2MNYA

Nmr structure of kdm5b phd1 finger
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
AVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 5B
publication title The PHD1 finger of KDM5B recognizes unmodified H3K4 during the demethylation of histone H3K4me2/3 by KDM5B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 5
structure length 55
sequence length 55
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2mnyA00
2H0DB 4AYCB 2YW8A 4A4CA 2KIZA 2KGIA 2XB1A 5TDWA 1WESA 3KV6A 4XI1A 4YBSA 4CCGX 1Z60A 2MNZA 2MUMA 3O70A 4O64A 4YABA 2VPEA 2VJFB 2KYUA 2RSDA 3N9OA 2H0DA 5TBNA 2HDPA 3V43A 1V87A 2KFTA 4R2YA 4AYCA 3LQIA 4MSXA 4LJNA 3O7AA 4YATA 1FP0A 2NAAA 4W4UA 2K4DA 2KWOA 5KH9A 1XWHA 3HCUA 2F6JA 2JMIA 3M63A 2VJFA 1IYMA 3ZTGA 4FO9A 4P5OB 4AVXA 2K17A 3N9NA 3N9MA 1X4JA 2ECGA 2RI7A 3O33A 5D1MB 5AITA 3RPGB 5LKXA 5LKZA 3U5PA 5B76A 4NN2A 4PTBA 4V3LC 2M1RA 1HYIA 1WGMA 2ECJA 2MA6A 2OXQC 1E4UA 2Y1MA 3L11A 2KWJA 3KV5A 1U6GB 2EGPA 1WEVA 2VJEB 3ZYQA 3GV4A 2YU4A 1K2FA 2VPDA 5TDRA 2IDAA 4LLBA 3HCSA 3ZVZB 2KWKA 5KH3A 4X3GA 1Z2QA 2LGKA 4R7EA 2VJEA 2M85A 2JMJA 4Q6FA 1F62A 2F6NA 4UP0A 2K1JA 3C5KA 2C2LA 1JM7A 3ZPVE 2YREA 5TRBA 2K16A 4WZ3B 1JOCA 2L75A 3ASLA 3N9PA 4V3KC 3U5MA 2F42A 4S3OB 2XEUA 2MA5A 3C6WA 1LDJB 3MHHA 4GNGA 2CKLA 2YHOA 3EB5A 5DKAA 3I2DA 5G0FA 1X4IA 2LDRA 1HYJA 4FK5A 4GNEA 4I7BA 2KGGA 2LV9A 4ZQLA 2FUIA 3VK6A 1G25A 3O35A 1WEOA 4YADA 5B78A 2KWNA 3LQHA 5H1VA 1N87A 5D1LB 1WFKA 5C13A 5LKUA 4UI9B 4YBTA 4FIPA 4L58A 1WE9A 4WA6A 2CSZA 4B86C 3T7LA 2L43A 1CHCA 2YURA 3PURA 3O34A 1Z6UA 2VNFA 2L5UA 2LN0A 2JRJA 3IHPA 2M3HA 2MD7B 5LCWB 3KNVA 4QF2A 2YSMA 2LXPC 4B7YC 2ECTA 4ZUXU 1WEPA 5AIUA 4N4FA 1DVPA 5B79A 5B77A 4QF3A 2ECNA 1BORA 3O36A 1RMDA 2LRIC 1WIMA 2PUYA 4A4BA 4UP5A 1MM3A 4GNDA 4TKPB 5DINA 2MIQA 2Y43A 4LADB 4FJCA 2C2VS 2Y1NA 4BHWA 1WEEA 2BAYA 1WENA 4A0CD 1VFYA 1WEMA 5FERA 5JG6A 5H9MA 2JMDA 2G43A 3EB6A 5FEYA 3U5OA 3L1XA 2EODA 4YBMA 4L7XA 3SOWA 2I50A 1X4UA 3RTRB 2CSYA 2FSAA 1MM2A 2YYRA 4YC9A 3DQVR 5H1TA 3FL2A 2MD8C 3LQJA 2DX8A 5G05B 4BBQA 2KR4A 2QJ0A 5LKTA 2ZETC 3DPLR 4IC3A 4A49A 1WILA 1WEUA 5I3LA 2E6SA 2MNYA 2QIZA 2M6MA 1FBVA 3SOXA 2L0BA 2VPBA 2VP7A 2LXHC 