2IQJA

Crystal structure of the gap domain of smap1l (loc64744) stromal membrane-associated protein 1-like
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
118
structure length
118
Chain Sequence
RYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Stromal membrane-associated protein 1-like
publication title Structure of the GAP domain of SMAP1L (LOC64744) stromal membrane-associated protein 1-like
rcsb
source organism Homo sapiens
total genus 39
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2iqjA00
2P57A 1DCQA 3JUEA 2IQJA 3LVRE 2B0OE 2CRRA 4F1PA 2CRWA 3LVQE 3SUBA 3DWDA 2OWAA 3O47A 3T9KA 3MDBC 3LJUX 3FEHA 3FM8C
chains in the Genus database with same CATH superfamily
1V87A 2DX8A 4GNDA 2ZETC 3GL6A 5TBNA 2E6RA 4IC3A 3RTRB 2EGMA 2LDRA 1WEUA 1N87A 1JOCA 4IC2A 3M62A 3ZPVE 3RPGC 2ECVA 5C13A 2M3HA 4UP0A 2YURA 5LCWB 1WILA 4AP4A 2ECNA 2YQLA 3GV4A 4W4UA 2KFTA 2MD8C 3I2DA 4A49A 1WEQA 5B8DA 1VD4A 4Z0OA 2XP0A 1XWHA 2MNZA 1HYJA 1FP0A 4A4BA 3KDEC 1WGMA 3SOUA 4GNGA 4AUQB 2F6JA 2VJFB 5D1KB 4QQ4A 3M63A 3KQIA 5G04B 2VJFA 2YSJA 2LGLA 3PHDA 2FFWA 2CSYA 4L58A 4CA1A 3N9PA 4F1PA 5H1UA 5TDWA 2F6NA 1IYMA 4GNEA 3L11A 3C5KA 2RR4A 2JMIA 1FBVA 5TDRA 3HTKC 3EB5A 4S3OB 3U5PA 2K17A 4FIPA 4GNFA 3ZNIA 2JMDA 1X4IA 2JM3A 2KWNA 2LN0A 2CRRA 2M13A 4P5OB 4LK9A 4C9ZA 2QIZA 2EXUA 2K4DA 2BAYA 3Q1DA 2EGPA 2MIQA 4AVXA 2KE1A 4FO9A 2Y1MA 2C2LA 3QZVA 2HYED 2XB1A 3FEHA 2HDPA 2PUYA 5FB0A 4N3WA 5B75A 3JUEA 2ECGA 4H9DA 2D8SA 3KV5A 2MT5A 2YHOA 3ZPV1 2IDAA 3PURA 3N9QA 2CRWA 2KGGA 2M6MA 1LDJB 3ZVZB 1WEVA 3FANA 5JG6A 5FEYA 4FJCA 4Z0RA 1WEMA 4WA6A 3KNVA 3T7LA 5FERA 3SOWA 2FD4A 5B76A 2VPEA 5AIUA 2OXQC 3O7AA 5TRBA 3O70A 4YBTA 1HYIA 4LLBA 4X3GA 1ZBDB 1BORA 4Q6FA 2P57A 1RMDA 1X4UA 5H1VA 3ASLA 4NN2A 3V43A 2ECWA 2H0DB 4WZ3B 3LRQA 2CSVA 2G45A 2Y43A 3O47A 4S3OC 3HCTA 3M99A 4A4CA 5LKZA 1Z6UA 2XEUA 3O34A 2FUUA 2MA6A 1WFKA 1F62A 2LAUA 4V3LC 5SVIB 2LQ6A 4B86C 5DINA 2M85A 4QF2A 5SVIA 2YVRA 3SUBA 4AYCB 2OWAA 2UZGA 2XOCA 4LADB 2RSDA 4AYCA 1LDKC 4YAXA 1Z60A 2G43A 2L75A 3LJUX 5B77A 2MA5A 2LGKA 2JMJA 1JM7B 2L80A 2MD7B 2KWJA 2LGGA 2EA6A 2YUCA 3IHPA 1T1HA 3FAOA 4R7EA 2L5UA 3LVQE 5KH7A 3MHHA 2QJ0A 4YATA 3ZYQA 2LV9A 3M7KA 2MNYA 5AITA 5LKTA 1WENA 4I7BA 1CHCA 2LRIC 2JRJA 4FK5A 3FM8C 2YT5A 3U5OA 