3FL2A

Crystal structure of the ring domain of the e3 ubiquitin-protein ligase uhrf1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
116
Chain Sequence
SLTAQQSSLIREDKSNAKLWNEVLASRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structure of the Ring Domain of the E3 Ubiquitin-Protein Ligase Uhrf1
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 36
structure length 116
sequence length 119
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3fl2A00
4AVXA 4L58A 2L43A 3GL6A 1WGMA 5TBNA 2LGLA 3KQIA 2KGIA 3EB6A 2ECNA 2MD8C 4P5OB 2HDPA 4ZDTA 3ZVYA 2ECWA 5B75A 2VJEB 1WIMA 2KE1A 3SOWA 3GV4A 5G04B 4WA6A 2OXQC 4LADB 4R2YA 4UP0A 3C6WA 2MD7B 2QJ0A 5J3XA 1VFYA 2LGKA 4L7XA 2MIQA 2PUYA 3RPGC 3MHHA 4A0CD 2KYUA 4YBMA 4GNEA 1IYMA 5LKZA 5D1MB 2RI7A 3N9PA 2F6NA 4WZ3B 2EGPA 2VJEA 4BBQA 1X4JA 2Y1NA 2L0BA 2YT5A 3N9NA 3U5OA 3T7LA 2CT2A 2M6MA 2YW8A 5FB0A 2XB1A 2YURA 4TKPB 5I3LA 5LKUA 2VP7A 2VPBA 3ZNIA 2M1RA 4B86C 5C11A 2KU3A 3IHPA 2YQMA 2L80A 4AUQB 2KIZA 2Y1MA 3MHSA 1ZBDB 1E4UA 1FBVA 1DVPA 4GB0A 5LKXA 4B7YC 4A4CA 3LQIA 1WEEA 2D8SA 3KV5A 1WEPA 3O34A 1Z6UA 4FO9A 4O64A 1K2FA 2LXPC 5C13A 4N4FA 2LGVA 4NN2A 4BHWA 3LRQA 2AN6A 3HCUA 5FERA 4UI9B 2EODA 3PHDA 2LN0A 2JRJA 3T6RA 2K1JA 4S3OC 1V87A 4ZQLA 2KWKA 5H1UA 2DX8A 2KR4A 4GNGA 2G45A 2MA5A 2VJFB 2ECJA 4LLBA 2FSAA 2KWJA 4IC2A 3ZTGA 3M62A 2G43A 1WEOA 2LV9A 5H1VA 5B79A 5B78A 4F52B 3U5PA 3HTKC 2KFTA 4R7EA 4N3WA 5G05B 1LDKC 2YQLA 2YREA 2MNYA 3O33A 4GNFA 3KNVA 3PUQA 5D1KB 2L5UA 5LCWB 5B8DA 3RPGB 4UP5A 1RMDA 3O7AA 3O35A 4WZ2A 2QIZA 4GNDA 2MT5A 2VJFA 5AITA 2G6QA 1VD4A 5KH9A 3M63A 4V3KC 3V43A 2CKLB 1WFKA 4YADA 2LGGA 3O37A 3EB5A 4MSXA 4AYCB 5TRBA 3VK6A 1WEUA 5DKAA 5JG6A 5KH7A 3SHBA 1MM2A 2YUCA 4A49A 1CHCA 2LDRA 3QZVA 1WESA 4FJCA 2MA6A 2E6SA 1F62A 1Z2QA 4YATA 3HCSA 2Y43A 5DINA 2ECIA 1HYIA 2YSJA 1X4IA 2CKLA 2QICA 4XI1A 1VYXA 2ECGA 4I7DA 1LDJB 3PURA 4Q6FA 5EYAF 2MNZA 2PNXA 4YBSA 5B76A 3LQHA 2JMIA 2KGGA 1Z60A 2L75A 3HCTA 4S3OB 2KREA 2M85A 1WENA 2KWNA 3DPLR 5AIUA 2ECTA 2C2LA 2VNFA 5G0FA 2LXHC 2K17A 3M99A 1MM3A 2LRIC 4FIPA 2LQ6A 2IDAA 1JM7B 4PTBA 1X4UA 4I7BA 4CCGX 3N9QA 3C5KA 5LKTA 3U5NA 1WEVA 4MVTA 2FUUA 3SOXA 2M3HA 2YHNA 3ASLA 3NG2A 2H0DB 4CA1A 2E6RA 3N9LA 3N9MA 1WEQA 3DQVR 5B77A 4R8PK 3RTRB 3SOUA 5TDWA 2JMDA 5TABA 4X3GA 3FL2A 1G25A 2ZETC 1JOCA 3L1ZB 5H9MA 3LQJA 2YYRA 2FUIA 4W4UA 2EA6A 5FEYA 2YU4A 2CSYA 1WILA 2RSDA 1JM7A 3N9OA 5FB1A 2HYED 5KH3A 4C9ZA 