4R8PK 3T6RA 5EYAF 2AN6A 4PPEA 4IC2A 3QZVA 3HCTA 4WZ0A 3PUQA 3NG2A 3ZPV1 2D8SA 3RPGC 2LGVA 5FB1A 3L1ZB 1VYXA 4LKAA 5J3XA 2G45A 2LGLA 3N9QA 4LK9A 5FB0A 3U5NA 3KQIA 5B75A 3SHBA 1WEWA 3HTKC 3GL6A 2PNXA 1ZBDB 1WEQA 5C11A 2YQMA 4CA1A 2CT2A 2UZGA 3M62A 4AUQB 3M99A 4C9ZA 2HYED 2QICA 4F52B 1T1HA 3ZVYA 3MHSA 2YUCA 2VPGA 2KE1A 4AP4A 3ZNIA 1LDKC 2ECWA 2ECIA 5KH7A 1VD4A 5TABA 2E6RA 4WZ2A 4N3WA 4S3OC 2LQ6A 3PHDA 5H1UA 2EA6A 2YHNA 4MVTA 2L80A 2G6QA 1JM7B 4I7CA 2ECVA 2MT5A 2KREA 4I7DA 3SOUA 2FUUA 2YT5A 2YQLA 5D1KB 5B8DA 4YAXA 4GB0A 3LRQA 2KU3A 2CKLB 2YSJA 2LGGA 3N9LA 4ZDTA 5G04B 3O37A 4GNFA
chains in the Genus database with same CATH superfamily
2H0DB 4AYCB 2YW8A 4A4CA 2KIZA 2KGIA 2XB1A 5TDWA 1WESA 3KV6A 4XI1A 4YBSA 2CONA 1Z60A 4CCGX 2MNZA 2MUMA 3O70A 4O64A 4YABA 3O47A 2VPEA 2VJFB 2KYUA 2RSDA 3N9OA 2H0DA 5TBNA 2HDPA 3V43A 1V87A 2KFTA 4R2YA 4AYCA 3LQIA 4MSXA 4LJNA 3O7AA 4YATA 1FP0A 2NAAA 4W4UA 2K4DA 2KWOA 5KH9A 1XWHA 3HCUA 2XOCA 2F6JA 2JMIA 3M63A 2VJFA 1IYMA 3ZTGA 4FO9A 4P5OB 4AVXA 2K17A 3N9NA 3N9MA 1X4JA 2ECGA 2RI7A 3O33A 5D1MB 2JUNA 2MKEA 5AITA 3RPGB 5LKXA 5LKZA 3FEHA 3U5PA 5B76A 4NN2A 4PTBA 4V3LC 2M1RA 1HYIA 1WGMA 2ECJA 2MA6A 2OXQC 1E4UA 2Y1MA 3L11A 2KWJA 3KV5A 1U6GB 2EGPA 1WEVA 2VJEB 3ZYQA 3GV4A 2YU4A 2CRWA 1K2FA 2VPDA 3FM8C 5TDRA 2IDAA 4LLBA 3HCSA 3ZVZB 2KWKA 5KH3A 4X3GA 1Z2QA 2M13A 2LGKA 4R7EA 2VJEA 2M85A 2JMJA 4Q6FA 1F62A 2F6NA 4UP0A 2K1JA 1DCQA 3C5KA 2C2LA 1JM7A 3ZPVE 2YREA 2JM3A 5TRBA 2K16A 4WZ3B 1JOCA 2L75A 3ASLA 2RR4A 3N9PA 4V3KC 2CRRA 2F42A 3U5MA 4S3OB 2XEUA 2MA5A 3C6WA 1LDJB 3MHHA 4GNGA 2CKLA 2YHOA 3EB5A 5DKAA 2XOYA 3I2DA 5G0FA 1X4IA 2LDRA 3E2DA 1HYJA 4FK5A 2FD4A 4GNEA 3FANA 4I7BA 2KGGA 2D8UA 4Z0RA 3M7KA 2XOZA 2LV9A 4ZQLA 2FUIA 3VK6A 1G25A 3O35A 1WEOA 4YADA 5B78A 2KWNA 3LQHA 2LAUA 5H1VA 2XP0A 1N87A 5D1LB 1WFKA 5C13A 5SVXA 5LKUA 4UI9B 4YBTA 4FIPA 4L58A 1WE9A 4WA6A 2CSZA 2DJAA 4B86C 3T7LA 2L43A 1CHCA 2YURA 3PURA 3O34A 4O62A 1Z6UA 2VNFA 2L5UA 2LN0A 2JRJA 3IHPA 2M3HA 2MD7B 2FFWA 5LCWB 3KDEC 3FAOA 4QF2A 3KNVA 3DWDA 4F1PA 2YSMA 2LXPC 4B7YC 3LDYA 2ECTA 4ZUXU 1WEPA 5AIUA 4N4FA 2B0OE 1DVPA 5B79A 5B77A 2KKYA 4QF3A 2ECNA 1BORA 3O36A 1RMDA 2LRIC 3Q1DA 2EGMA 1WIMA 