3O35A 2I50A 4GB0A 3LQHA 3LVRE 1WEOA 4R8PK 1MM3A 2KR4A 1WIMA 2KKXA 4CCGX 4A0CD 2K16A 2FUIA 3PUQA 2NAAA 2F42A 2KKYA 4YABA 3U5NA 5C11A 4MSXA 2LGVA 3LDYA 4B7YC 2B0OE 2E61A 4WZ0A 5D1MB 2YHNA 3N9LA 4UP5A 3N9OA 2L7PA 2QICA 3VK6A 1X4JA 4L7XA 4QF3A 5G0FA 1WEWA 1WEPA 2YREA 5LKUA 3N9NA 2KYUA 2VP7A 2VPGA 3FL2A 3L1XA 3MDBC 2CSZA 3HCUA 1MBMA 3T6RA 1G25A 1WE9A 2M1RA 4MVTA 5B79A 4UI9B 1MM2A 4XI1A 3E2DA 3SOXA 3O33A 1DVPA 2AN6A 2H0DA 2LXHC 2D8UA 3DWDA 5H9MA 4YADA 4ZQLA 5H1TA 1DCQA 4BBQA 5TABA 4R2YA 4WZ2A 5DKAA 2K1JA 4LJNA 2YSMA 4V3KC 3RPGB 4BHWA 3DQVR 3SHBA 5I3LA 4PTBA 3PLWA 3HCSA 2YYRA 5J3XA 4I7CA 1WESA 3O37A 3ZTGA 3C6WA 2CKLB 2IQJA 2RI7A 2VPBA 2KWKA 1JM7A 2KGIA 2CKLA 4LKAA 4I7DA 2DSMA 2VJEB 1U6GB 3MHSA 4O64A 2VJEA 3H7HA 3EB6A 2FSAA 2KWOA 1E4UA 5B78A 4N4FA 2VPDA 4OGCA 5KH9A 5G05B 3ZVYA 2ECTA 2C2VS 4F52B 4O62A 4PPEA 2E6SA 5SVXA 4ZUXU 2XOZA 3U5MA 5KH3A 2Y1NA 2G6QA 3FJUB 1K2FA 2ECJA 2EODA 2LXPC 2KREA 1Z2QA 3LQIA 4YBSA 4ZDTA 2MKEA 2PNXA 1WEEA 2YW8A 5EYAF 2KU3A 5K3QA 2YU4A 2L43A 3L1ZB 1VFYA 2XOYA 5SVYA 3N9MA 2MUMA 3O36A 4OGEA 2KIZA 5FB1A 5LKXA 3DPLR 2DJAA 4TKPB 2VNFA 5D1LB 1VYXA 3KV6A 3LQJA 4YC9A 2YQMA 2ECIA 4YBMA 3NG2A 2JUNA 3T9KA 3DDTA 2CT2A 2L0BA 2CONA
chains in the Genus database with same CATH topology
2P57A 5SVXA 1DCQA 3JUEA 4QQ4A 3LDYA 2XOZA 2XOYA 2JM3A 4H9DA 2IQJA 3LVRE 5SVYA 4Z0OA 2B0OE 2E61A 2CRRA 2M13A 2LAUA 4OGEA 2FFWA 5SVIB 3FJUB 2FD4A 2L7PA 2EXUA 3E2DA 4F1PA 3Q1DA 5SVIA 2CSVA 2EGMA 2CRWA 3H7HA 2DJAA 2XP0A 3LVQE 2D8UA 2KKXA 2RR4A 2YVRA 3SUBA 3KDEC 3DWDA 2OWAA 3O47A 2YREA 2XOCA 4OGCA 3PLWA 2MKEA 4Z0RA 3M7KA 2JUNA 3T9KA 3DDTA 2KKYA 3MDBC 3LJUX 4O62A 2CONA 3FEHA 5K3QA 3FM8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P57 A;  1DCQ A;  3JUE A;  2IQJ A;  3LVR E;  2B0O E;  2CRR A;  4F1P A;  2CRW A;  3LVQ E;  3SUB A;  3DWD A;  2OWA A;  3O47 A;  3T9K A;  3MDB C;  3LJU X;  3FEH A;  3FM8 C; 
#chains in the Genus database with same CATH topology
