2MNYA

Nmr structure of kdm5b phd1 finger
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
AVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 5B
publication title The PHD1 finger of KDM5B recognizes unmodified H3K4 during the demethylation of histone H3K4me2/3 by KDM5B
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 55
sequence length 55
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mnyA00
2KWKA 2JMDA 2VJEB 5H1UA 1WEPA 2VPGA 2NAAA 1U6GB 2K1JA 4QF3A 2HDPA 2LN0A 2LV9A 2XEUA 2LGLA 4YBMA 2ECVA 5AIUA 4A4CA 3EB6A 4A0CD 2MA6A 2FSAA 4S3OB 3SHBA 2CKLB 3ZYQA 2JMJA 3FL2A 5C13A 5D1LB 5LKZA 3GV4A 4AVXA 5EYAF 3IHPA 4AYCB 2KWNA 4A49A 4B86C 1VD4A 1WIMA 4FJCA 1HYJA 2I50A 5LKTA 2KIZA 4N3WA 3MHSA 4YAXA 3SOWA 1WEMA 1K2FA 3ZNIA 3LRQA 2IDAA 1WE9A 4YBTA 4WZ2A 3ASLA 5KH3A 3QZVA 2MT5A 4FO9A 2CSYA 2EGPA 4GNDA 2KGGA 4L58A 3ZPV1 5FB1A 1WGMA 2MIQA 2K17A 2M85A 2H0DB 4CA1A 3O70A 3U5OA 2YQLA 5TDRA 3GL6A 1BORA 2YW8A 2YREA 5I3LA 3RPGB 4GNEA 2Y1NA 2KR4A 3O35A 2KU3A 1WEWA 1WEQA 2L75A 2YURA 2YSJA 2KREA 3U5PA 4AUQB 5LCWB 1WEOA 1RMDA 4WZ3B 5FEYA 2KE1A 4WZ0A 5KH9A 3DPLR 4UP5A 2ECWA 4ZQLA 1HYIA 3ZVZB 2YQMA 4TKPB 2G45A 3SOUA 2LRIC 2CT2A 2EODA 1Z6UA 2VP7A 3O34A 4PPEA 4LKAA 3ZTGA 3ZVYA 1WESA 1FP0A 4I7BA 4Q6FA 3U5NA 2JMIA 1WFKA 4YBSA 1Z60A 2PNXA 5D1MB 1JM7A 5DINA 5B79A 1X4JA 2E6SA 5G0FA 4YADA 5B75A 4BBQA 4IC3A 2VJEA 3LQHA 4O64A 3M62A 4ZDTA 4FK5A 2ECTA 3PURA 2YSMA 1G25A 5LKXA 3V43A 5B8DA 3O36A 3C6WA 4BHWA 5TDWA 1WEVA 1VFYA 4AP4A 4C9ZA 2FUIA 5G05B 4MVTA 2L80A 1XWHA 3VK6A 3EB5A 2CKLA 4NN2A 4UI9B 4ZUXU 3N9PA 2PUYA 1MM2A 2CSZA 2ECNA 4AYCA 2LDRA 4UP0A 2RSDA 3HCUA 3I2DA 5B76A 2VJFB 3L11A 3N9QA 3KV6A 1WEEA 4L7XA 3KNVA 3KV5A 3U5MA 2Y1MA 2M6MA 3KQIA 2ZETC 3NG2A 2YU4A 2K4DA 2L5UA 4V3KC 2VPBA 2KWJA 1Z2QA 2ECGA 4QF2A 5JG6A 2C2VS 2MUMA 5H1VA 1N87A 4WA6A 3MHHA 2QIZA 4GNGA 4S3OC 1VYXA 4I7CA 2ECJA 1IYMA 3T6RA 2E6RA 4P5OB 2H0DA 4XI1A 5D1KB 3HCTA 2EA6A 2G6QA 1LDJB 3O7AA 3SOXA 3N9LA 4YABA 2F42A 4LLBA 2LGKA 2YYRA 1FBVA 1ZBDB 2AN6A 2RI7A 1MM3A 4LK9A 1X4IA 4CCGX 4GB0A 2XB1A 5KH7A 4LJNA 2LGGA 2MNZA 2KWOA 3N9OA 1T1HA 4FIPA 2D8SA 3DQVR 4GNFA 3L1ZB 3HCSA 3LQJA 4I7DA 2KGIA 1F62A 4F52B 5DKAA 2Y43A 2C2LA 3PHDA 3M99A 3LQIA 4YC9A 2MD8C 1LDKC 1E4UA 2MA5A 3O37A 4R2YA 4R8PK 3RPGC 2YHNA 1CHCA 1DVPA 2L43A 5J3XA 2LGVA 3T7LA 4MSXA 4V3LC 2OXQC 3C5KA 2MNYA 3RTRB 2K16A 5AITA 2LXHC 3N9NA 2LQ6A 2UZGA 5H1TA 4PTBA 5B77A 2F6JA 5TBNA 2KYUA 2BAYA 4LADB 2F6NA 3L1XA 5C11A 2QJ0A 2VNFA 2FUUA 5TRBA 5FB0A 2HYED 4A4BA 4X3GA 1V87A 2YUCA 4W4UA 2ECIA 3PUQA 5LKUA 1WILA 2YHOA 3O33A 5TABA 4IC2A 2JRJA 2MD7B 3M63A 1JOCA 4R7EA 5B78A 1WEUA 2VJFA 5FERA 2DX8A 2VPEA 4B7YC 2YT5A 5G04B 5H9MA 2KFTA 2M1RA 3N9MA 4N4FA 2LXPC 2G43A 2L0BA 2QICA 4YATA 2VPDA 3ZPVE 1WENA 1X4UA 3HTKC 1JM7B 2M3HA
