2MNYA

Nmr structure of kdm5b phd1 finger
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
b'AVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 5B
publication title The PHD1 finger of KDM5B recognizes unmodified H3K4 during the demethylation of histone H3K4me2/3 by KDM5B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 5
structure length 55
sequence length 55
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mnyA00
5B76A 3L11A 3O37A 4GNFA 3SOWA 1WEWA 4FO9A 3T6RA 2KREA 4A4BA 2UZGA 5D1KB 3N9PA 2ECTA 1LDKC 2YQLA 3V43A 4YBTA 3L1XA 4MSXA 2RI7A 3O34A 3C6WA 2YYRA 3M62A 2MNYA 2C2VS 2YHOA 2VPGA 2M3HA 4WA6A 2M1RA 3RPGC 1XWHA 1WE9A 3EB5A 2KWJA 3PUQA 3U5OA 4QF2A 5J3XA 4I7BA 3O36A 4YBSA 2YQMA 4X3GA 1Z60A 3ZVYA 2XEUA 5LKXA 5H1TA 4WZ2A 3SHBA 2H0DA 3O33A 5TBNA 2VJEB 5G04B 2LGKA 5H1VA 5FB1A 4B86C 2FUUA 5KH7A 2MA5A 2QJ0A 4GNGA 4UP5A 2JRJA 5H9MA 4YATA 2VNFA 5AIUA 1F62A 1WILA 1WEMA 3DPLR 1LDJB 5TRBA 1WGMA 4IC3A 2VPEA 3GV4A 5FEYA 4BHWA 5C11A 4ZDTA 1VYXA 3SOXA 2KGGA 2K4DA 2LGGA 2K16A 2C2LA 4V3KC 5JG6A 2KYUA 2L80A 4I7DA 3HTKC 2ECNA 5EYAF 1WEVA 1X4IA 2KWKA 2VJFB 4B7YC 1JM7A 2CKLB 1U6GB 4F52B 4YBMA 4P5OB 5FERA 1WESA 2YSMA 3RPGB 3ZYQA 4NN2A 4MVTA 3EB6A 4LLBA 1WIMA 4N3WA 1WEQA 5C13A 3MHSA 5LKUA 2ECJA 4C9ZA 4R2YA 3GL6A 4QF3A 5G0FA 3U5MA 5TDRA 3ZNIA 1VFYA 3ZPVE 2KWOA 1Z6UA 2CSZA 3O70A 2LXHC 4R7EA 4Q6FA 3O35A 2QIZA 2L5UA 1WEOA 2LN0A 4A4CA 1T1HA 3T7LA 4FK5A 2FSAA 5DKAA 3N9LA 4BBQA 2ZETC 1RMDA 2YT5A 3L1ZB 4UI9B 1CHCA 3HCTA 2D8SA 2EA6A 2PUYA 2G45A 1WFKA 4LK9A 4CA1A 1K2FA 2EGPA 2H0DB 2KE1A 2YURA 5LCWB 1G25A 5B8DA 2VP7A 5FB0A 2MA6A 1X4JA 3C5KA 4R8PK 2F6JA 2OXQC 1WEPA 2EODA 3N9OA 2E6RA 3ZVZB 3LQIA 4AUQB 2KU3A 2Y1MA 3N9MA 2JMJA 1BORA 2PNXA 4WZ0A 4GNDA 3N9NA 2NAAA 1MM2A 1DVPA 4V3LC 4YABA 3HCUA 5KH9A 2MD7B 3PHDA 3FL2A 1JOCA 1IYMA 2VPDA 3M63A 2VPBA 4YAXA 4W4UA 3KV6A 4AVXA 1WEEA 1JM7B 4PTBA 3HCSA 4LJNA 2I50A 1FBVA 3LRQA 1VD4A 3MHHA 4AYCA 3SOUA 5B79A 4L7XA 4WZ3B 2L0BA 2LDRA 1WEUA 2KGIA 3U5NA 2ECVA 5H1UA 3KNVA 5B78A 4TKPB 2MT5A 2LQ6A 1FP0A 2CSYA 4LADB 3NG2A 2FUIA 2HYED 4FIPA 2IDAA 4O64A 2MD8C 3DQVR 4N4FA 1WENA 2L43A 5KH3A 1X4UA 4CCGX 2QICA 5D1MB 2Y43A 3N9QA 4S3OC 1Z2QA 4YC9A 3ZPV1 1N87A 4AP4A 1MM3A 1E4UA 2KFTA 2L75A 4PPEA 5G05B 4A0CD 3KV5A 2DX8A 3IHPA 1HYIA 2YUCA 3VK6A 2VJEA 2G6QA 2AN6A 2ECGA 2E6SA 2M6MA 3RTRB 4FJCA 2MUMA 4ZUXU 4L58A 4ZQLA 2JMIA 5TDWA 4A49A 3LQJA 2Y1NA 2F42A 4GB0A 5B77A 3KQIA 