 1V87 A;  2DX8 A;  4GND A;  2ZET C;  3GL6 A;  5TBN A;  2E6R A;  4IC3 A;  3RTR B;  2EGM A;  2LDR A;  1WEU A;  1N87 A;  1JOC A;  4IC2 A;  3M62 A;  3ZPV E;  3RPG C;  2ECV A;  5C13 A;  2M3H A;  4UP0 A;  2YUR A;  5LCW B;  1WIL A;  4AP4 A;  2ECN A;  2YQL A;  3GV4 A;  4W4U A;  2KFT A;  2MD8 C;  3I2D A;  4A49 A;  1WEQ A;  5B8D A;  1VD4 A;  4Z0O A;  2XP0 A;  1XWH A;  2MNZ A;  1HYJ A;  1FP0 A;  4A4B A;  3KDE C;  1WGM A;  3SOU A;  4GNG A;  4AUQ B;  2F6J A;  2VJF B;  5D1K B;  4QQ4 A;  3M63 A;  3KQI A;  5G04 B;  2VJF A;  2YSJ A;  2LGL A;  3PHD A;  2FFW A;  2CSY A;  4L58 A;  4CA1 A;  3N9P A;  4F1P A;  5H1U A;  5TDW A;  2F6N A;  1IYM A;  4GNE A;  3L11 A;  3C5K A;  2RR4 A;  2JMI A;  1FBV A;  5TDR A;  3HTK C;  3EB5 A;  4S3O B;  3U5P A;  2K17 A;  4FIP A;  4GNF A;  3ZNI A;  2JMD A;  1X4I A;  2JM3 A;  2KWN A;  2LN0 A;  2CRR A;  2M13 A;  4P5O B;  4LK9 A;  4C9Z A;  2QIZ A;  2EXU A;  2K4D A;  2BAY A;  3Q1D A;  2EGP A;  2MIQ A;  4AVX A;  2KE1 A;  4FO9 A;  2Y1M A;  2C2L A;  3QZV A;  2HYE D;  2XB1 A;  3FEH A;  2HDP A;  2PUY A;  5FB0 A;  4N3W A;  5B75 A;  3JUE A;  2ECG A;  4H9D A;  2D8S A;  3KV5 A;  2MT5 A;  2YHO A;  3ZPV 1;  2IDA A;  3PUR A;  3N9Q A;  2CRW A;  2KGG A;  2M6M A;  1LDJ B;  3ZVZ B;  1WEV A;  3FAN A;  5JG6 A;  5FEY A;  4FJC A;  4Z0R A;  1WEM A;  4WA6 A;  3KNV A;  3T7L A;  5FER A;  3SOW A;  2FD4 A;  5B76 A;  2VPE A;  5AIU A;  2OXQ C;  3O7A A;  5TRB A;  3O70 A;  4YBT A;  1HYI A;  4LLB A;  4X3G A;  1ZBD B;  1BOR A;  4Q6F A;  2P57 A;  1RMD A;  1X4U A;  5H1V A;  3ASL A;  4NN2 A;  3V43 A;  2ECW A;  2H0D B;  4WZ3 B;  3LRQ A;  2CSV A;  2G45 A;  2Y43 A;  3O47 A;  4S3O C;  3HCT A;  3M99 A;  4A4C A;  5LKZ A;  1Z6U A;  2XEU A;  3O34 A;  2FUU A;  2MA6 A;  1WFK A;  1F62 A;  2LAU A;  4V3L C;  5SVI B;  2LQ6 A;  4B86 C;  5DIN A;  2M85 A;  4QF2 A;  5SVI A;  2YVR A;  3SUB A;  4AYC B;  2OWA A;  2UZG A;  2XOC A;  4LAD B;  2RSD A;  4AYC A;  1LDK C;  4YAX A;  1Z60 A;  2G43 A;  2L75 A;  3LJU X;  5B77 A;  2MA5 A;  2LGK A;  2JMJ A;  1JM7 B;  2L80 A;  2MD7 B;  2KWJ A;  2LGG A;  2EA6 A;  2YUC A;  3IHP A;  1T1H A;  3FAO A;  4R7E A;  2L5U A;  3LVQ E;  5KH7 A;  3MHH A;  2QJ0 A;  4YAT A;  3ZYQ A;  2LV9 A;  3M7K A;  2MNY A;  5AIT A;  5LKT A;  1WEN A;  4I7B A;  1CHC A;  2LRI C;  2JRJ A;  4FK5 A;  3FM8 C;  2YT5 A;  3U5O A;  3O35 A;  2I50 A;  4GB0 A;  3LQH A;  3LVR E;  1WEO A;  4R8P K;  1MM3 A;  2KR4 A;  1WIM A;  2KKX A;  4CCG X;  4A0C D;  2K16 A;  2FUI A;  3PUQ A;  2NAA A;  2F42 A;  2KKY A;  4YAB A;  3U5N A;  5C11 A;  4MSX A;  2LGV A;  3LDY A;  4B7Y C;  2B0O E;  2E61 