chains in the Genus database with same CATH superfamily
2KWKA 2JMDA 2VJEB 3M7KA 2FFWA 5H1UA 1WEPA 2VPGA 2NAAA 1U6GB 2K1JA 4QF3A 2KKYA 2HDPA 2LN0A 2LV9A 2XEUA 2LGLA 4YBMA 2ECVA 5AIUA 2XP0A 4A4CA 3SUBA 3EB6A 4A0CD 2MA6A 2FSAA 3FEHA 4S3OB 3SHBA 2CKLB 2LAUA 3ZYQA 2JMJA 3FL2A 5C13A 5D1LB 5LKZA 3GV4A 4AVXA 5SVIA 5EYAF 3IHPA 4AYCB 2YVRA 2KWNA 4A49A 4B86C 1VD4A 1WIMA 4FJCA 1HYJA 2I50A 5LKTA 2KIZA 4N3WA 3MHSA 4YAXA 2P57A 1WEMA 3SOWA 1K2FA 3ZNIA 3LRQA 1DCQA 2FD4A 4F1PA 2IDAA 1WE9A 4YBTA 4WZ2A 3ASLA 5KH3A 3QZVA 2MT5A 4FO9A 2CSYA 2EGPA 4GNDA 3T9KA 2KGGA 4L58A 3ZPV1 3PLWA 5FB1A 1WGMA 3E2DA 2MIQA 2K17A 2M85A 2H0DB 4CA1A 3O70A 3U5OA 2YQLA 5TDRA 3GL6A 1BORA 2YW8A 2YREA 5I3LA 3RPGB 4GNEA 2Y1NA 2KR4A 3O35A 2KU3A 1WEWA 1WEQA 2L75A 2YURA 2YSJA 2KREA 3U5PA 4AUQB 5LCWB 2XOZA 4H9DA 1WEOA 1RMDA 4WZ3B 5FEYA 2KE1A 4WZ0A 5KH9A 3DPLR 4UP5A 2ECWA 4ZQLA 1HYIA 3DDTA 2XOCA 2MKEA 3ZVZB 2YQMA 4OGEA 4TKPB 2G45A 3SOUA 2LRIC 2CT2A 2EODA 4Z0OA 1Z6UA 2VP7A 3O34A 4PPEA 4LKAA 3ZTGA 3ZVYA 1WESA 1FP0A 4I7BA 4Q6FA 3U5NA 2JMIA 3FM8C 1WFKA 4YBSA 1Z60A 2PNXA 5D1MB 1JM7A 5DINA 5B79A 5SVYA 1X4JA 2E6SA 5G0FA 4YADA 5B75A 4BBQA 4IC3A 2VJEA 3LQHA 4O64A 3M62A 4ZDTA 4FK5A 2ECTA 3PURA 2YSMA 1G25A 5LKXA 3V43A 5B8DA 3O36A 3C6WA 4BHWA 5TDWA 1WEVA 1VFYA 4AP4A 4C9ZA 2FUIA 5G05B 4Z0RA 4MVTA 2L80A 4OGCA 1XWHA 3VK6A 3EB5A 2CKLA 4NN2A 4UI9B 4ZUXU 3N9PA 2PUYA 1MM2A 2CSZA 2ECNA 4AYCA 2LDRA 3FANA 4UP0A 2RSDA 3HCUA 3I2DA 5B76A 2VJFB 3KDEC 3L11A 2OWAA 3N9QA 3KV6A 1WEEA 4L7XA 3KNVA 3KV5A 3U5MA 2Y1MA 2M6MA 3Q1DA 3KQIA 2ZETC 3NG2A 2YU4A 2K4DA 2L5UA 4V3KC 2VPBA 2KWJA 1Z2QA 2ECGA 4QF2A 5JG6A 2C2VS 2MUMA 5H1VA 1N87A 4WA6A 3MHHA 2KKXA 2CSVA 2QIZA 4GNGA 4S3OC 2JM3A 1VYXA 4I7CA 2ECJA 1IYMA 3T6RA 2IQJA 2E6RA 3JUEA 4P5OB 2H0DA 4XI1A 5D1KB 3HCTA 2RR4A 2EA6A 2G6QA 1LDJB 3O7AA 3SOXA 3N9LA 2E61A 4YABA 2F42A 4LLBA 2B0OE 2LGKA 2YYRA 1FBVA 1ZBDB 2AN6A 3LVQE 2RI7A 2CONA 1MM3A 4LK9A 1X4IA 2DJAA 4CCGX 4GB0A 2XB1A 3LDYA 5SVIB 5KH7A 4LJNA 2LGGA 2MNZA 2KWOA 3N9OA 1T1HA 4FIPA 2D8SA 3DQVR 1MBMA 2DSMA 4GNFA 3L1ZB 3HCSA 3LQJA 