1WEMA 5TDRA 4I7CA 3ZPV1 2C2VS 4AP4A 2I50A 3U5MA 2YSMA 3O36A 2K4DA 1U6GB 2H0DA 4QF3A 2JMJA 4YAXA 2KWOA 3KV6A 2ECVA 4YBTA 3I2DA 4PPEA 1WE9A 2CSZA 2K16A 2VPGA 2MUMA 3L1XA 1T1HA 4ZUXU 1N87A 4A4BA 3ZYQA 1FP0A 2VPDA 4AYCA 4LK9A 4V3LC 4YC9A 3ZPVE 2F6JA 2VPEA 2BAYA 3O70A 1HYJA 1WEWA 2UZGA 2XEUA 4LJNA 3L11A 4IC3A 4FK5A 1BORA 2NAAA 5H1TA 4WZ0A 3ZVZB 4QF2A 1XWHA 2YHOA 4LKAA 2F42A 5D1LB 4YABA
chains in the Genus database with same CATH superfamily
4AVXA 4L58A 2L43A 2LAUA 3GL6A 1WGMA 5TBNA 2LGLA 3KQIA 2KGIA 3EB6A 2ECNA 2MD8C 4P5OB 2HDPA 4ZDTA 3ZVYA 2ECWA 5B75A 3SUBA 2VJEB 1WIMA 2KE1A 3SOWA 3GV4A 5G04B 4WA6A 2OXQC 4LADB 4R2YA 4UP0A 3C6WA 2MD7B 2QJ0A 5J3XA 1VFYA 2LGKA 4L7XA 2FD4A 2MIQA 2PUYA 3RPGC 3MHHA 4A0CD 2KYUA 2M13A 4YBMA 4GNEA 1IYMA 2DSMA 2YVRA 5LKZA 5D1MB 2RI7A 3N9PA 2F6NA 4WZ3B 2EGPA 2XP0A 2VJEA 4BBQA 1X4JA 2Y1NA 2EXUA 2L0BA 2YT5A 3N9NA 3U5OA 3LVQE 3T7LA 2CT2A 2M6MA 2YW8A 5FB0A 2XB1A 2YURA 4TKPB 5I3LA 5LKUA 2VP7A 2VPBA 3ZNIA 2M1RA 4B86C 5C11A 2KU3A 3IHPA 4F1PA 2YQMA 1MBMA 3MDBC 2L80A 4AUQB 2KIZA 2Y1MA 3MHSA 1ZBDB 3PLWA 1E4UA 1FBVA 1DVPA 4GB0A 5LKXA 4B7YC 4A4CA 3LQIA 1WEEA 2D8SA 3KV5A 1WEPA 3O34A 1Z6UA 4FO9A 4O64A 1K2FA 2LXPC 5C13A 3FM8C 4N4FA 2CRWA 3M7KA 2LGVA 4NN2A 4BHWA 1DCQA 3LRQA 2XOCA 2AN6A 3HCUA 5FERA 4UI9B 2EODA 3PHDA 2LN0A 2JRJA 3T6RA 2CSVA 2K1JA 4S3OC 1V87A 4ZQLA 2KWKA 5H1UA 2DX8A 2KR4A 4GNGA 2G45A 2MA5A 3H7HA 2VJFB 2B0OE 2ECJA 4LLBA 2FSAA 2KWJA 4IC2A 3ZTGA 3M62A 2G43A 2XOYA 1WEOA 2LV9A 5H1VA 5B79A 5B78A 4F52B 3U5PA 3HTKC 2KFTA 4R7EA 2DJAA 4N3WA 5G05B 1LDKC 2YQLA 2YREA 2MNYA 3LVRE 3O33A 2L7PA 4GNFA 3KNVA 3PUQA 5D1KB 2L5UA 5LCWB 5B8DA 3RPGB 4UP5A 1RMDA 3O7AA 3FEHA 2JM3A 3O35A 4WZ2A 2QIZA 4GNDA 2MT5A 2VJFA 5AITA 2G6QA 1VD4A 5KH9A 3M63A 4V3KC 3V43A 2CKLB 1WFKA 4YADA 2LGGA 3O37A 3EB5A 4MSXA 4AYCB 5TRBA 3VK6A 2FFWA 1WEUA 5DKAA 5JG6A 5KH7A 3SHBA 1MM2A 2YUCA 4A49A 1CHCA 2LDRA 3QZVA 1WESA 4FJCA 2MA6A 2E6SA 1F62A 1Z2QA 2D8UA 4YATA 3HCSA 2IQJA 3Q1DA 2Y43A 5DINA 2ECIA 1HYIA 2KKYA 2YSJA 2CRRA 1X4IA 2CKLA 2QICA 4XI1A 1VYXA 5K3QA 2ECGA 4I7DA 1LDJB 3PURA 4Q6FA 5EYAF 2MNZA 2PNXA 5SVIB 3DWDA 4YBSA 4Z0OA 5B76A 2CONA 3LQHA 2JMIA 2KGGA 1Z60A 2L75A 3HCTA 4S3OB 2KREA 2M85A 1WENA 2KWNA 3DPLR 5AIUA 2ECTA 2C2LA 2VNFA 5G0FA 2LXHC 2K17A 3M99A 1MM3A 4Z0RA 2LRIC 5SVYA 3FANA 2P57A 4FIPA 2LQ6A 2IDAA 1JM7B 4PTBA 4QQ4A 1X4UA 4I7BA 4CCGX 3N9QA 3C5KA 5LKTA 3U5NA 1WEVA 3FJUB 4MVTA 2KKXA 2FUUA 3SOXA 2M3HA 