2ECIA 2JMDA 2LXPC 2LV9A 5I3LA 5TABA 3O7AA 4XI1A 4YADA 3ASLA 1HYJA 5LKTA 2YHNA 2ECWA 2CT2A 2G43A 2RSDA 3U5PA 4I7CA 2YW8A 1V87A 2LRIC 2M85A 3I2DA 2LGVA 3M99A 4IC2A 1ZBDB 2XB1A 4GNEA 2F6NA 2YU4A 3QZVA 5AITA 5D1LB 2KIZA 2YREA 2MIQA 4LKAA 2K17A 5LKZA 2VJFA 2YSJA 2CKLA 3PURA 2HDPA 3LQHA 2KWNA 2KR4A 5DINA 5B75A 2K1JA 2LGLA 3ZTGA 4AYCB 2MNZA 4UP0A 2BAYA 4S3OB
chains in the Genus database with same CATH superfamily
5B76A 5K3QA 3L11A 3O37A 4GNFA 4OGEA 3E2DA 3SOWA 1WEWA 4FO9A 3T6RA 2KREA 4A4BA 2UZGA 5D1KB 2XOZA 3N9PA 2ECTA 1LDKC 2YQLA 3V43A 4YBTA 3L1XA 4MSXA 2DSMA 2RI7A 3O34A 3C6WA 2YYRA 3M62A 3SUBA 2MNYA 3O47A 2C2VS 2YHOA 2VPGA 2M3HA 4WA6A 4O62A 2M1RA 4Z0RA 3RPGC 1XWHA 2KKYA 1WE9A 3EB5A 2KWJA 3PUQA 3U5OA 4QF2A 5J3XA 4I7BA 3O36A 4YBSA 4F1PA 2YQMA 4X3GA 1Z60A 3ZVYA 2XEUA 5LKXA 5H1TA 4WZ2A 3SHBA 2H0DA 3O33A 5TBNA 2VJEB 5G04B 2KKXA 2LGKA 5H1VA 3LJUX 5FB1A 4B86C 3LDYA 2FUUA 5KH7A 2MA5A 2QJ0A 4GNGA 4UP5A 2JRJA 5H9MA 4YATA 2CRRA 2VNFA 3T9KA 5AIUA 1F62A 3FAOA 2CRWA 1WILA 1WEMA 3DPLR 1LDJB 5TRBA 1WGMA 4IC3A 2VPEA 3GV4A 5FEYA 4BHWA 5C11A 4ZDTA 1VYXA 3SOXA 2KGGA 2K4DA 2LGGA 2K16A 2C2LA 3LVQE 4V3KC 5JG6A 2KYUA 2L80A 4I7DA 3HTKC 2ECNA 5EYAF 1WEVA 1X4IA 2KWKA 2JM3A 2EGMA 2VJFB 4B7YC 2M13A 1JM7A 2CKLB 1U6GB 2FFWA 4F52B 4YBMA 4P5OB 5FERA 1WESA 2YSMA 3RPGB 3ZYQA 4NN2A 4MVTA 3EB6A 3H7HA 1WIMA 4LLBA 4N3WA 1WEQA 5C13A 3MHSA 5LKUA 2ECJA 4C9ZA 4R2YA 3GL6A 4QF3A 5G0FA 3U5MA 5TDRA 3ZNIA 1VFYA 3ZPVE 3MDBC 2KWOA 1Z6UA 2CSZA 3O70A 2YVRA 2LXHC 4R7EA 3FANA 3O35A 4Q6FA 2QIZA 2L5UA 1WEOA 2LN0A 4A4CA 1T1HA 3T7LA 2DJAA 4FK5A 2FSAA 5DKAA 3N9LA 4BBQA 2ZETC 1RMDA 3LVRE 2YT5A 3L1ZB 4UI9B 1CHCA 3HCTA 2D8SA 2EA6A 3FEHA 2PUYA 2G45A 1WFKA 2XOYA 4LK9A 4CA1A 1K2FA 2EGPA 2H0DB 2KE1A 2YURA 5LCWB 1G25A 5B8DA 2VP7A 5FB0A 2MA6A 1X4JA 3C5KA 4R8PK 2F6JA 2OXQC 1WEPA 2EODA 3N9OA 3FM8C 2E6RA 3ZVZB 3LQIA 4AUQB 2P57A 2KU3A 2Y1MA 3N9MA 2JMJA 5SVIA 2JUNA 1BORA 2PNXA 3DDTA 2D8UA 4WZ0A 4GNDA 3N9NA 2NAAA 1MM2A 1DVPA 4V3LC 4YABA 2L7PA 3HCUA 5KH9A 2MD7B 3PHDA 3FL2A 1JOCA 1IYMA 2IQJA 2VPDA 3M63A 2VPBA 2LAUA 4YAXA 4W4UA 3KV6A 4AVXA 1WEEA 1JM7B 2E61A 4PTBA 3HCSA 4LJNA 2B0OE 2I50A 1FBVA 4H9DA 3LRQA 1VD4A 3MHHA 5SVXA 4AYCA 3M7KA 3SOUA 5B79A 4L7XA 4WZ3B 2L0BA 2LDRA 1WEUA 2KGIA 3U5NA 2ECVA 5H1UA 3KNVA 5B78A 4TKPB 2EXUA 2MT5A 2LQ6A 1FP0A 2CSYA 4LADB 3NG2A 2FUIA 2CSVA 2HYED 4FIPA 2IDAA 4O64A 2MD8C 3DWDA 3DQVR 2OWAA 4N4FA 1WENA 2L43A 5KH3A 1X4UA 