4I7DA 2KGIA 3MDBC 1F62A 4F52B 5DKAA 2M13A 2Y43A 2C2LA 2EGMA 3PHDA 3M99A 3LQIA 4QQ4A 4YC9A 2MD8C 1LDKC 1E4UA 2MA5A 3O37A 5K3QA 4R2YA 4R8PK 3RPGC 2YHNA 1CHCA 3O47A 3LJUX 1DVPA 2L43A 5J3XA 2LGVA 3T7LA 4MSXA 4V3LC 2OXQC 2CRWA 3C5KA 2MNYA 3RTRB 2K16A 3FJUB 5AITA 2LXHC 3N9NA 2LQ6A 2UZGA 5H1TA 4PTBA 5B77A 2XOYA 2F6JA 5TBNA 2KYUA 2BAYA 4LADB 2F6NA 2CRRA 3L1XA 5C11A 2D8UA 2QJ0A 3DWDA 2VNFA 2FUUA 5TRBA 5FB0A 2HYED 4A4BA 4X3GA 1V87A 2YUCA 4W4UA 2ECIA 3PUQA 5LKUA 1WILA 2YHOA 2L7PA 3O33A 5TABA 4IC2A 2JRJA 2MD7B 3M63A 1JOCA 4O62A 4R7EA 5B78A 1WEUA 2VJFA 3H7HA 5FERA 5SVXA 2DX8A 2VPEA 4B7YC 2YT5A 5G04B 5H9MA 2KFTA 2M1RA 3N9MA 4N4FA 2LXPC 2G43A 2L0BA 3LVRE 2EXUA 2QICA 4YATA 2VPDA 3ZPVE 1WENA 1X4UA 3HTKC 3FAOA 1JM7B 2M3HA 2JUNA
chains in the Genus database with same CATH topology
2KWKA 2JMDA 2VJEB 5H1UA 1WEPA 2VPGA 2NAAA 1U6GB 2K1JA 4QF3A 2HDPA 2LN0A 2LV9A 2XEUA 2LGLA 4YBMA 2ECVA 5AIUA 4A4CA 3EB6A 4A0CD 2MA6A 2FSAA 4S3OB 3SHBA 2CKLB 3ZYQA 2JMJA 3FL2A 5C13A 5D1LB 5LKZA 3GV4A 4AVXA 5EYAF 3IHPA 4AYCB 2KWNA 4A49A 4B86C 1VD4A 1WIMA 4FJCA 1HYJA 2I50A 5LKTA 2KIZA 4N3WA 3MHSA 4YAXA 3SOWA 1WEMA 1K2FA 3ZNIA 3LRQA 2IDAA 1WE9A 4YBTA 4WZ2A 3ASLA 5KH3A 3QZVA 2MT5A 4FO9A 2CSYA 2EGPA 4GNDA 2KGGA 4L58A 3ZPV1 5FB1A 1WGMA 2MIQA 2K17A 2M85A 2H0DB 4CA1A 3O70A 3U5OA 2YQLA 5TDRA 3GL6A 1BORA 2YW8A 2YREA 5I3LA 3RPGB 4GNEA 2Y1NA 2KR4A 3O35A 2KU3A 1WEWA 1WEQA 2L75A 2YURA 2YSJA 2KREA 3U5PA 4AUQB 5LCWB 1WEOA 1RMDA 4WZ3B 5FEYA 2KE1A 4WZ0A 5KH9A 3DPLR 4UP5A 2ECWA 4ZQLA 1HYIA 3ZVZB 2YQMA 4TKPB 2G45A 3SOUA 2LRIC 2CT2A 2EODA 1Z6UA 2VP7A 3O34A 4PPEA 4LKAA 3ZTGA 3ZVYA 1WESA 1FP0A 4I7BA 4Q6FA 3U5NA 2JMIA 1WFKA 4YBSA 1Z60A 2PNXA 5D1MB 1JM7A 5DINA 5B79A 1X4JA 2E6SA 5G0FA 4YADA 5B75A 4BBQA 4IC3A 2VJEA 3LQHA 4O64A 3M62A 4ZDTA 4FK5A 2ECTA 3PURA 2YSMA 1G25A 5LKXA 3V43A 5B8DA 3O36A 3C6WA 4BHWA 5TDWA 1WEVA 1VFYA 4AP4A 4C9ZA 2FUIA 5G05B 4MVTA 2L80A 1XWHA 3VK6A 3EB5A 2CKLA 4NN2A 4UI9B 4ZUXU 3N9PA 2PUYA 1MM2A 2CSZA 2ECNA 4AYCA 2LDRA 4UP0A 2RSDA 3HCUA 3I2DA 5B76A 2VJFB 3L11A 3N9QA 3KV6A 1WEEA 4L7XA 3KNVA 3KV5A 3U5MA 2Y1MA 2M6MA 3KQIA 2ZETC 3NG2A 2YU4A 2K4DA 2L5UA 4V3KC 2VPBA 2KWJA 1Z2QA 2ECGA 4QF2A 5JG6A 2C2VS 2MUMA 5H1VA 1N87A 4WA6A 3MHHA 2QIZA 4GNGA 4S3OC 1VYXA 4I7CA 2ECJA 1IYMA 3T6RA 2E6RA 4P5OB 2H0DA 4XI1A 5D1KB 3HCTA 2EA6A 2G6QA 1LDJB 3O7AA 3SOXA 3N9LA 4YABA 2F42A 4LLBA 2LGKA 2YYRA 1FBVA 1ZBDB 2AN6A 2RI7A 1MM3A 4LK9A 1X4IA 4CCGX 