2YHNA 3ASLA 3NG2A 2H0DB 3O47A 4CA1A 5SVIA 2E6RA 3N9LA 3N9MA 2MKEA 3LDYA 1WEQA 3T9KA 3DQVR 5B77A 4R8PK 3RTRB 4H9DA 5TDWA 3SOUA 2JMDA 5TABA 4X3GA 4OGEA 3FL2A 1G25A 2ZETC 1JOCA 3L1ZB 5H9MA 3LQJA 2YYRA 2FUIA 4W4UA 2EA6A 5FEYA 2YU4A 2CSYA 1WILA 2RSDA 1JM7A 3N9OA 3JUEA 5FB1A 2HYED 2RR4A 5KH3A 4C9ZA 1WEMA 5TDRA 4I7CA 3ZPV1 2C2VS 2XOZA 4AP4A 2I50A 3U5MA 2YSMA 3LJUX 2K4DA 3O36A 1U6GB 2H0DA 4QF3A 2JMJA 4YAXA 5SVXA 2KWOA 2OWAA 3KV6A 2JUNA 2EGMA 4O62A 2ECVA 4YBTA 3I2DA 4PPEA 1WE9A 2CSZA 2K16A 2VPGA 2MUMA 3L1XA 1T1HA 4ZUXU 1N87A 3FAOA 4A4BA 3ZYQA 1FP0A 2VPDA 2E61A 4AYCA 4LK9A 4V3LC 4YC9A 3ZPVE 2F6JA 3E2DA 2VPEA 2BAYA 3O70A 1HYJA 3KDEC 1WEWA 2UZGA 2XEUA 4LJNA 3L11A 4IC3A 4FK5A 4OGCA 1BORA 2NAAA 5H1TA 3DDTA 4WZ0A 3ZVZB 4QF2A 1XWHA 2YHOA 4LKAA 2F42A 5D1LB 4YABA
chains in the Genus database with same CATH topology
4AVXA 4L58A 2L43A 3GL6A 1WGMA 5TBNA 2LGLA 3KQIA 2KGIA 3EB6A 2ECNA 2MD8C 4P5OB 2HDPA 4ZDTA 3ZVYA 2ECWA 5B75A 2VJEB 1WIMA 2KE1A 3SOWA 3GV4A 5G04B 4WA6A 2OXQC 4LADB 4R2YA 4UP0A 3C6WA 2MD7B 2QJ0A 5J3XA 1VFYA 2LGKA 4L7XA 2MIQA 2PUYA 3RPGC 3MHHA 4A0CD 2KYUA 4YBMA 4GNEA 1IYMA 5LKZA 5D1MB 2RI7A 3N9PA 2F6NA 4WZ3B 2EGPA 2VJEA 4BBQA 1X4JA 2Y1NA 2L0BA 2YT5A 3N9NA 3U5OA 3T7LA 2CT2A 2M6MA 2YW8A 5FB0A 2XB1A 2YURA 4TKPB 5I3LA 5LKUA 2VP7A 2VPBA 3ZNIA 2M1RA 4B86C 5C11A 2KU3A 3IHPA 2YQMA 2L80A 4AUQB 2KIZA 2Y1MA 3MHSA 1ZBDB 1E4UA 1FBVA 1DVPA 4GB0A 5LKXA 4B7YC 4A4CA 3LQIA 1WEEA 2D8SA 3KV5A 1WEPA 3O34A 1Z6UA 4FO9A 4O64A 1K2FA 2LXPC 5C13A 4N4FA 2LGVA 4NN2A 4BHWA 3LRQA 2AN6A 3HCUA 5FERA 4UI9B 2EODA 3PHDA 2LN0A 2JRJA 3T6RA 2K1JA 4S3OC 1V87A 4ZQLA 2KWKA 5H1UA 2DX8A 2KR4A 4GNGA 2G45A 2MA5A 2VJFB 2ECJA 4LLBA 2FSAA 2KWJA 4IC2A 3ZTGA 3M62A 2G43A 1WEOA 2LV9A 5H1VA 5B79A 5B78A 4F52B 3U5PA 3HTKC 2KFTA 4R7EA 4N3WA 5G05B 1LDKC 2YQLA 2YREA 2MNYA 3O33A 4GNFA 3KNVA 3PUQA 5D1KB 2L5UA 5LCWB 5B8DA 3RPGB 4UP5A 1RMDA 3O7AA 3O35A 4WZ2A 2QIZA 4GNDA 2MT5A 2VJFA 5AITA 2G6QA 1VD4A 5KH9A 3M63A 4V3KC 3V43A 2CKLB 1WFKA 4YADA 2LGGA 3O37A 3EB5A 4MSXA 4AYCB 5TRBA 3VK6A 1WEUA 5DKAA 5JG6A 5KH7A 3SHBA 1MM2A 2YUCA 4A49A 1CHCA 2LDRA 3QZVA 1WESA 4FJCA 2MA6A 2E6SA 1F62A 1Z2QA 4YATA 3HCSA 2Y43A 5DINA 2ECIA 1HYIA 2YSJA 1X4IA 2CKLA 2QICA 4XI1A 1VYXA 2ECGA 4I7DA 1LDJB 3PURA 4Q6FA 5EYAF 2MNZA 2PNXA 4YBSA 5B76A 3LQHA 2JMIA 2KGGA 1Z60A 2L75A 3HCTA 4S3OB 2KREA 2M85A 1WENA 2KWNA 3DPLR 5AIUA 2ECTA 2C2LA 2VNFA 5G0FA 2LXHC 2K17A 3M99A 1MM3A 2LRIC 