4CCGX 3KDEC 2QICA 5D1MB 2Y43A 3N9QA 4S3OC 1Z2QA 4YC9A 3ZPV1 1N87A 3JUEA 4AP4A 1MM3A 1E4UA 2KFTA 2L75A 4PPEA 1DCQA 5G05B 4A0CD 3KV5A 2DX8A 3IHPA 1HYIA 2YUCA 3VK6A 2VJEA 2G6QA 2MKEA 2AN6A 2ECGA 2E6SA 2M6MA 3RTRB 4FJCA 2MUMA 4ZUXU 4L58A 4ZQLA 2JMIA 5TDWA 4A49A 3LQJA 2Y1NA 2F42A 4GB0A 5B77A 3KQIA 2ECIA 2JMDA 2LXPC 1MBMA 2LV9A 5I3LA 5TABA 3O7AA 4XI1A 4YADA 3ASLA 4OGCA 3Q1DA 1HYJA 5LKTA 2RR4A 2YHNA 2ECWA 2CT2A 2G43A 2RSDA 5SVIB 2XP0A 3U5PA 4I7CA 3PLWA 2YW8A 1V87A 2CONA 2LRIC 2M85A 3I2DA 2LGVA 4QQ4A 3M99A 4IC2A 2XOCA 1ZBDB 2XB1A 4GNEA 2F6NA 4Z0OA 2YU4A 3QZVA 2FD4A 5AITA 5D1LB 2KIZA 3FJUB 2YREA 2MIQA 4LKAA 5SVYA 2K17A 5LKZA 2VJFA 2YSJA 2CKLA 3PURA 2HDPA 3LQHA 2KWNA 2KR4A 5DINA 5B75A 2K1JA 2LGLA 3ZTGA 4AYCB 2MNZA 4UP0A 2BAYA 4S3OB
chains in the Genus database with same CATH topology
5B76A 3L11A 3O37A 4GNFA 3SOWA 1WEWA 4FO9A 3T6RA 2KREA 4A4BA 2UZGA 5D1KB 3N9PA 2ECTA 1LDKC 2YQLA 3V43A 4YBTA 3L1XA 4MSXA 2RI7A 3O34A 3C6WA 2YYRA 3M62A 2MNYA 2C2VS 2YHOA 2VPGA 2M3HA 4WA6A 2M1RA 3RPGC 1XWHA 1WE9A 3EB5A 2KWJA 3PUQA 3U5OA 4QF2A 5J3XA 4I7BA 3O36A 4YBSA 2YQMA 4X3GA 1Z60A 3ZVYA 2XEUA 5LKXA 5H1TA 4WZ2A 3SHBA 2H0DA 3O33A 5TBNA 2VJEB 5G04B 2LGKA 5H1VA 5FB1A 4B86C 2FUUA 5KH7A 2MA5A 2QJ0A 4GNGA 4UP5A 2JRJA 5H9MA 4YATA 2VNFA 5AIUA 1F62A 1WILA 1WEMA 3DPLR 1LDJB 5TRBA 1WGMA 4IC3A 2VPEA 3GV4A 5FEYA 4BHWA 5C11A 4ZDTA 1VYXA 3SOXA 2KGGA 2K4DA 2LGGA 2K16A 2C2LA 4V3KC 5JG6A 2KYUA 2L80A 4I7DA 3HTKC 2ECNA 5EYAF 1WEVA 1X4IA 2KWKA 2VJFB 4B7YC 1JM7A 2CKLB 1U6GB 4F52B 4YBMA 4P5OB 5FERA 1WESA 2YSMA 3RPGB 3ZYQA 4NN2A 4MVTA 3EB6A 4LLBA 1WIMA 4N3WA 1WEQA 5C13A 3MHSA 5LKUA 2ECJA 4C9ZA 4R2YA 3GL6A 4QF3A 5G0FA 3U5MA 5TDRA 3ZNIA 1VFYA 3ZPVE 2KWOA 1Z6UA 2CSZA 3O70A 2LXHC 4R7EA 4Q6FA 3O35A 2QIZA 2L5UA 1WEOA 2LN0A 4A4CA 1T1HA 3T7LA 4FK5A 2FSAA 5DKAA 3N9LA 4BBQA 2ZETC 1RMDA 2YT5A 3L1ZB 4UI9B 1CHCA 3HCTA 2D8SA 2EA6A 2PUYA 2G45A 1WFKA 4LK9A 4CA1A 1K2FA 2EGPA 2H0DB 2KE1A 2YURA 5LCWB 1G25A 5B8DA 2VP7A 5FB0A 2MA6A 1X4JA 3C5KA 4R8PK 2F6JA 2OXQC 1WEPA 2EODA 3N9OA 2E6RA 3ZVZB 3LQIA 4AUQB 2KU3A 2Y1MA 3N9MA 2JMJA 1BORA 2PNXA 4WZ0A 4GNDA 3N9NA 2NAAA 1MM2A 1DVPA 4V3LC 4YABA 3HCUA 5KH9A 2MD7B 3PHDA 3FL2A 1JOCA 1IYMA 2VPDA 3M63A 2VPBA 4YAXA 4W4UA 3KV6A 4AVXA 1WEEA 1JM7B 4PTBA 3HCSA 4LJNA 2I50A 1FBVA 3LRQA 1VD4A 3MHHA 4AYCA 3SOUA 5B79A 4L7XA 4WZ3B 2L0BA 2LDRA 1WEUA 2KGIA 3U5NA 2ECVA 5H1UA 3KNVA 5B78A 4TKPB 2MT5A 2LQ6A 1FP0A 2CSYA 4LADB 