4GB0A 2XB1A 5KH7A 4LJNA 2LGGA 2MNZA 2KWOA 3N9OA 1T1HA 4FIPA 2D8SA 3DQVR 4GNFA 3L1ZB 3HCSA 3LQJA 4I7DA 2KGIA 1F62A 4F52B 5DKAA 2Y43A 2C2LA 3PHDA 3M99A 3LQIA 4YC9A 2MD8C 1LDKC 1E4UA 2MA5A 3O37A 4R2YA 4R8PK 3RPGC 2YHNA 1CHCA 1DVPA 2L43A 5J3XA 2LGVA 3T7LA 4MSXA 4V3LC 2OXQC 3C5KA 2MNYA 3RTRB 2K16A 5AITA 2LXHC 3N9NA 2LQ6A 2UZGA 5H1TA 4PTBA 5B77A 2F6JA 5TBNA 2KYUA 2BAYA 4LADB 2F6NA 3L1XA 5C11A 2QJ0A 2VNFA 2FUUA 5TRBA 5FB0A 2HYED 4A4BA 4X3GA 1V87A 2YUCA 4W4UA 2ECIA 3PUQA 5LKUA 1WILA 2YHOA 3O33A 5TABA 4IC2A 2JRJA 2MD7B 3M63A 1JOCA 4R7EA 5B78A 1WEUA 2VJFA 5FERA 2DX8A 2VPEA 4B7YC 2YT5A 5G04B 5H9MA 2KFTA 2M1RA 3N9MA 4N4FA 2LXPC 2G43A 2L0BA 2QICA 4YATA 2VPDA 3ZPVE 1WENA 1X4UA 3HTKC 1JM7B 2M3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWK A;  2JMD A;  2VJE B;  5H1U A;  1WEP A;  2VPG A;  2NAA A;  1U6G B;  2K1J A;  4QF3 A;  2HDP A;  2LN0 A;  2LV9 A;  2XEU A;  2LGL A;  4YBM A;  2ECV A;  5AIU A;  4A4C A;  3EB6 A;  4A0C D;  2MA6 A;  2FSA A;  4S3O B;  3SHB A;  2CKL B;  3ZYQ A;  2JMJ A;  3FL2 A;  5C13 A;  5D1L B;  5LKZ A;  3GV4 A;  4AVX A;  5EYA F;  3IHP A;  4AYC B;  2KWN A;  4A49 A;  4B86 C;  1VD4 A;  1WIM A;  4FJC A;  1HYJ A;  2I50 A;  5LKT A;  2KIZ A;  4N3W A;  3MHS A;  4YAX A;  3SOW A;  1WEM A;  1K2F A;  3ZNI A;  3LRQ A;  2IDA A;  1WE9 A;  4YBT A;  4WZ2 A;  3ASL A;  5KH3 A;  3QZV A;  2MT5 A;  4FO9 A;  2CSY A;  2EGP A;  4GND A;  2KGG A;  4L58 A;  3ZPV 1;  5FB1 A;  1WGM A;  2MIQ A;  2K17 A;  2M85 A;  2H0D B;  4CA1 A;  3O70 A;  3U5O A;  2YQL A;  5TDR A;  3GL6 A;  1BOR A;  2YW8 A;  2YRE A;  5I3L A;  3RPG B;  4GNE A;  2Y1N A;  2KR4 A;  3O35 A;  2KU3 A;  1WEW A;  1WEQ A;  2L75 A;  2YUR A;  2YSJ A;  2KRE A;  3U5P A;  4AUQ B;  5LCW B;  1WEO A;  1RMD A;  4WZ3 B;  5FEY A;  2KE1 A;  4WZ0 A;  5KH9 A;  3DPL R;  4UP5 A;  2ECW A;  4ZQL A;  1HYI A;  3ZVZ B;  2YQM A;  4TKP B;  2G45 A;  3SOU A;  2LRI C;  2CT2 A;  2EOD A;  1Z6U A;  2VP7 A;  3O34 A;  4PPE A;  4LKA A;  3ZTG A;  3ZVY A;  1WES A;  1FP0 A;  4I7B A;  4Q6F A;  3U5N A;  2JMI A;  1WFK A;  4YBS A;  1Z60 A;  2PNX A;  5D1M B;  1JM7 A;  5DIN A;  5B79 A;  1X4J A;  2E6S A;  5G0F A;  4YAD A;  5B75 A;  4BBQ A;  4IC3 A;  2VJE A;  3LQH A;  4O64 A;  3M62 A;  4ZDT A;  4FK5 A;  2ECT A;  3PUR A;  2YSM A;  1G25 A;  5LKX A;  3V43 A;  5B8D A;  3O36 A;  3C6W A;  4BHW A;  5TDW A;  1WEV A;  1VFY A;  4AP4 A;  4C9Z A;  2FUI A;  5G05 B;  4MVT A;  2L80 