4FIPA 2LQ6A 2IDAA 1JM7B 4PTBA 1X4UA 4I7BA 4CCGX 3N9QA 3C5KA 5LKTA 3U5NA 1WEVA 4MVTA 2FUUA 3SOXA 2M3HA 2YHNA 3ASLA 3NG2A 2H0DB 4CA1A 2E6RA 3N9LA 3N9MA 1WEQA 3DQVR 5B77A 4R8PK 3RTRB 3SOUA 5TDWA 2JMDA 5TABA 4X3GA 3FL2A 1G25A 2ZETC 1JOCA 3L1ZB 5H9MA 3LQJA 2YYRA 2FUIA 4W4UA 2EA6A 5FEYA 2YU4A 2CSYA 1WILA 2RSDA 1JM7A 3N9OA 5FB1A 2HYED 5KH3A 4C9ZA 1WEMA 5TDRA 4I7CA 3ZPV1 2C2VS 4AP4A 2I50A 3U5MA 2YSMA 3O36A 2K4DA 1U6GB 2H0DA 4QF3A 2JMJA 4YAXA 2KWOA 3KV6A 2ECVA 4YBTA 3I2DA 4PPEA 1WE9A 2CSZA 2K16A 2VPGA 2MUMA 3L1XA 1T1HA 4ZUXU 1N87A 4A4BA 3ZYQA 1FP0A 2VPDA 4AYCA 4LK9A 4V3LC 4YC9A 3ZPVE 2F6JA 2VPEA 2BAYA 3O70A 1HYJA 1WEWA 2UZGA 2XEUA 4LJNA 3L11A 4IC3A 4FK5A 1BORA 2NAAA 5H1TA 4WZ0A 3ZVZB 4QF2A 1XWHA 2YHOA 4LKAA 2F42A 5D1LB 4YABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVX A;  4L58 A;  2L43 A;  3GL6 A;  1WGM A;  5TBN A;  2LGL A;  3KQI A;  2KGI A;  3EB6 A;  2ECN A;  2MD8 C;  4P5O B;  2HDP A;  4ZDT A;  3ZVY A;  2ECW A;  5B75 A;  2VJE B;  1WIM A;  2KE1 A;  3SOW A;  3GV4 A;  5G04 B;  4WA6 A;  2OXQ C;  4LAD B;  4R2Y A;  4UP0 A;  3C6W A;  2MD7 B;  2QJ0 A;  5J3X A;  1VFY A;  2LGK A;  4L7X A;  2MIQ A;  2PUY A;  3RPG C;  3MHH A;  4A0C D;  2KYU A;  4YBM A;  4GNE A;  1IYM A;  5LKZ A;  5D1M B;  2RI7 A;  3N9P A;  2F6N A;  4WZ3 B;  2EGP A;  2VJE A;  4BBQ A;  1X4J A;  2Y1N A;  2L0B A;  2YT5 A;  3N9N A;  3U5O A;  3T7L A;  2CT2 A;  2M6M A;  2YW8 A;  5FB0 A;  2XB1 A;  2YUR A;  4TKP B;  5I3L A;  5LKU A;  2VP7 A;  2VPB A;  3ZNI A;  2M1R A;  4B86 C;  5C11 A;  2KU3 A;  3IHP A;  2YQM A;  2L80 A;  4AUQ B;  2KIZ A;  2Y1M A;  3MHS A;  1ZBD B;  1E4U A;  1FBV A;  1DVP A;  4GB0 A;  5LKX A;  4B7Y C;  4A4C A;  3LQI A;  1WEE A;  2D8S A;  3KV5 A;  1WEP A;  3O34 A;  1Z6U A;  4FO9 A;  4O64 A;  1K2F A;  2LXP C;  5C13 A;  4N4F A;  2LGV A;  4NN2 A;  4BHW A;  3LRQ A;  2AN6 A;  3HCU A;  5FER A;  4UI9 B;  2EOD A;  3PHD A;  2LN0 A;  2JRJ A;  3T6R A;  2K1J A;  4S3O C;  1V87 A;  4ZQL A;  2KWK A;  5H1U A;  2DX8 A;  2KR4 A;  4GNG A;  2G45 A;  2MA5 A;  2VJF B;  2ECJ A;  4LLB A;  2FSA A;  2KWJ A;  4IC2 A;  3ZTG A;  3M62 A;  2G43 A;  1WEO A;  2LV9 A;  5H1V A;  5B79 A;  5B78 A;  4F52 B;  3U5P A;  3HTK C;  2KFT A;  4R7E A;  4N3W A;  5G05 B;  1LDK C;  2YQL A;  2YRE A;  2MNY A;  3O33 A;  4GNF A;  3KNV A;  3PUQ A;  5D1K B;  2L5U A;  5LCW B;  5B8D A;  3RPG B;  4UP5 A;  1RMD A;  3O7A A;  3O35 A;  4WZ2 A;  2QIZ A;  4GND A;  2MT5 A;  