3NG2A 2FUIA 2HYED 4FIPA 2IDAA 4O64A 2MD8C 3DQVR 4N4FA 1WENA 2L43A 5KH3A 1X4UA 4CCGX 2QICA 5D1MB 2Y43A 3N9QA 4S3OC 1Z2QA 4YC9A 3ZPV1 1N87A 4AP4A 1MM3A 1E4UA 2KFTA 2L75A 4PPEA 5G05B 4A0CD 3KV5A 2DX8A 3IHPA 1HYIA 2YUCA 3VK6A 2VJEA 2G6QA 2AN6A 2ECGA 2E6SA 2M6MA 3RTRB 4FJCA 2MUMA 4ZUXU 4L58A 4ZQLA 2JMIA 5TDWA 4A49A 3LQJA 2Y1NA 2F42A 4GB0A 5B77A 3KQIA 2ECIA 2JMDA 2LXPC 2LV9A 5I3LA 5TABA 3O7AA 4XI1A 4YADA 3ASLA 1HYJA 5LKTA 2YHNA 2ECWA 2CT2A 2G43A 2RSDA 3U5PA 4I7CA 2YW8A 1V87A 2LRIC 2M85A 3I2DA 2LGVA 3M99A 4IC2A 1ZBDB 2XB1A 4GNEA 2F6NA 2YU4A 3QZVA 5AITA 5D1LB 2KIZA 2YREA 2MIQA 4LKAA 2K17A 5LKZA 2VJFA 2YSJA 2CKLA 3PURA 2HDPA 3LQHA 2KWNA 2KR4A 5DINA 5B75A 2K1JA 2LGLA 3ZTGA 4AYCB 2MNZA 4UP0A 2BAYA 4S3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B76 A;  3L11 A;  3O37 A;  4GNF A;  3SOW A;  1WEW A;  4FO9 A;  3T6R A;  2KRE A;  4A4B A;  2UZG A;  5D1K B;  3N9P A;  2ECT A;  1LDK C;  2YQL A;  3V43 A;  4YBT A;  3L1X A;  4MSX A;  2RI7 A;  3O34 A;  3C6W A;  2YYR A;  3M62 A;  2MNY A;  2C2V S;  2YHO A;  2VPG A;  2M3H A;  4WA6 A;  2M1R A;  3RPG C;  1XWH A;  1WE9 A;  3EB5 A;  2KWJ A;  3PUQ A;  3U5O A;  4QF2 A;  5J3X A;  4I7B A;  3O36 A;  4YBS A;  2YQM A;  4X3G A;  1Z60 A;  3ZVY A;  2XEU A;  5LKX A;  5H1T A;  4WZ2 A;  3SHB A;  2H0D A;  3O33 A;  5TBN A;  2VJE B;  5G04 B;  2LGK A;  5H1V A;  5FB1 A;  4B86 C;  2FUU A;  5KH7 A;  2MA5 A;  2QJ0 A;  4GNG A;  4UP5 A;  2JRJ A;  5H9M A;  4YAT A;  2VNF A;  5AIU A;  1F62 A;  1WIL A;  1WEM A;  3DPL R;  1LDJ B;  5TRB A;  1WGM A;  4IC3 A;  2VPE A;  3GV4 A;  5FEY A;  4BHW A;  5C11 A;  4ZDT A;  1VYX A;  3SOX A;  2KGG A;  2K4D A;  2LGG A;  2K16 A;  2C2L A;  4V3K C;  5JG6 A;  2KYU A;  2L80 A;  4I7D A;  3HTK C;  2ECN A;  5EYA F;  1WEV A;  1X4I A;  2KWK A;  2VJF B;  4B7Y C;  1JM7 A;  2CKL B;  1U6G B;  4F52 B;  4YBM A;  4P5O B;  5FER A;  1WES A;  2YSM A;  3RPG B;  3ZYQ A;  4NN2 A;  4MVT A;  3EB6 A;  4LLB A;  1WIM A;  4N3W A;  1WEQ A;  5C13 A;  3MHS A;  5LKU A;  2ECJ A;  4C9Z A;  4R2Y A;  3GL6 A;  4QF3 A;  5G0F A;  3U5M A;  5TDR A;  3ZNI A;  1VFY A;  3ZPV E;  2KWO A;  1Z6U A;  2CSZ A;  3O70 A;  2LXH C;  4R7E A;  4Q6F A;  3O35 A;  2QIZ A;  2L5U A;  1WEO A;  2LN0 A;  4A4C A;  1T1H A;  3T7L A;  4FK5 A;  2FSA A;  5DKA A;  3N9L A;  4BBQ A;  2ZET C;  1RMD A;  2YT5 A;  3L1Z B;  4UI9 B;  1CHC A;  3HCT A;  2D8S A;  2EA6 A;  2PUY A;  2G45 A;  1WFK A;  4LK9 A;  4CA1 