A;  1XWH A;  3VK6 A;  3EB5 A;  2CKL A;  4NN2 A;  4UI9 B;  4ZUX U;  3N9P A;  2PUY A;  1MM2 A;  2CSZ A;  2ECN A;  4AYC A;  2LDR A;  4UP0 A;  2RSD A;  3HCU A;  3I2D A;  5B76 A;  2VJF B;  3L11 A;  3N9Q A;  3KV6 A;  1WEE A;  4L7X A;  3KNV A;  3KV5 A;  3U5M A;  2Y1M A;  2M6M A;  3KQI A;  2ZET C;  3NG2 A;  2YU4 A;  2K4D A;  2L5U A;  4V3K C;  2VPB A;  2KWJ A;  1Z2Q A;  2ECG A;  4QF2 A;  5JG6 A;  2C2V S;  2MUM A;  5H1V A;  1N87 A;  4WA6 A;  3MHH A;  2QIZ A;  4GNG A;  4S3O C;  1VYX A;  4I7C A;  2ECJ A;  1IYM A;  3T6R A;  2E6R A;  4P5O B;  2H0D A;  4XI1 A;  5D1K B;  3HCT A;  2EA6 A;  2G6Q A;  1LDJ B;  3O7A A;  3SOX A;  3N9L A;  4YAB A;  2F42 A;  4LLB A;  2LGK A;  2YYR A;  1FBV A;  1ZBD B;  2AN6 A;  2RI7 A;  1MM3 A;  4LK9 A;  1X4I A;  4CCG X;  4GB0 A;  2XB1 A;  5KH7 A;  4LJN A;  2LGG A;  2MNZ A;  2KWO A;  3N9O A;  1T1H A;  4FIP A;  2D8S A;  3DQV R;  4GNF A;  3L1Z B;  3HCS A;  3LQJ A;  4I7D A;  2KGI A;  1F62 A;  4F52 B;  5DKA A;  2Y43 A;  2C2L A;  3PHD A;  3M99 A;  3LQI A;  4YC9 A;  2MD8 C;  1LDK C;  1E4U A;  2MA5 A;  3O37 A;  4R2Y A;  4R8P K;  3RPG C;  2YHN A;  1CHC A;  1DVP A;  2L43 A;  5J3X A;  2LGV A;  3T7L A;  4MSX A;  4V3L C;  2OXQ C;  3C5K A;  2MNY A;  3RTR B;  2K16 A;  5AIT A;  2LXH C;  3N9N A;  2LQ6 A;  2UZG A;  5H1T A;  4PTB A;  5B77 A;  2F6J A;  5TBN A;  2KYU A;  2BAY A;  4LAD B;  2F6N A;  3L1X A;  5C11 A;  2QJ0 A;  2VNF A;  2FUU A;  5TRB A;  5FB0 A;  2HYE D;  4A4B A;  4X3G A;  1V87 A;  2YUC A;  4W4U A;  2ECI A;  3PUQ A;  5LKU A;  1WIL A;  2YHO A;  3O33 A;  5TAB A;  4IC2 A;  2JRJ A;  2MD7 B;  3M63 A;  1JOC A;  4R7E A;  5B78 A;  1WEU A;  2VJF A;  5FER A;  2DX8 A;  2VPE A;  4B7Y C;  2YT5 A;  5G04 B;  5H9M A;  2KFT A;  2M1R A;  3N9M A;  4N4F A;  2LXP C;  2G43 A;  2L0B A;  2QIC A;  4YAT A;  2VPD A;  3ZPV E;  1WEN A;  1X4U A;  3HTK C;  1JM7 B;  2M3H A; 
#chains in the Genus database with same CATH topology
 2KWK A;  2JMD A;  2VJE B;  3M7K A;  2FFW A;  5H1U A;  1WEP A;  2VPG A;  2NAA A;  1U6G B;  2K1J A;  4QF3 A;  2KKY A;  2HDP A;  2LN0 A;  2LV9 A;  2XEU A;  2LGL A;  4YBM A;  2ECV A;  5AIU A;  2XP0 A;  4A4C A;  3SUB A;  3EB6 A;  4A0C D;  2MA6 A;  2FSA A;  3FEH A;  4S3O B;  3SHB A;  2CKL B;  2LAU A;  3ZYQ A;  2JMJ A;  3FL2 A;  5C13 A;  5D1L B;  5LKZ A;  3GV4 A;  4AVX A;  5SVI A;  5EYA F;  3IHP A;  4AYC B;  2YVR A;  2KWN A;  4A49 A;  4B86 C;  1VD4 A;  1WIM A;  4FJC A;  1HYJ A;  2I50 A;  5LKT A;  2KIZ A;  4N3W A;  3MHS A;  4YAX A;  2P57 A;  1WEM A;  3SOW A;  1K2F A;  3ZNI A;  3LRQ A;  1DCQ A;  2FD4 A;  4F1P A;  2IDA A;  1WE9 A;  4YBT A;  4WZ2 A;  3ASL A;  5KH3 A;  3QZV A;  2MT5 A;  4FO9 A;  2CSY A;  2EGP A;  4GND A;  3T9K A;  2KGG A;  4L58 A;  3ZPV 1;  3PLW A;  5FB1 A;  1WGM A;  3E2D A;  2MIQ A;  2K17 A;  2M85 A;  2H0D B;  4CA1 A;  3O70 A;  3U5O A;  2YQL A;  5TDR A;  3GL6 A;  1BOR A;  2YW8 A;  2YRE A;  5I3L A;  3RPG B;  4GNE A;  2Y1N A;  2KR4 A;  3O35 A;  2KU3 A;  1WEW A;  1WEQ A;  2L75 A;  2YUR A;  2YSJ A;  2KRE A;  3U5P A;  4AUQ B;  5LCW B;  2XOZ A;  4H9D A;  1WEO A;  1RMD A;  4WZ3 B;  5FEY A;  2KE1 A;  4WZ0 A;  5KH9 A;  3DPL R;  4UP5 A;  2ECW A;  4ZQL A;  1HYI A;  3DDT A;  2XOC A;  2MKE A;  3ZVZ B;  2YQM A;  4OGE A;  4TKP B;  2G45 A;  3SOU A;  2LRI C;  2CT2 A;  2EOD A;  4Z0O A;  1Z6U A;  2VP7 A;  3O34 A;  4PPE A;  4LKA A;  3ZTG A;  3ZVY A;  1WES A;  1FP0 A;  4I7B A;  4Q6F A;  3U5N A;  2JMI A;  3FM8 C;  1WFK A;  4YBS A;  1Z60 A;  2PNX A;  5D1M B;  1JM7 A;  5DIN A;  5B79 A;  5SVY A;  1X4J A;  2E6S A;  5G0F A;  4YAD A;  5B75 A;  4BBQ A;  4IC3 A;  2VJE A;  3LQH A;  4O64 A;  3M62 A;  4ZDT A;  4FK5 A;  2ECT A;  3PUR A;  2YSM A;  1G25 A;  5LKX A;  3V43 A;  5B8D A;  3O36 A;  3C6W A;  4BHW A;  5TDW A;  1WEV A;  1VFY A;  4AP4 A;  4C9Z A;  2FUI A;  5G05 B;  4Z0R A;  4MVT A;  2L80 A;  4OGC A;  1XWH A;  3VK6 A;  3EB5 A;  2CKL A;  4NN2 A;  4UI9 B;  4ZUX U;  3N9P A;  2PUY A;  1MM2 A;  2CSZ A;  2ECN A;  4AYC A;  2LDR A;  3FAN A;  4UP0 A;  2RSD A;  3HCU A;  3I2D A;  5B76 A;  2VJF B;  3KDE C;  3L11 A;  2OWA A;  3N9Q A;  3KV6 A;  1WEE A;  4L7X A;  3KNV A;  3KV5 A;  3U5M A;  2Y1M A;  2M6M A;  3Q1D A;  3KQI A;  2ZET C;  3NG2 A;  2YU4 A;  2K4D A;  2L5U A;  4V3K C;  2VPB A;  2KWJ A;  1Z2Q A;  2ECG A;  4QF2 A;  5JG6 A;  2C2V S;  2MUM A;  5H1V A;  1N87 A;  4WA6 A;  3MHH A;  2KKX A;  2CSV A;  2QIZ A;  4GNG A;  4S3O C;  2JM3 A;  1VYX A;  4I7C A;  2ECJ A;  1IYM A;  3T6R A;  2IQJ A;  2E6R A;  3JUE A;  4P5O B;  2H0D A;  4XI1 A;  5D1K B;  3HCT A;  2RR4 A;  2EA6 A;  2G6Q A;  1LDJ B;  3O7A A;  3SOX A;  3N9L A;  2E61 A;  4YAB A;  2F42 A;  4LLB A;  2B0O E;  2LGK A;  2YYR A;  1FBV A;  1ZBD B;  2AN6 A;  3LVQ E;  2RI7 A;  2CON A;  1MM3 A;  4LK9 A;  1X4I A;  2DJA A;  4CCG X;  4GB0 A;  2XB1 A;  3LDY A;  5SVI B;  5KH7 A;  4LJN A;  2LGG A;  2MNZ A;  2KWO A;  3N9O A;  1T1H