;  5EM3 A;  4CA1 A;  4C66 A;  4MSX A;  4N4I A;  4WA6 A;  4QR3 A;  4PPE A;  4IR6 A;  5I89 A;  5D25 A;  2LGK A;  3D7C A;  3KV6 A;  2I8N A;  4YBT A;  2G43 A;  2QIC A;  1F68 A;  5FH6 A;  2HDP A;  3UV4 A;  5CQ8 A;  2ECJ A;  5G4R A;  5EWC A;  4LYW A;  5FG6 A;  5I88 A;  1JM4 B;  2R0Y A;  4MEP A;  5AD2 A;  4LKA A;  4YH3 A;  3FKM X;  4W4U A;  5D3L A;  2D9E A;  1MM2 A;  4QB3 A;  4QF3 A;  4LC2 A;  3ZTG A;  2N9G A;  2BAY A;  2YDW A;  4BBQ A;  3HME A;  5EIC A;  2CSZ A;  5D26 A;  3JVL A;  4OGI A;  4A9M A;  1Z2Q A;  5CY9 A;  2ECG A;  5EP7 A;  4N4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...