A;  1K2F A;  2EGP A;  2H0D B;  2KE1 A;  2YUR A;  5LCW B;  1G25 A;  5B8D A;  2VP7 A;  5FB0 A;  2MA6 A;  1X4J A;  3C5K A;  4R8P K;  2F6J A;  2OXQ C;  1WEP A;  2EOD A;  3N9O A;  2E6R A;  3ZVZ B;  3LQI A;  4AUQ B;  2KU3 A;  2Y1M A;  3N9M A;  2JMJ A;  1BOR A;  2PNX A;  4WZ0 A;  4GND A;  3N9N A;  2NAA A;  1MM2 A;  1DVP A;  4V3L C;  4YAB A;  3HCU A;  5KH9 A;  2MD7 B;  3PHD A;  3FL2 A;  1JOC A;  1IYM A;  2VPD A;  3M63 A;  2VPB A;  4YAX A;  4W4U A;  3KV6 A;  4AVX A;  1WEE A;  1JM7 B;  4PTB A;  3HCS A;  4LJN A;  2I50 A;  1FBV A;  3LRQ A;  1VD4 A;  3MHH A;  4AYC A;  3SOU A;  5B79 A;  4L7X A;  4WZ3 B;  2L0B A;  2LDR A;  1WEU A;  2KGI A;  3U5N A;  2ECV A;  5H1U A;  3KNV A;  5B78 A;  4TKP B;  2MT5 A;  2LQ6 A;  1FP0 A;  2CSY A;  4LAD B;  3NG2 A;  2FUI A;  2HYE D;  4FIP A;  2IDA A;  4O64 A;  2MD8 C;  3DQV R;  4N4F A;  1WEN A;  2L43 A;  5KH3 A;  1X4U A;  4CCG X;  2QIC A;  5D1M B;  2Y43 A;  3N9Q A;  4S3O C;  1Z2Q A;  4YC9 A;  3ZPV 1;  1N87 A;  4AP4 A;  1MM3 A;  1E4U A;  2KFT A;  2L75 A;  4PPE A;  5G05 B;  4A0C D;  3KV5 A;  2DX8 A;  3IHP A;  1HYI A;  2YUC A;  3VK6 A;  2VJE A;  2G6Q A;  2AN6 A;  2ECG A;  2E6S A;  2M6M A;  3RTR B;  4FJC A;  2MUM A;  4ZUX U;  4L58 A;  4ZQL A;  2JMI A;  5TDW A;  4A49 A;  3LQJ A;  2Y1N A;  2F42 A;  4GB0 A;  5B77 A;  3KQI A;  2ECI A;  2JMD A;  2LXP C;  2LV9 A;  5I3L A;  5TAB A;  3O7A A;  4XI1 A;  4YAD A;  3ASL A;  1HYJ A;  5LKT A;  2YHN A;  2ECW A;  2CT2 A;  2G43 A;  2RSD A;  3U5P A;  4I7C A;  2YW8 A;  1V87 A;  2LRI C;  2M85 A;  3I2D A;  2LGV A;  3M99 A;  4IC2 A;  1ZBD B;  2XB1 A;  4GNE A;  2F6N A;  2YU4 A;  3QZV A;  5AIT A;  5D1L B;  2KIZ A;  2YRE A;  2MIQ A;  4LKA A;  2K17 A;  5LKZ A;  2VJF A;  2YSJ A;  2CKL A;  3PUR A;  2HDP A;  3LQH A;  2KWN A;  2KR4 A;  5DIN A;  5B75 A;  2K1J A;  2LGL A;  3ZTG A;  4AYC B;  2MNZ A;  4UP0 A;  2BAY A;  4S3O B; 
#chains in the Genus database with same CATH topology
 5B76 A;  5K3Q A;  3L11 A;  3O37 A;  4GNF A;  4OGE A;  3E2D A;  3SOW A;  1WEW A;  4FO9 A;  3T6R A;  2KRE A;  4A4B A;  2UZG A;  5D1K B;  2XOZ A;  3N9P A;  2ECT A;  1LDK C;  2YQL A;  3V43 A;  4YBT A;  3L1X A;  4MSX A;  2DSM A;  2RI7 A;  3O34 A;  3C6W A;  2YYR A;  3M62 A;  3SUB A;  2MNY A;  3O47 A;  2C2V S;  2YHO A;  2VPG A;  2M3H A;  4WA6 A;  4O62 A;  2M1R A;  4Z0R A;  3RPG C;  1XWH A;  2KKY A;  1WE9 A;  3EB5 A;  2KWJ A;  3PUQ A;  3U5O A;  4QF2 A;  5J3X A;  4I7B