A;  4FIP A;  2D8S A;  3DQV R;  1MBM A;  2DSM A;  4GNF A;  3L1Z B;  3HCS A;  3LQJ A;  4I7D A;  2KGI A;  3MDB C;  1F62 A;  4F52 B;  5DKA A;  2M13 A;  2Y43 A;  2C2L A;  2EGM A;  3PHD A;  3M99 A;  3LQI A;  4QQ4 A;  4YC9 A;  2MD8 C;  1LDK C;  1E4U A;  2MA5 A;  3O37 A;  5K3Q A;  4R2Y A;  4R8P K;  3RPG C;  2YHN A;  1CHC A;  3O47 A;  3LJU X;  1DVP A;  2L43 A;  5J3X A;  2LGV A;  3T7L A;  4MSX A;  4V3L C;  2OXQ C;  2CRW A;  3C5K A;  2MNY A;  3RTR B;  2K16 A;  3FJU B;  5AIT A;  2LXH C;  3N9N A;  2LQ6 A;  2UZG A;  5H1T A;  4PTB A;  5B77 A;  2XOY A;  2F6J A;  5TBN A;  2KYU A;  2BAY A;  4LAD B;  2F6N A;  2CRR A;  3L1X A;  5C11 A;  2D8U A;  2QJ0 A;  3DWD A;  2VNF A;  2FUU A;  5TRB A;  5FB0 A;  2HYE D;  4A4B A;  4X3G A;  1V87 A;  2YUC A;  4W4U A;  2ECI A;  3PUQ A;  5LKU A;  1WIL A;  2YHO A;  2L7P A;  3O33 A;  5TAB A;  4IC2 A;  2JRJ A;  2MD7 B;  3M63 A;  1JOC A;  4O62 A;  4R7E A;  5B78 A;  1WEU A;  2VJF A;  3H7H A;  5FER A;  5SVX A;  2DX8 A;  2VPE A;  4B7Y C;  2YT5 A;  5G04 B;  5H9M A;  2KFT A;  2M1R A;  3N9M A;  4N4F A;  2LXP C;  2G43 A;  2L0B A;  3LVR E;  2EXU A;  2QIC A;  4YAT A;  2VPD A;  3ZPV E;  1WEN A;  1X4U A;  3HTK C;  3FAO A;  1JM7 B;  2M3H A;  2JUN A; 
#chains in the Genus database with same CATH homology
 2KWK A;  2JMD A;  2VJE B;  5H1U A;  1WEP A;  2VPG A;  2NAA A;  1U6G B;  2K1J A;  4QF3 A;  2HDP A;  2LN0 A;  2LV9 A;  2XEU A;  2LGL A;  4YBM A;  2ECV A;  5AIU A;  4A4C A;  3EB6 A;  4A0C D;  2MA6 A;  2FSA A;  4S3O B;  3SHB A;  2CKL B;  3ZYQ A;  2JMJ A;  3FL2 A;  5C13 A;  5D1L B;  5LKZ A;  3GV4 A;  4AVX A;  5EYA F;  3IHP A;  4AYC B;  2KWN A;  4A49 A;  4B86 C;  1VD4 A;  1WIM A;  4FJC A;  1HYJ A;  2I50 A;  5LKT A;  2KIZ A;  4N3W A;  3MHS A;  4YAX A;  3SOW A;  1WEM A;  1K2F A;  3ZNI A;  3LRQ A;  2IDA A;  1WE9 A;  4YBT A;  4WZ2 A;  3ASL A;  5KH3 A;  3QZV A;  2MT5 A;  4FO9 A;  2CSY A;  2EGP A;  4GND A;  2KGG A;  4L58 A;  3ZPV 1;  5FB1 A;  1WGM A;  2MIQ A;  2K17 A;  2M85 A;  2H0D B;  4CA1 A;  3O70 A;  3U5O A;  2YQL A;  5TDR A;  3GL6 A;  1BOR A;  2YW8 A;  2YRE A;  5I3L A;  3RPG B;  4GNE A;  2Y1N A;  2KR4 A;  3O35 A;  2KU3 A;  1WEW A;  1WEQ A;  2L75 A;  2YUR A;  2YSJ A;  2KRE A;  3U5P A;  4AUQ B;  5LCW B;  1WEO A;  1RMD A;  4WZ3 B;  5FEY A;  2KE1 A;  4WZ0 A;  5KH9 A;  3DPL R;  4UP5 A;  2ECW A;  4ZQL A;  1HYI A;  3ZVZ B;  2YQM A;  4TKP B;  2G45 A;  3SOU A;  2LRI C;  2CT2 A;  2EOD