2VJF A;  5AIT A;  2G6Q A;  1VD4 A;  5KH9 A;  3M63 A;  4V3K C;  3V43 A;  2CKL B;  1WFK A;  4YAD A;  2LGG A;  3O37 A;  3EB5 A;  4MSX A;  4AYC B;  5TRB A;  3VK6 A;  1WEU A;  5DKA A;  5JG6 A;  5KH7 A;  3SHB A;  1MM2 A;  2YUC A;  4A49 A;  1CHC A;  2LDR A;  3QZV A;  1WES A;  4FJC A;  2MA6 A;  2E6S A;  1F62 A;  1Z2Q A;  4YAT A;  3HCS A;  2Y43 A;  5DIN A;  2ECI A;  1HYI A;  2YSJ A;  1X4I A;  2CKL A;  2QIC A;  4XI1 A;  1VYX A;  2ECG A;  4I7D A;  1LDJ B;  3PUR A;  4Q6F A;  5EYA F;  2MNZ A;  2PNX A;  4YBS A;  5B76 A;  3LQH A;  2JMI A;  2KGG A;  1Z60 A;  2L75 A;  3HCT A;  4S3O B;  2KRE A;  2M85 A;  1WEN A;  2KWN A;  3DPL R;  5AIU A;  2ECT A;  2C2L A;  2VNF A;  5G0F A;  2LXH C;  2K17 A;  3M99 A;  1MM3 A;  2LRI C;  4FIP A;  2LQ6 A;  2IDA A;  1JM7 B;  4PTB A;  1X4U A;  4I7B A;  4CCG X;  3N9Q A;  3C5K A;  5LKT A;  3U5N A;  1WEV A;  4MVT A;  2FUU A;  3SOX A;  2M3H A;  2YHN A;  3ASL A;  3NG2 A;  2H0D B;  4CA1 A;  2E6R A;  3N9L A;  3N9M A;  1WEQ A;  3DQV R;  5B77 A;  4R8P K;  3RTR B;  3SOU A;  5TDW A;  2JMD A;  5TAB A;  4X3G A;  3FL2 A;  1G25 A;  2ZET C;  1JOC A;  3L1Z B;  5H9M A;  3LQJ A;  2YYR A;  2FUI A;  4W4U A;  2EA6 A;  5FEY A;  2YU4 A;  2CSY A;  1WIL A;  2RSD A;  1JM7 A;  3N9O A;  5FB1 A;  2HYE D;  5KH3 A;  4C9Z A;  1WEM A;  5TDR A;  4I7C A;  3ZPV 1;  2C2V S;  4AP4 A;  2I50 A;  3U5M A;  2YSM A;  3O36 A;  2K4D A;  1U6G B;  2H0D A;  4QF3 A;  2JMJ A;  4YAX A;  2KWO A;  3KV6 A;  2ECV A;  4YBT A;  3I2D A;  4PPE A;  1WE9 A;  2CSZ A;  2K16 A;  2VPG A;  2MUM A;  3L1X A;  1T1H A;  4ZUX U;  1N87 A;  4A4B A;  3ZYQ A;  1FP0 A;  2VPD A;  4AYC A;  4LK9 A;  4V3L C;  4YC9 A;  3ZPV E;  2F6J A;  2VPE A;  2BAY A;  3O70 A;  1HYJ A;  1WEW A;  2UZG A;  2XEU A;  4LJN A;  3L11 A;  4IC3 A;  4FK5 A;  1BOR A;  2NAA A;  5H1T A;  4WZ0 A;  3ZVZ B;  4QF2 A;  1XWH A;  2YHO A;  4LKA A;  2F42 A;  5D1L B;  4YAB A; 
#chains in the Genus database with same CATH topology
 4AVX A;  4L58 A;  2L43 A;  2LAU A;  3GL6 A;  1WGM A;  5TBN A;  2LGL A;  3KQI A;  2KGI A;  3EB6 A;  2ECN A;  2MD8 C;  4P5O B;  2HDP A;  4ZDT A;  3ZVY A;  2ECW A;  5B75 A;  3SUB A;  2VJE B;  1WIM A;  2KE1 A;  3SOW A;  3GV4 A;  5G04 B;  4WA6 A;  2OXQ C;  4LAD B;  4R2Y A;  4UP0 A;  3C6W A;  2MD7 B;  2QJ0 A;  5J3X A;  1VFY A;  2LGK A;  4L7X A;  2FD4 A;  2MIQ A;  2PUY A;  3RPG C;  3MHH A;  4A0C D;  2KYU A;  2M13 A;  4YBM A;  4GNE A;  1IYM A;  2DSM A;  2YVR