2DSMA 2PUYA 4A4BA 4UP5A 1MBMA 1MM3A 4GNDA 4TKPB 5DINA 5SVYA 2MIQA 2Y43A 4LADB 4FJCA 2C2VS 2Y1NA 4BHWA 1WEEA 2BAYA 1WENA 4A0CD 1VFYA 1WEMA 5FERA 4Z0OA 5JG6A 5H9MA 2JMDA 2G43A 3EB6A 5FEYA 3U5OA 3L1XA 2EODA 5SVIB 4YBMA 4L7XA 3SOWA 2I50A 1X4UA 3RTRB 3LVQE 2CSYA 2FSAA 1MM2A 2YYRA 4YC9A 3DQVR 5H1TA 2YVRA 3FL2A 2MD8C 3LQJA 2DX8A 5G05B 4BBQA 2KR4A 2QJ0A 3SUBA 5LKTA 2ZETC 3DPLR 4IC3A 4OGEA 3LVRE 4A49A 1WILA 1WEUA 5I3LA 2E6SA 2MNYA 2QIZA 2M6MA 1FBVA 3PLWA 3SOXA 2L0BA 2VPBA 2VP7A 2LXHC 4R8PK 3T6RA 3FJUB 5EYAF 2AN6A 2KKXA 4PPEA 4IC2A 3QZVA 3HCTA 4WZ0A 3PUQA 3NG2A 3ZPV1 2D8SA 5K3QA 3RPGC 3LJUX 2EXUA 2LGVA 5FB1A 3L1ZB 1VYXA 4LKAA 5J3XA 2G45A 2LGLA 3N9QA 4LK9A 5FB0A 3U5NA 3KQIA 4H9DA 5B75A 3SHBA 1WEWA 2E61A 3HTKC 3GL6A 2PNXA 1ZBDB 3JUEA 1WEQA 5C11A 2YQMA 4CA1A 2CT2A 2UZGA 3M62A 4AUQB 3M99A 4C9ZA 2HYED 2QICA 4F52B 1T1HA 3ZVYA 3MHSA 2YUCA 2VPGA 3T9KA 2L7PA 2KE1A 4AP4A 3ZNIA 1LDKC 2ECWA 2ECIA 5KH7A 1VD4A 5TABA 2E6RA 4WZ2A 4N3WA 4S3OC 2LQ6A 3PHDA 5H1UA 2EA6A 2YHNA 4MVTA 2L80A 2G6QA 1JM7B 4I7CA 2ECVA 2MT5A 2KREA 3DDTA 4I7DA 2P57A 3SOUA 2FUUA 2YT5A 4QQ4A 2YQLA 5D1KB 5B8DA 4YAXA 3MDBC 5SVIA 4OGCA 4GB0A 3LRQA 2KU3A 2CKLB 2IQJA 2YSJA 2LGGA 3N9LA 4ZDTA 3H7HA 2OWAA 5G04B 2CSVA 3O37A 4GNFA
chains in the Genus database with same CATH topology
2H0DB 4AYCB 2YW8A 4A4CA 2KIZA 2KGIA 2XB1A 5TDWA 1WESA 3KV6A 4XI1A 4YBSA 4CCGX 1Z60A 2MNZA 2MUMA 3O70A 4O64A 4YABA 2VPEA 2VJFB 2KYUA 2RSDA 3N9OA 2H0DA 5TBNA 2HDPA 3V43A 1V87A 2KFTA 4R2YA 4AYCA 3LQIA 4MSXA 4LJNA 3O7AA 4YATA 1FP0A 2NAAA 4W4UA 2K4DA 2KWOA 5KH9A 1XWHA 3HCUA 2F6JA 2JMIA 3M63A 2VJFA 1IYMA 3ZTGA 4FO9A 4P5OB 4AVXA 2K17A 3N9NA 3N9MA 1X4JA 2ECGA 2RI7A 3O33A 5D1MB 5AITA 3RPGB 5LKXA 5LKZA 3U5PA 5B76A 4NN2A 4PTBA 4V3LC 2M1RA 1HYIA 1WGMA 2ECJA 2MA6A 2OXQC 1E4UA 2Y1MA 3L11A 2KWJA 3KV5A 1U6GB 2EGPA 1WEVA 2VJEB 3ZYQA 3GV4A 2YU4A 1K2FA 2VPDA 5TDRA 2IDAA 4LLBA 3HCSA 3ZVZB 2KWKA 5KH3A 4X3GA 1Z2QA 2LGKA 4R7EA 2VJEA 2M85A 2JMJA 4Q6FA 1F62A 2F6NA 4UP0A 2K1JA 3C5KA 2C2LA 1JM7A 3ZPVE 2YREA 5TRBA 2K16A 4WZ3B 1JOCA 2L75A 3ASLA 3N9PA 4V3KC 3U5MA 2F42A 4S3OB 2XEUA 2MA5A 3C6WA 1LDJB 3MHHA 4GNGA 2CKLA 2YHOA 3EB5A 5DKAA 3I2DA 5G0FA 1X4IA 2LDRA 1HYJA 