A;  4WZ0 A;  5D1M B;  2YHN A;  3N9L A;  4UP5 A;  3N9O A;  2L7P A;  2QIC A;  3VK6 A;  1X4J A;  4L7X A;  4QF3 A;  5G0F A;  1WEW A;  1WEP A;  2YRE A;  5LKU A;  3N9N A;  2KYU A;  2VP7 A;  2VPG A;  3FL2 A;  3L1X A;  3MDB C;  2CSZ A;  3HCU A;  1MBM A;  3T6R A;  1G25 A;  1WE9 A;  2M1R A;  4MVT A;  5B79 A;  4UI9 B;  1MM2 A;  4XI1 A;  3E2D A;  3SOX A;  3O33 A;  1DVP A;  2AN6 A;  2H0D A;  2LXH C;  2D8U A;  3DWD A;  5H9M A;  4YAD A;  4ZQL A;  5H1T A;  1DCQ A;  4BBQ A;  5TAB A;  4R2Y A;  4WZ2 A;  5DKA A;  2K1J A;  4LJN A;  2YSM A;  4V3K C;  3RPG B;  4BHW A;  3DQV R;  3SHB A;  5I3L A;  4PTB A;  3PLW A;  3HCS A;  2YYR A;  5J3X A;  4I7C A;  1WES A;  3O37 A;  3ZTG A;  3C6W A;  2CKL B;  2IQJ A;  2RI7 A;  2VPB A;  2KWK A;  1JM7 A;  2KGI A;  2CKL A;  4LKA A;  4I7D A;  2DSM A;  2VJE B;  1U6G B;  3MHS A;  4O64 A;  2VJE A;  3H7H A;  3EB6 A;  2FSA A;  2KWO A;  1E4U A;  5B78 A;  4N4F A;  2VPD A;  4OGC A;  5KH9 A;  5G05 B;  3ZVY A;  2ECT A;  2C2V S;  4F52 B;  4O62 A;  4PPE A;  2E6S A;  5SVX A;  4ZUX U;  2XOZ A;  3U5M A;  5KH3 A;  2Y1N A;  2G6Q A;  3FJU B;  1K2F A;  2ECJ A;  2EOD A;  2LXP C;  2KRE A;  1Z2Q A;  3LQI A;  4YBS A;  4ZDT A;  2MKE A;  2PNX A;  1WEE A;  2YW8 A;  5EYA F;  2KU3 A;  5K3Q A;  2YU4 A;  2L43 A;  3L1Z B;  1VFY A;  2XOY A;  5SVY A;  3N9M A;  2MUM A;  3O36 A;  4OGE A;  2KIZ A;  5FB1 A;  5LKX A;  3DPL R;  2DJA A;  4TKP B;  2VNF A;  5D1L B;  1VYX A;  3KV6 A;  3LQJ A;  4YC9 A;  2YQM A;  2ECI A;  4YBM A;  3NG2 A;  2JUN A;  3T9K A;  3DDT A;  2CT2 A;  2L0B A;  2CON A; 
#chains in the Genus database with same CATH homology
 2P57 A;  5SVX A;  1DCQ A;  3JUE A;  4QQ4 A;  3LDY A;  2XOZ A;  2XOY A;  2JM3 A;  4H9D A;  2IQJ A;  3LVR E;  5SVY A;  4Z0O A;  2B0O E;  2E61 A;  2CRR A;  2M13 A;  2LAU A;  4OGE A;  2FFW A;  5SVI B;  3FJU B;  2FD4 A;  2L7P A;  2EXU A;  3E2D A;  4F1P A;  3Q1D A;  5SVI A;  2CSV A;  2EGM A;  2CRW A;  3H7H A;  2DJA A;  2XP0 A;  3LVQ E;  2D8U A;  2KKX A;  2RR4 A;  2YVR A;  3SUB A;  3KDE C;  3DWD A;  2OWA A;  3O47 A;  2YRE A;  2XOC A;  4OGC A;  3PLW A;  2MKE A;  4Z0R A;  3M7K A;  2JUN A;  3T9K A;  3DDT A;  2KKY A;  3MDB C;  3LJU X;  4O62 A;  2CON A;  3FEH A;  5K3Q A;  3FM8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...