A;  3O36 A;  4YBS A;  4F1P A;  2YQM A;  4X3G A;  1Z60 A;  3ZVY A;  2XEU A;  5LKX A;  5H1T A;  4WZ2 A;  3SHB A;  2H0D A;  3O33 A;  5TBN A;  2VJE B;  5G04 B;  2KKX A;  2LGK A;  5H1V A;  3LJU X;  5FB1 A;  4B86 C;  3LDY A;  2FUU A;  5KH7 A;  2MA5 A;  2QJ0 A;  4GNG A;  4UP5 A;  2JRJ A;  5H9M A;  4YAT A;  2CRR A;  2VNF A;  3T9K A;  5AIU A;  1F62 A;  3FAO A;  2CRW A;  1WIL A;  1WEM A;  3DPL R;  1LDJ B;  5TRB A;  1WGM A;  4IC3 A;  2VPE A;  3GV4 A;  5FEY A;  4BHW A;  5C11 A;  4ZDT A;  1VYX A;  3SOX A;  2KGG A;  2K4D A;  2LGG A;  2K16 A;  2C2L A;  3LVQ E;  4V3K C;  5JG6 A;  2KYU A;  2L80 A;  4I7D A;  3HTK C;  2ECN A;  5EYA F;  1WEV A;  1X4I A;  2KWK A;  2JM3 A;  2EGM A;  2VJF B;  4B7Y C;  2M13 A;  1JM7 A;  2CKL B;  1U6G B;  2FFW A;  4F52 B;  4YBM A;  4P5O B;  5FER A;  1WES A;  2YSM A;  3RPG B;  3ZYQ A;  4NN2 A;  4MVT A;  3EB6 A;  3H7H A;  1WIM A;  4LLB A;  4N3W A;  1WEQ A;  5C13 A;  3MHS A;  5LKU A;  2ECJ A;  4C9Z A;  4R2Y A;  3GL6 A;  4QF3 A;  5G0F A;  3U5M A;  5TDR A;  3ZNI A;  1VFY A;  3ZPV E;  3MDB C;  2KWO A;  1Z6U A;  2CSZ A;  3O70 A;  2YVR A;  2LXH C;  4R7E A;  3FAN A;  3O35 A;  4Q6F A;  2QIZ A;  2L5U A;  1WEO A;  2LN0 A;  4A4C A;  1T1H A;  3T7L A;  2DJA A;  4FK5 A;  2FSA A;  5DKA A;  3N9L A;  4BBQ A;  2ZET C;  1RMD A;  3LVR E;  2YT5 A;  3L1Z B;  4UI9 B;  1CHC A;  3HCT A;  2D8S A;  2EA6 A;  3FEH A;  2PUY A;  2G45 A;  1WFK A;  2XOY A;  4LK9 A;  4CA1 A;  1K2F A;  2EGP A;  2H0D B;  2KE1 A;  2YUR A;  5LCW B;  1G25 A;  5B8D A;  2VP7 A;  5FB0 A;  2MA6 A;  1X4J A;  3C5K A;  4R8P K;  2F6J A;  2OXQ C;  1WEP A;  2EOD A;  3N9O A;  3FM8 C;  2E6R A;  3ZVZ B;  3LQI A;  4AUQ B;  2P57 A;  2KU3 A;  2Y1M A;  3N9M A;  2JMJ A;  5SVI A;  2JUN A;  1BOR A;  2PNX A;  3DDT A;  2D8U A;  4WZ0 A;  4GND A;  3N9N A;  2NAA A;  1MM2 A;  1DVP A;  4V3L C;  4YAB A;  2L7P A;  3HCU A;  5KH9 A;  2MD7 B;  3PHD A;  3FL2 A;  1JOC A;  1IYM A;  2IQJ A;  2VPD A;  3M63 A;  2VPB A;  2LAU A;  4YAX A;  4W4U A;  3KV6 A;  4AVX A;  1WEE A;  1JM7 B;  2E61 A;  4PTB A;  3HCS A;  4LJN A;  2B0O E;  2I50 A;  1FBV A;  4H9D A;  3LRQ A;  1VD4 A;  3MHH A;  5SVX A;  4AYC A;  3M7K A;  3SOU A;  5B79 A;  4L7X A;  4WZ3 B;  2L0B A;  2LDR A;  1WEU A;  2KGI A;  3U5N A;  2ECV A;  5H1U A;  3KNV A;  5B78 A;  4TKP B;  2EXU A;  2MT5 A;  2LQ6 A;  1FP0 A;  2CSY A;  4LAD B;  3NG2 A;  2FUI A;  2CSV A;  2HYE D;  4FIP A;  2IDA A;  4O64 A;  2MD8 C;  