4FK5A 4GNEA 4I7BA 2KGGA 2LV9A 4ZQLA 2FUIA 3VK6A 1G25A 3O35A 1WEOA 4YADA 5B78A 2KWNA 3LQHA 5H1VA 1N87A 5D1LB 1WFKA 5C13A 5LKUA 4UI9B 4YBTA 4FIPA 4L58A 1WE9A 4WA6A 2CSZA 4B86C 3T7LA 2L43A 1CHCA 2YURA 3PURA 3O34A 1Z6UA 2VNFA 2L5UA 2LN0A 2JRJA 3IHPA 2M3HA 2MD7B 5LCWB 3KNVA 4QF2A 2YSMA 2LXPC 4B7YC 2ECTA 4ZUXU 1WEPA 5AIUA 4N4FA 1DVPA 5B79A 5B77A 4QF3A 2ECNA 1BORA 3O36A 1RMDA 2LRIC 1WIMA 2PUYA 4A4BA 4UP5A 1MM3A 4GNDA 4TKPB 5DINA 2MIQA 2Y43A 4LADB 4FJCA 2C2VS 2Y1NA 4BHWA 1WEEA 2BAYA 1WENA 4A0CD 1VFYA 1WEMA 5FERA 5JG6A 5H9MA 2JMDA 2G43A 3EB6A 5FEYA 3U5OA 3L1XA 2EODA 4YBMA 4L7XA 3SOWA 2I50A 1X4UA 3RTRB 2CSYA 2FSAA 1MM2A 2YYRA 4YC9A 3DQVR 5H1TA 3FL2A 2MD8C 3LQJA 2DX8A 5G05B 4BBQA 2KR4A 2QJ0A 5LKTA 2ZETC 3DPLR 4IC3A 4A49A 1WILA 1WEUA 5I3LA 2E6SA 2MNYA 2QIZA 2M6MA 1FBVA 3SOXA 2L0BA 2VPBA 2VP7A 2LXHC 4R8PK 3T6RA 5EYAF 2AN6A 4PPEA 4IC2A 3QZVA 3HCTA 4WZ0A 3PUQA 3NG2A 3ZPV1 2D8SA 3RPGC 2LGVA 5FB1A 3L1ZB 1VYXA 4LKAA 5J3XA 2G45A 2LGLA 3N9QA 4LK9A 5FB0A 3U5NA 3KQIA 5B75A 3SHBA 1WEWA 3HTKC 3GL6A 2PNXA 1ZBDB 1WEQA 5C11A 2YQMA 4CA1A 2CT2A 2UZGA 3M62A 4AUQB 3M99A 4C9ZA 2HYED 2QICA 4F52B 1T1HA 3ZVYA 3MHSA 2YUCA 2VPGA 2KE1A 4AP4A 3ZNIA 1LDKC 2ECWA 2ECIA 5KH7A 1VD4A 5TABA 2E6RA 4WZ2A 4N3WA 4S3OC 2LQ6A 3PHDA 5H1UA 2EA6A 2YHNA 4MVTA 2L80A 2G6QA 1JM7B 4I7CA 2ECVA 2MT5A 2KREA 4I7DA 3SOUA 2FUUA 2YT5A 2YQLA 5D1KB 5B8DA 4YAXA 4GB0A 3LRQA 2KU3A 2CKLB 2YSJA 2LGGA 3N9LA 4ZDTA 5G04B 3O37A 4GNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0D B;  4AYC B;  2YW8 A;  4A4C A;  2KIZ A;  2KGI A;  2XB1 A;  5TDW A;  1WES A;  3KV6 A;  4XI1 A;  4YBS A;  4CCG X;  1Z60 A;  2MNZ A;  2MUM A;  3O70 A;  4O64 A;  4YAB A;  2VPE A;  2VJF B;  2KYU A;  2RSD A;  3N9O A;  2H0D A;  5TBN A;  2HDP A;  3V43 A;  1V87 A;  2KFT A;  4R2Y A;  4AYC A;  3LQI A;  4MSX A;  4LJN A;  3O7A A;  4YAT A;  1FP0 A;  2NAA A;  4W4U A;  2K4D A;  2KWO A;  5KH9 A;  1XWH A;  3HCU A;  2F6J A;  2JMI A;  3M63 A;  2VJF A;  1IYM A;  3ZTG A;  4FO9 A;  4P5O B;  4AVX A;  2K17 A;  3N9N A;  3N9M A;  1X4J A;  2ECG A;  2RI7 A;  3O33 A;  5D1M B;  5AIT A;  3RPG B;  5LKX A;  5LKZ A;  3U5P A;  5B76 A;  4NN2 A;  4PTB A;  4V3L C;  2M1R A;  1HYI