A;  5LKZ A;  5D1M B;  2RI7 A;  3N9P A;  2F6N A;  4WZ3 B;  2EGP A;  2XP0 A;  2VJE A;  4BBQ A;  1X4J A;  2Y1N A;  2EXU A;  2L0B A;  2YT5 A;  3N9N A;  3U5O A;  3LVQ E;  3T7L A;  2CT2 A;  2M6M A;  2YW8 A;  5FB0 A;  2XB1 A;  2YUR A;  4TKP B;  5I3L A;  5LKU A;  2VP7 A;  2VPB A;  3ZNI A;  2M1R A;  4B86 C;  5C11 A;  2KU3 A;  3IHP A;  4F1P A;  2YQM A;  1MBM A;  3MDB C;  2L80 A;  4AUQ B;  2KIZ A;  2Y1M A;  3MHS A;  1ZBD B;  3PLW A;  1E4U A;  1FBV A;  1DVP A;  4GB0 A;  5LKX A;  4B7Y C;  4A4C A;  3LQI A;  1WEE A;  2D8S A;  3KV5 A;  1WEP A;  3O34 A;  1Z6U A;  4FO9 A;  4O64 A;  1K2F A;  2LXP C;  5C13 A;  3FM8 C;  4N4F A;  2CRW A;  3M7K A;  2LGV A;  4NN2 A;  4BHW A;  1DCQ A;  3LRQ A;  2XOC A;  2AN6 A;  3HCU A;  5FER A;  4UI9 B;  2EOD A;  3PHD A;  2LN0 A;  2JRJ A;  3T6R A;  2CSV A;  2K1J A;  4S3O C;  1V87 A;  4ZQL A;  2KWK A;  5H1U A;  2DX8 A;  2KR4 A;  4GNG A;  2G45 A;  2MA5 A;  3H7H A;  2VJF B;  2B0O E;  2ECJ A;  4LLB A;  2FSA A;  2KWJ A;  4IC2 A;  3ZTG A;  3M62 A;  2G43 A;  2XOY A;  1WEO A;  2LV9 A;  5H1V A;  5B79 A;  5B78 A;  4F52 B;  3U5P A;  3HTK C;  2KFT A;  4R7E A;  2DJA A;  4N3W A;  5G05 B;  1LDK C;  2YQL A;  2YRE A;  2MNY A;  3LVR E;  3O33 A;  2L7P A;  4GNF A;  3KNV A;  3PUQ A;  5D1K B;  2L5U A;  5LCW B;  5B8D A;  3RPG B;  4UP5 A;  1RMD A;  3O7A A;  3FEH A;  2JM3 A;  3O35 A;  4WZ2 A;  2QIZ A;  4GND A;  2MT5 A;  2VJF A;  5AIT A;  2G6Q A;  1VD4 A;  5KH9 A;  3M63 A;  4V3K C;  3V43 A;  2CKL B;  1WFK A;  4YAD A;  2LGG A;  3O37 A;  3EB5 A;  4MSX A;  4AYC B;  5TRB A;  3VK6 A;  2FFW A;  1WEU A;  5DKA A;  5JG6 A;  5KH7 A;  3SHB A;  1MM2 A;  2YUC A;  4A49 A;  1CHC A;  2LDR A;  3QZV A;  1WES A;  4FJC A;  2MA6 A;  2E6S A;  1F62 A;  1Z2Q A;  2D8U A;  4YAT A;  3HCS A;  2IQJ A;  3Q1D A;  2Y43 A;  5DIN A;  2ECI A;  1HYI A;  2KKY A;  2YSJ A;  2CRR A;  1X4I A;  2CKL A;  2QIC A;  4XI1 A;  1VYX A;  5K3Q A;  2ECG A;  4I7D A;  1LDJ B;  3PUR A;  4Q6F A;  5EYA F;  2MNZ A;  2PNX A;  5SVI B;  3DWD A;  4YBS A;  4Z0O A;  5B76 A;  2CON A;  3LQH A;  2JMI A;  2KGG A;  1Z60 A;  2L75 A;  3HCT A;  4S3O B;  2KRE A;  2M85 A;  1WEN A;  2KWN A;  3DPL R;  5AIU A;  2ECT A;  2C2L A;  2VNF A;  5G0F A;  2LXH C;  2K17 A;  3M99 A;  1MM3 A;  4Z0R A;  2LRI C;  5SVY A;  3FAN A;  2P57 A;  4FIP A;  2LQ6 A;  2IDA A;  1JM7 B;  4PTB A;  4QQ4 A;  1X4U A;  4I7B A;  4CCG X;  3N9Q A;  3C5K A;  5LKT A;  3U5N A;  1WEV A;  3FJU B;  