3DWD A;  3DQV R;  2OWA A;  4N4F A;  1WEN A;  2L43 A;  5KH3 A;  1X4U A;  4CCG X;  3KDE C;  2QIC A;  5D1M B;  2Y43 A;  3N9Q A;  4S3O C;  1Z2Q A;  4YC9 A;  3ZPV 1;  1N87 A;  3JUE A;  4AP4 A;  1MM3 A;  1E4U A;  2KFT A;  2L75 A;  4PPE A;  1DCQ A;  5G05 B;  4A0C D;  3KV5 A;  2DX8 A;  3IHP A;  1HYI A;  2YUC A;  3VK6 A;  2VJE A;  2G6Q A;  2MKE A;  2AN6 A;  2ECG A;  2E6S A;  2M6M A;  3RTR B;  4FJC A;  2MUM A;  4ZUX U;  4L58 A;  4ZQL A;  2JMI A;  5TDW A;  4A49 A;  3LQJ A;  2Y1N A;  2F42 A;  4GB0 A;  5B77 A;  3KQI A;  2ECI A;  2JMD A;  2LXP C;  1MBM A;  2LV9 A;  5I3L A;  5TAB A;  3O7A A;  4XI1 A;  4YAD A;  3ASL A;  4OGC A;  3Q1D A;  1HYJ A;  5LKT A;  2RR4 A;  2YHN A;  2ECW A;  2CT2 A;  2G43 A;  2RSD A;  5SVI B;  2XP0 A;  3U5P A;  4I7C A;  3PLW A;  2YW8 A;  1V87 A;  2CON A;  2LRI C;  2M85 A;  3I2D A;  2LGV A;  4QQ4 A;  3M99 A;  4IC2 A;  2XOC A;  1ZBD B;  2XB1 A;  4GNE A;  2F6N A;  4Z0O A;  2YU4 A;  3QZV A;  2FD4 A;  5AIT A;  5D1L B;  2KIZ A;  3FJU B;  2YRE A;  2MIQ A;  4LKA A;  5SVY A;  2K17 A;  5LKZ A;  2VJF A;  2YSJ A;  2CKL A;  3PUR A;  2HDP A;  3LQH A;  2KWN A;  2KR4 A;  5DIN A;  5B75 A;  2K1J A;  2LGL A;  3ZTG A;  4AYC B;  2MNZ A;  4UP0 A;  2BAY A;  4S3O B; 
#chains in the Genus database with same CATH homology
 5B76 A;  3L11 A;  3O37 A;  4GNF A;  3SOW A;  1WEW A;  4FO9 A;  3T6R A;  2KRE A;  4A4B A;  2UZG A;  5D1K B;  3N9P A;  2ECT A;  1LDK C;  2YQL A;  3V43 A;  4YBT A;  3L1X A;  4MSX A;  2RI7 A;  3O34 A;  3C6W A;  2YYR A;  3M62 A;  2MNY A;  2C2V S;  2YHO A;  2VPG A;  2M3H A;  4WA6 A;  2M1R A;  3RPG C;  1XWH A;  1WE9 A;  3EB5 A;  2KWJ A;  3PUQ A;  3U5O A;  4QF2 A;  5J3X A;  4I7B A;  3O36 A;  4YBS A;  2YQM A;  4X3G A;  1Z60 A;  3ZVY A;  2XEU A;  5LKX A;  5H1T A;  4WZ2 A;  3SHB A;  2H0D A;  3O33 A;  5TBN A;  2VJE B;  5G04 B;  2LGK A;  5H1V A;  5FB1 A;  4B86 C;  2FUU A;  5KH7 A;  2MA5 A;  2QJ0 A;  4GNG A;  4UP5 A;  2JRJ A;  5H9M A;  4YAT A;  2VNF A;  5AIU A;  1F62 A;  1WIL A;  1WEM A;  3DPL R;  1LDJ B;  5TRB A;  1WGM A;  4IC3 A;  2VPE A;  3GV4 A;  5FEY A;  4BHW A;  5C11 A;  4ZDT A;  1VYX A;  3SOX A;  2KGG A;  2K4D A;  2LGG A;  2K16 A;  2C2L A;  4V3K C;  5JG6 A;  2KYU A;  2L80 A;  4I7D A;  3HTK C;  2ECN A;  5EYA F;  1WEV A;  1X4I A;  2KWK A;  2VJF B;  4B7Y C;  1JM7 A;  2CKL B;  1U6G B;  4F52 B;  4YBM A;  4P5O B;  5FER A;  1WES A;  2YSM A;  3RPG B;  3ZYQ A;  4NN2 A;  4MVT A;  