A;  1WGM A;  2ECJ A;  2MA6 A;  2OXQ C;  1E4U A;  2Y1M A;  3L11 A;  2KWJ A;  3KV5 A;  1U6G B;  2EGP A;  1WEV A;  2VJE B;  3ZYQ A;  3GV4 A;  2YU4 A;  1K2F A;  2VPD A;  5TDR A;  2IDA A;  4LLB A;  3HCS A;  3ZVZ B;  2KWK A;  5KH3 A;  4X3G A;  1Z2Q A;  2LGK A;  4R7E A;  2VJE A;  2M85 A;  2JMJ A;  4Q6F A;  1F62 A;  2F6N A;  4UP0 A;  2K1J A;  3C5K A;  2C2L A;  1JM7 A;  3ZPV E;  2YRE A;  5TRB A;  2K16 A;  4WZ3 B;  1JOC A;  2L75 A;  3ASL A;  3N9P A;  4V3K C;  3U5M A;  2F42 A;  4S3O B;  2XEU A;  2MA5 A;  3C6W A;  1LDJ B;  3MHH A;  4GNG A;  2CKL A;  2YHO A;  3EB5 A;  5DKA A;  3I2D A;  5G0F A;  1X4I A;  2LDR A;  1HYJ A;  4FK5 A;  4GNE A;  4I7B A;  2KGG A;  2LV9 A;  4ZQL A;  2FUI A;  3VK6 A;  1G25 A;  3O35 A;  1WEO A;  4YAD A;  5B78 A;  2KWN A;  3LQH A;  5H1V A;  1N87 A;  5D1L B;  1WFK A;  5C13 A;  5LKU A;  4UI9 B;  4YBT A;  4FIP A;  4L58 A;  1WE9 A;  4WA6 A;  2CSZ A;  4B86 C;  3T7L A;  2L43 A;  1CHC A;  2YUR A;  3PUR A;  3O34 A;  1Z6U A;  2VNF A;  2L5U A;  2LN0 A;  2JRJ A;  3IHP A;  2M3H A;  2MD7 B;  5LCW B;  3KNV A;  4QF2 A;  2YSM A;  2LXP C;  4B7Y C;  2ECT A;  4ZUX U;  1WEP A;  5AIU A;  4N4F A;  1DVP A;  5B79 A;  5B77 A;  4QF3 A;  2ECN A;  1BOR A;  3O36 A;  1RMD A;  2LRI C;  1WIM A;  2PUY A;  4A4B A;  4UP5 A;  1MM3 A;  4GND A;  4TKP B;  5DIN A;  2MIQ A;  2Y43 A;  4LAD B;  4FJC A;  2C2V S;  2Y1N A;  4BHW A;  1WEE A;  2BAY A;  1WEN A;  4A0C D;  1VFY A;  1WEM A;  5FER A;  5JG6 A;  5H9M A;  2JMD A;  2G43 A;  3EB6 A;  5FEY A;  3U5O A;  3L1X A;  2EOD A;  4YBM A;  4L7X A;  3SOW A;  2I50 A;  1X4U A;  3RTR B;  2CSY A;  2FSA A;  1MM2 A;  2YYR A;  4YC9 A;  3DQV R;  5H1T A;  3FL2 A;  2MD8 C;  3LQJ A;  2DX8 A;  5G05 B;  4BBQ A;  2KR4 A;  2QJ0 A;  5LKT A;  2ZET C;  3DPL R;  4IC3 A;  4A49 A;  1WIL A;  1WEU A;  5I3L A;  2E6S A;  2MNY A;  2QIZ A;  2M6M A;  1FBV A;  3SOX A;  2L0B A;  2VPB A;  2VP7 A;  2LXH C;  4R8P K;  3T6R A;  5EYA F;  2AN6 A;  4PPE A;  4IC2 A;  3QZV A;  3HCT A;  4WZ0 A;  3PUQ A;  3NG2 A;  3ZPV 1;  2D8S A;  3RPG C;  2LGV A;  5FB1 A;  3L1Z B;  1VYX A;  4LKA A;  5J3X A;  2G45 A;  2LGL A;  3N9Q A;  4LK9 A;  5FB0 A;  3U5N A;  3KQI A;  5B75 A;  3SHB A;  1WEW A;  