4MVT A;  2KKX A;  2FUU A;  3SOX A;  2M3H A;  2YHN A;  3ASL A;  3NG2 A;  2H0D B;  3O47 A;  4CA1 A;  5SVI A;  2E6R A;  3N9L A;  3N9M A;  2MKE A;  3LDY A;  1WEQ A;  3T9K A;  3DQV R;  5B77 A;  4R8P K;  3RTR B;  4H9D A;  5TDW A;  3SOU A;  2JMD A;  5TAB A;  4X3G A;  4OGE A;  3FL2 A;  1G25 A;  2ZET C;  1JOC A;  3L1Z B;  5H9M A;  3LQJ A;  2YYR A;  2FUI A;  4W4U A;  2EA6 A;  5FEY A;  2YU4 A;  2CSY A;  1WIL A;  2RSD A;  1JM7 A;  3N9O A;  3JUE A;  5FB1 A;  2HYE D;  2RR4 A;  5KH3 A;  4C9Z A;  1WEM A;  5TDR A;  4I7C A;  3ZPV 1;  2C2V S;  2XOZ A;  4AP4 A;  2I50 A;  3U5M A;  2YSM A;  3LJU X;  2K4D A;  3O36 A;  1U6G B;  2H0D A;  4QF3 A;  2JMJ A;  4YAX A;  5SVX A;  2KWO A;  2OWA A;  3KV6 A;  2JUN A;  2EGM A;  4O62 A;  2ECV A;  4YBT A;  3I2D A;  4PPE A;  1WE9 A;  2CSZ A;  2K16 A;  2VPG A;  2MUM A;  3L1X A;  1T1H A;  4ZUX U;  1N87 A;  3FAO A;  4A4B A;  3ZYQ A;  1FP0 A;  2VPD A;  2E61 A;  4AYC A;  4LK9 A;  4V3L C;  4YC9 A;  3ZPV E;  2F6J A;  3E2D A;  2VPE A;  2BAY A;  3O70 A;  1HYJ A;  3KDE C;  1WEW A;  2UZG A;  2XEU A;  4LJN A;  3L11 A;  4IC3 A;  4FK5 A;  4OGC A;  1BOR A;  2NAA A;  5H1T A;  3DDT A;  4WZ0 A;  3ZVZ B;  4QF2 A;  1XWH A;  2YHO A;  4LKA A;  2F42 A;  5D1L B;  4YAB A; 
#chains in the Genus database with same CATH homology
 4AVX A;  4L58 A;  2L43 A;  3GL6 A;  1WGM A;  5TBN A;  2LGL A;  3KQI A;  2KGI A;  3EB6 A;  2ECN A;  2MD8 C;  4P5O B;  2HDP A;  4ZDT A;  3ZVY A;  2ECW A;  5B75 A;  2VJE B;  1WIM A;  2KE1 A;  3SOW A;  3GV4 A;  5G04 B;  4WA6 A;  2OXQ C;  4LAD B;  4R2Y A;  4UP0 A;  3C6W A;  2MD7 B;  2QJ0 A;  5J3X A;  1VFY A;  2LGK A;  4L7X A;  2MIQ A;  2PUY A;  3RPG C;  3MHH A;  4A0C D;  2KYU A;  4YBM A;  4GNE A;  1IYM A;  5LKZ A;  5D1M B;  2RI7 A;  3N9P A;  2F6N A;  4WZ3 B;  2EGP A;  2VJE A;  4BBQ A;  1X4J A;  2Y1N A;  2L0B A;  2YT5 A;  3N9N A;  3U5O A;  3T7L A;  2CT2 A;  2M6M A;  2YW8 A;  5FB0 A;  2XB1 A;  2YUR A;  4TKP B;  5I3L A;  5LKU A;  2VP7 A;  2VPB A;  3ZNI A;  2M1R A;  4B86 C;  5C11 A;  2KU3 A;  3IHP A;  2YQM A;  2L80 A;  4AUQ B;  2KIZ A;  2Y1M A;  3MHS A;  1ZBD B;  1E4U A;  1FBV A;  1DVP A;  4GB0 A;  5LKX A;  4B7Y C;  4A4C A;  3LQI A;  1WEE A;  2D8S A;  3KV5 A;  1WEP A;  3O34 A;  1Z6U A;  4FO9 A;  4O64 A;  1K2F A;  2LXP C;  5C13 A;  4N4F A;  2LGV A;  4NN2 A;  4BHW A;  3LRQ A;  2AN6 A;  3HCU A;  5FER A;  4UI9 B;  2EOD A;  3PHD A;  2LN0 A;  2JRJ A;  3T6R A;  2K1J A;  4S3O C;  