A;  1Z6U A;  2VP7 A;  3O34 A;  4PPE A;  4LKA A;  3ZTG A;  3ZVY A;  1WES A;  1FP0 A;  4I7B A;  4Q6F A;  3U5N A;  2JMI A;  1WFK A;  4YBS A;  1Z60 A;  2PNX A;  5D1M B;  1JM7 A;  5DIN A;  5B79 A;  1X4J A;  2E6S A;  5G0F A;  4YAD A;  5B75 A;  4BBQ A;  4IC3 A;  2VJE A;  3LQH A;  4O64 A;  3M62 A;  4ZDT A;  4FK5 A;  2ECT A;  3PUR A;  2YSM A;  1G25 A;  5LKX A;  3V43 A;  5B8D A;  3O36 A;  3C6W A;  4BHW A;  5TDW A;  1WEV A;  1VFY A;  4AP4 A;  4C9Z A;  2FUI A;  5G05 B;  4MVT A;  2L80 A;  1XWH A;  3VK6 A;  3EB5 A;  2CKL A;  4NN2 A;  4UI9 B;  4ZUX U;  3N9P A;  2PUY A;  1MM2 A;  2CSZ A;  2ECN A;  4AYC A;  2LDR A;  4UP0 A;  2RSD A;  3HCU A;  3I2D A;  5B76 A;  2VJF B;  3L11 A;  3N9Q A;  3KV6 A;  1WEE A;  4L7X A;  3KNV A;  3KV5 A;  3U5M A;  2Y1M A;  2M6M A;  3KQI A;  2ZET C;  3NG2 A;  2YU4 A;  2K4D A;  2L5U A;  4V3K C;  2VPB A;  2KWJ A;  1Z2Q A;  2ECG A;  4QF2 A;  5JG6 A;  2C2V S;  2MUM A;  5H1V A;  1N87 A;  4WA6 A;  3MHH A;  2QIZ A;  4GNG A;  4S3O C;  1VYX A;  4I7C A;  2ECJ A;  1IYM A;  3T6R A;  2E6R A;  4P5O B;  2H0D A;  4XI1 A;  5D1K B;  3HCT A;  2EA6 A;  2G6Q A;  1LDJ B;  3O7A A;  3SOX A;  3N9L A;  4YAB A;  2F42 A;  4LLB A;  2LGK A;  2YYR A;  1FBV A;  1ZBD B;  2AN6 A;  2RI7 A;  1MM3 A;  4LK9 A;  1X4I A;  4CCG X;  4GB0 A;  2XB1 A;  5KH7 A;  4LJN A;  2LGG A;  2MNZ A;  2KWO A;  3N9O A;  1T1H A;  4FIP A;  2D8S A;  3DQV R;  4GNF A;  3L1Z B;  3HCS A;  3LQJ A;  4I7D A;  2KGI A;  1F62 A;  4F52 B;  5DKA A;  2Y43 A;  2C2L A;  3PHD A;  3M99 A;  3LQI A;  4YC9 A;  2MD8 C;  1LDK C;  1E4U A;  2MA5 A;  3O37 A;  4R2Y A;  4R8P K;  3RPG C;  2YHN A;  1CHC A;  1DVP A;  2L43 A;  5J3X A;  2LGV A;  3T7L A;  4MSX A;  4V3L C;  2OXQ C;  3C5K A;  2MNY A;  3RTR B;  2K16 A;  5AIT A;  2LXH C;  3N9N A;  2LQ6 A;  2UZG A;  5H1T A;  4PTB A;  5B77 A;  2F6J A;  5TBN A;  2KYU A;  2BAY A;  4LAD B;  2F6N A;  3L1X A;  5C11 A;  2QJ0 A;  2VNF A;  2FUU A;  5TRB A;  5FB0 A;  2HYE D;  4A4B A;  4X3G A;  1V87 A;  2YUC A;  4W4U A;  2ECI A;  3PUQ A;  5LKU A;  1WIL A;  2YHO A;  3O33 A;  5TAB A;  4IC2 A;  2JRJ A;  2MD7 B;  3M63 A;  1JOC A;  4R7E A;  5B78 A;  1WEU A;  2VJF A;  5FER A;  2DX8 A;  2VPE A;  4B7Y C;  2YT5 A;  5G04 B;  5H9M A;  2KFT A;  2M1R A;  3N9M A;  4N4F A;  2LXP C;  2G43 A;  2L0B A;  2QIC A;  4YAT A;  2VPD A;  3ZPV E;  1WEN A;  1X4U A;  3HTK C;  1JM7 B;  2M3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...