3HTK C;  3GL6 A;  2PNX A;  1ZBD B;  1WEQ A;  5C11 A;  2YQM A;  4CA1 A;  2CT2 A;  2UZG A;  3M62 A;  4AUQ B;  3M99 A;  4C9Z A;  2HYE D;  2QIC A;  4F52 B;  1T1H A;  3ZVY A;  3MHS A;  2YUC A;  2VPG A;  2KE1 A;  4AP4 A;  3ZNI A;  1LDK C;  2ECW A;  2ECI A;  5KH7 A;  1VD4 A;  5TAB A;  2E6R A;  4WZ2 A;  4N3W A;  4S3O C;  2LQ6 A;  3PHD A;  5H1U A;  2EA6 A;  2YHN A;  4MVT A;  2L80 A;  2G6Q A;  1JM7 B;  4I7C A;  2ECV A;  2MT5 A;  2KRE A;  4I7D A;  3SOU A;  2FUU A;  2YT5 A;  2YQL A;  5D1K B;  5B8D A;  4YAX A;  4GB0 A;  3LRQ A;  2KU3 A;  2CKL B;  2YSJ A;  2LGG A;  3N9L A;  4ZDT A;  5G04 B;  3O37 A;  4GNF A; 
#chains in the Genus database with same CATH topology
 2H0D B;  4AYC B;  2YW8 A;  4A4C A;  2KIZ A;  2KGI A;  2XB1 A;  5TDW A;  1WES A;  3KV6 A;  4XI1 A;  4YBS A;  2CON A;  1Z60 A;  4CCG X;  2MNZ A;  2MUM A;  3O70 A;  4O64 A;  4YAB A;  3O47 A;  2VPE A;  2VJF B;  2KYU A;  2RSD A;  3N9O A;  2H0D A;  5TBN A;  2HDP A;  3V43 A;  1V87 A;  2KFT A;  4R2Y A;  4AYC A;  3LQI A;  4MSX A;  4LJN A;  3O7A A;  4YAT A;  1FP0 A;  2NAA A;  4W4U A;  2K4D A;  2KWO A;  5KH9 A;  1XWH A;  3HCU A;  2XOC A;  2F6J A;  2JMI A;  3M63 A;  2VJF A;  1IYM A;  3ZTG A;  4FO9 A;  4P5O B;  4AVX A;  2K17 A;  3N9N A;  3N9M A;  1X4J A;  2ECG A;  2RI7 A;  3O33 A;  5D1M B;  2JUN A;  2MKE A;  5AIT A;  3RPG B;  5LKX A;  5LKZ A;  3FEH A;  3U5P A;  5B76 A;  4NN2 A;  4PTB A;  4V3L C;  2M1R A;  1HYI A;  1WGM A;  2ECJ A;  2MA6 A;  2OXQ C;  1E4U A;  2Y1M A;  3L11 A;  2KWJ A;  3KV5 A;  1U6G B;  2EGP A;  1WEV A;  2VJE B;  3ZYQ A;  3GV4 A;  2YU4 A;  2CRW A;  1K2F A;  2VPD A;  3FM8 C;  5TDR A;  2IDA A;  4LLB A;  3HCS A;  3ZVZ B;  2KWK A;  5KH3 A;  4X3G A;  1Z2Q A;  2M13 A;  2LGK A;  4R7E A;  2VJE A;  2M85 A;  2JMJ A;  4Q6F A;  1F62 A;  2F6N A;  4UP0 A;  2K1J A;  1DCQ A;  3C5K A;  2C2L A;  1JM7 A;  3ZPV E;  2YRE A;  2JM3 A;  5TRB A;  2K16 A;  4WZ3 B;  1JOC A;  2L75 A;  3ASL A;  2RR4 A;  3N9P A;  4V3K C;  2CRR A;  2F42 A;  3U5M A;  4S3O B;  2XEU A;  2MA5 A;  3C6W A;  1LDJ B;  3MHH A;  4GNG A;  2CKL A;  2YHO A;  3EB5 A;  5DKA A;  2XOY A;  3I2D A;  5G0F A;  1X4I A;  2LDR A;  3E2D A;  1HYJ A;  4FK5 A;  2FD4 A;  