1V87 A;  4ZQL A;  2KWK A;  5H1U A;  2DX8 A;  2KR4 A;  4GNG A;  2G45 A;  2MA5 A;  2VJF B;  2ECJ A;  4LLB A;  2FSA A;  2KWJ A;  4IC2 A;  3ZTG A;  3M62 A;  2G43 A;  1WEO A;  2LV9 A;  5H1V A;  5B79 A;  5B78 A;  4F52 B;  3U5P A;  3HTK C;  2KFT A;  4R7E A;  4N3W A;  5G05 B;  1LDK C;  2YQL A;  2YRE A;  2MNY A;  3O33 A;  4GNF A;  3KNV A;  3PUQ A;  5D1K B;  2L5U A;  5LCW B;  5B8D A;  3RPG B;  4UP5 A;  1RMD A;  3O7A A;  3O35 A;  4WZ2 A;  2QIZ A;  4GND A;  2MT5 A;  2VJF A;  5AIT A;  2G6Q A;  1VD4 A;  5KH9 A;  3M63 A;  4V3K C;  3V43 A;  2CKL B;  1WFK A;  4YAD A;  2LGG A;  3O37 A;  3EB5 A;  4MSX A;  4AYC B;  5TRB A;  3VK6 A;  1WEU A;  5DKA A;  5JG6 A;  5KH7 A;  3SHB A;  1MM2 A;  2YUC A;  4A49 A;  1CHC A;  2LDR A;  3QZV A;  1WES A;  4FJC A;  2MA6 A;  2E6S A;  1F62 A;  1Z2Q A;  4YAT A;  3HCS A;  2Y43 A;  5DIN A;  2ECI A;  1HYI A;  2YSJ A;  1X4I A;  2CKL A;  2QIC A;  4XI1 A;  1VYX A;  2ECG A;  4I7D A;  1LDJ B;  3PUR A;  4Q6F A;  5EYA F;  2MNZ A;  2PNX A;  4YBS A;  5B76 A;  3LQH A;  2JMI A;  2KGG A;  1Z60 A;  2L75 A;  3HCT A;  4S3O B;  2KRE A;  2M85 A;  1WEN A;  2KWN A;  3DPL R;  5AIU A;  2ECT A;  2C2L A;  2VNF A;  5G0F A;  2LXH C;  2K17 A;  3M99 A;  1MM3 A;  2LRI C;  4FIP A;  2LQ6 A;  2IDA A;  1JM7 B;  4PTB A;  1X4U A;  4I7B A;  4CCG X;  3N9Q A;  3C5K A;  5LKT A;  3U5N A;  1WEV A;  4MVT A;  2FUU A;  3SOX A;  2M3H A;  2YHN A;  3ASL A;  3NG2 A;  2H0D B;  4CA1 A;  2E6R A;  3N9L A;  3N9M A;  1WEQ A;  3DQV R;  5B77 A;  4R8P K;  3RTR B;  3SOU A;  5TDW A;  2JMD A;  5TAB A;  4X3G A;  3FL2 A;  1G25 A;  2ZET C;  1JOC A;  3L1Z B;  5H9M A;  3LQJ A;  2YYR A;  2FUI A;  4W4U A;  2EA6 A;  5FEY A;  2YU4 A;  2CSY A;  1WIL A;  2RSD A;  1JM7 A;  3N9O A;  5FB1 A;  2HYE D;  5KH3 A;  4C9Z A;  1WEM A;  5TDR A;  4I7C A;  3ZPV 1;  2C2V S;  4AP4 A;  2I50 A;  3U5M A;  2YSM A;  3O36 A;  2K4D A;  1U6G B;  2H0D A;  4QF3 A;  2JMJ A;  4YAX A;  2KWO A;  3KV6 A;  2ECV A;  4YBT A;  3I2D A;  4PPE A;  1WE9 A;  2CSZ A;  2K16 A;  2VPG A;  2MUM A;  3L1X A;  1T1H A;  4ZUX U;  1N87 A;  4A4B A;  3ZYQ A;  1FP0 A;  2VPD A;  4AYC A;  4LK9 A;  4V3L C;  4YC9 A;  3ZPV E;  2F6J A;  2VPE A;  2BAY A;  3O70 A;  1HYJ A;  1WEW A;  2UZG A;  2XEU A;  4LJN A;  3L11 A;  4IC3 A;  4FK5 A;  1BOR A;  2NAA A;  5H1T A;  4WZ0 A;  3ZVZ B;  4QF2 A;  1XWH A;  2YHO A;  4LKA A;  2F42 A;  5D1L B;  4YAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...