3EB6 A;  4LLB A;  1WIM A;  4N3W A;  1WEQ A;  5C13 A;  3MHS A;  5LKU A;  2ECJ A;  4C9Z A;  4R2Y A;  3GL6 A;  4QF3 A;  5G0F A;  3U5M A;  5TDR A;  3ZNI A;  1VFY A;  3ZPV E;  2KWO A;  1Z6U A;  2CSZ A;  3O70 A;  2LXH C;  4R7E A;  4Q6F A;  3O35 A;  2QIZ A;  2L5U A;  1WEO A;  2LN0 A;  4A4C A;  1T1H A;  3T7L A;  4FK5 A;  2FSA A;  5DKA A;  3N9L A;  4BBQ A;  2ZET C;  1RMD A;  2YT5 A;  3L1Z B;  4UI9 B;  1CHC A;  3HCT A;  2D8S A;  2EA6 A;  2PUY A;  2G45 A;  1WFK A;  4LK9 A;  4CA1 A;  1K2F A;  2EGP A;  2H0D B;  2KE1 A;  2YUR A;  5LCW B;  1G25 A;  5B8D A;  2VP7 A;  5FB0 A;  2MA6 A;  1X4J A;  3C5K A;  4R8P K;  2F6J A;  2OXQ C;  1WEP A;  2EOD A;  3N9O A;  2E6R A;  3ZVZ B;  3LQI A;  4AUQ B;  2KU3 A;  2Y1M A;  3N9M A;  2JMJ A;  1BOR A;  2PNX A;  4WZ0 A;  4GND A;  3N9N A;  2NAA A;  1MM2 A;  1DVP A;  4V3L C;  4YAB A;  3HCU A;  5KH9 A;  2MD7 B;  3PHD A;  3FL2 A;  1JOC A;  1IYM A;  2VPD A;  3M63 A;  2VPB A;  4YAX A;  4W4U A;  3KV6 A;  4AVX A;  1WEE A;  1JM7 B;  4PTB A;  3HCS A;  4LJN A;  2I50 A;  1FBV A;  3LRQ A;  1VD4 A;  3MHH A;  4AYC A;  3SOU A;  5B79 A;  4L7X A;  4WZ3 B;  2L0B A;  2LDR A;  1WEU A;  2KGI A;  3U5N A;  2ECV A;  5H1U A;  3KNV A;  5B78 A;  4TKP B;  2MT5 A;  2LQ6 A;  1FP0 A;  2CSY A;  4LAD B;  3NG2 A;  2FUI A;  2HYE D;  4FIP A;  2IDA A;  4O64 A;  2MD8 C;  3DQV R;  4N4F A;  1WEN A;  2L43 A;  5KH3 A;  1X4U A;  4CCG X;  2QIC A;  5D1M B;  2Y43 A;  3N9Q A;  4S3O C;  1Z2Q A;  4YC9 A;  3ZPV 1;  1N87 A;  4AP4 A;  1MM3 A;  1E4U A;  2KFT A;  2L75 A;  4PPE A;  5G05 B;  4A0C D;  3KV5 A;  2DX8 A;  3IHP A;  1HYI A;  2YUC A;  3VK6 A;  2VJE A;  2G6Q A;  2AN6 A;  2ECG A;  2E6S A;  2M6M A;  3RTR B;  4FJC A;  2MUM A;  4ZUX U;  4L58 A;  4ZQL A;  2JMI A;  5TDW A;  4A49 A;  3LQJ A;  2Y1N A;  2F42 A;  4GB0 A;  5B77 A;  3KQI A;  2ECI A;  2JMD A;  2LXP C;  2LV9 A;  5I3L A;  5TAB A;  3O7A A;  4XI1 A;  4YAD A;  3ASL A;  1HYJ A;  5LKT A;  2YHN A;  2ECW A;  2CT2 A;  2G43 A;  2RSD A;  3U5P A;  4I7C A;  2YW8 A;  1V87 A;  2LRI C;  2M85 A;  3I2D A;  2LGV A;  3M99 A;  4IC2 A;  1ZBD B;  2XB1 A;  4GNE A;  2F6N A;  2YU4 A;  3QZV A;  5AIT A;  5D1L B;  2KIZ A;  2YRE A;  2MIQ A;  4LKA A;  2K17 A;  5LKZ A;  2VJF A;  2YSJ A;  2CKL A;  3PUR A;  2HDP A;  3LQH A;  2KWN A;  2KR4 A;  5DIN A;  5B75 A;  2K1J A;  2LGL A;  3ZTG A;  4AYC B;  2MNZ A;  4UP0 A;  2BAY A;  4S3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...