4GNE A;  3FAN A;  4I7B A;  2KGG A;  2D8U A;  4Z0R A;  3M7K A;  2XOZ A;  2LV9 A;  4ZQL A;  2FUI A;  3VK6 A;  1G25 A;  3O35 A;  1WEO A;  4YAD A;  5B78 A;  2KWN A;  3LQH A;  2LAU A;  5H1V A;  2XP0 A;  1N87 A;  5D1L B;  1WFK A;  5C13 A;  5SVX A;  5LKU A;  4UI9 B;  4YBT A;  4FIP A;  4L58 A;  1WE9 A;  4WA6 A;  2CSZ A;  2DJA A;  4B86 C;  3T7L A;  2L43 A;  1CHC A;  2YUR A;  3PUR A;  3O34 A;  4O62 A;  1Z6U A;  2VNF A;  2L5U A;  2LN0 A;  2JRJ A;  3IHP A;  2M3H A;  2MD7 B;  2FFW A;  5LCW B;  3KDE C;  3FAO A;  4QF2 A;  3KNV A;  3DWD A;  4F1P A;  2YSM A;  2LXP C;  4B7Y C;  3LDY A;  2ECT A;  4ZUX U;  1WEP A;  5AIU A;  4N4F A;  2B0O E;  1DVP A;  5B79 A;  5B77 A;  2KKY A;  4QF3 A;  2ECN A;  1BOR A;  3O36 A;  1RMD A;  2LRI C;  3Q1D A;  2EGM A;  1WIM A;  2DSM A;  2PUY A;  4A4B A;  4UP5 A;  1MBM A;  1MM3 A;  4GND A;  4TKP B;  5DIN A;  5SVY A;  2MIQ A;  2Y43 A;  4LAD B;  4FJC A;  2C2V S;  2Y1N A;  4BHW A;  1WEE A;  2BAY A;  1WEN A;  4A0C D;  1VFY A;  1WEM A;  5FER A;  4Z0O A;  5JG6 A;  5H9M A;  2JMD A;  2G43 A;  3EB6 A;  5FEY A;  3U5O A;  3L1X A;  2EOD A;  5SVI B;  4YBM A;  4L7X A;  3SOW A;  2I50 A;  1X4U A;  3RTR B;  3LVQ E;  2CSY A;  2FSA A;  1MM2 A;  2YYR A;  4YC9 A;  3DQV R;  5H1T A;  2YVR A;  3FL2 A;  2MD8 C;  3LQJ A;  2DX8 A;  5G05 B;  4BBQ A;  2KR4 A;  2QJ0 A;  3SUB A;  5LKT A;  2ZET C;  3DPL R;  4IC3 A;  4OGE A;  3LVR E;  4A49 A;  1WIL A;  1WEU A;  5I3L A;  2E6S A;  2MNY A;  2QIZ A;  2M6M A;  1FBV A;  3PLW A;  3SOX A;  2L0B A;  2VPB A;  2VP7 A;  2LXH C;  4R8P K;  3T6R A;  3FJU B;  5EYA F;  2AN6 A;  2KKX A;  4PPE A;  4IC2 A;  3QZV A;  3HCT A;  4WZ0 A;  3PUQ A;  3NG2 A;  3ZPV 1;  2D8S A;  5K3Q A;  3RPG C;  3LJU X;  2EXU A;  2LGV A;  5FB1 A;  3L1Z B;  1VYX A;  4LKA A;  5J3X A;  2G45 A;  2LGL A;  3N9Q A;  4LK9 A;  5FB0 A;  3U5N A;  3KQI A;  4H9D A;  5B75 A;  3SHB A;  1WEW A;  2E61 A;  3HTK C;  3GL6 A;  2PNX A;  1ZBD B;  3JUE A;  1WEQ A;  5C11 A;  2YQM A;  4CA1 A;  2CT2 A;  2UZG A;  3M62 A;  4AUQ B;  3M99 A;  4C9Z A;  2HYE D;  2QIC A;  4F52 B;  1T1H A;  3ZVY A;  3MHS A;  2YUC A;  2VPG A;  3T9K A;  2L7P A;  2KE1 A;  4AP4 A;  3ZNI A;  1LDK C;  2ECW A;  2ECI A;  5KH7 A;  1VD4 A;  5TAB A;  2E6R A;  4WZ2 A;  4N3W A;  4S3O C;  2LQ6 A;  3PHD A;  5H1U A;  2EA6 A;  2YHN A;  4MVT A;  2L80 A;  2G6Q A;  1JM7 B;  4I7C A;  2ECV A;  2MT5 A;  2KRE A;  3DDT A;  4I7D A;  2P57 A;  3SOU A;  2FUU A;  2YT5 A;  4QQ4 A;  2YQL A;  5D1K B;  5B8D A;  4YAX A;  3MDB C;  5SVI A;  4OGC A;  4GB0 A;  3LRQ A;  2KU3 A;  2CKL B;  2IQJ A;  2YSJ A;  2LGG A;  3N9L A;  4ZDT A;  3H7H A;  2OWA A;  5G04 B;  2CSV A;  3O37 A;  4GNF A; 
#chains in the Genus database with same CATH homology
 2H0D B;  4AYC B;  2YW8 A;  4A4C A;  2KIZ A;  2KGI A;  2XB1 A;  5TDW A;  1WES A;  3KV6 A;  4XI1 A;  4YBS A;  4CCG X;  1Z60 A;  2MNZ A;  2MUM A;  3O70 A;  4O64 A;  4YAB A;  2VPE A;  2VJF B;  2KYU A;  2RSD A;  3N9O A;  2H0D A;  5TBN A;  2HDP A;  3V43 A;  1V87 A;  2KFT A;  4R2Y A;  4AYC A;  3LQI A;  4MSX A;  4LJN A;  3O7A A;  4YAT A;  1FP0 A;  2NAA A;  4W4U A;  2K4D A;  2KWO A;  5KH9 A;  1XWH A;  3HCU A;  2F6J A;  2JMI A;  3M63 A;  2VJF A;  1IYM A;  3ZTG A;  4FO9 A;  4P5O B;  4AVX A;  2K17 A;  3N9N A;  3N9M A;  1X4J A;  2ECG A;  2RI7 A;  3O33 A;  5D1M B;  5AIT A;  3RPG B;  5LKX A;  5LKZ A;  3U5P A;  5B76 A;  4NN2 A;  4PTB A;  4V3L C;  2M1R A;  1HYI A;  1WGM A;  2ECJ A;  2MA6 A;  2OXQ C;  1E4U A;  2Y1M A;  3L11 A;  2KWJ A;  3KV5 A;  1U6G B;  2EGP A;  1WEV A;  2VJE B;  3ZYQ A;  3GV4 A;  2YU4 A;  1K2F A;  2VPD A;  5TDR A;  2IDA A;  4LLB A;  3HCS A;  3ZVZ B;  2KWK A;  5KH3 A;  4X3G A;  1Z2Q A;  2LGK A;  4R7E A;  2VJE A;  2M85 A;  2JMJ A;  4Q6F A;  1F62 A;  2F6N A;  4UP0 A;  2K1J A;  3C5K A;  2C2L A;  1JM7 A;  3ZPV E;  2YRE A;  5TRB A;  2K16 A;  4WZ3 B;  1JOC A;  2L75 A;  3ASL A;  3N9P A;  4V3K C;  3U5M A;  2F42 A;  4S3O B;  2XEU A;  2MA5 A;  3C6W A;  1LDJ B;  3MHH A;  4GNG A;  2CKL A;  2YHO A;  3EB5 A;  5DKA A;  3I2D A;  5G0F A;  1X4I A;  2LDR A;  1HYJ A;  4FK5 A;  4GNE A;  4I7B A;  2KGG A;  2LV9 A;  4ZQL A;  2FUI A;  3VK6 A;  1G25 A;  3O35 A;  1WEO A;  4YAD A;  5B78 A;  2KWN A;  3LQH A;  5H1V A;  1N87 A;  5D1L B;  1WFK A;  5C13 A;  5LKU A;  4UI9 B;  4YBT A;  4FIP A;  4L58 A;  1WE9 A;  4WA6 A;  2CSZ A;  4B86 C;  3T7L A;  2L43 A;  1CHC A;  2YUR A;  3PUR A;  3O34 A;  1Z6U A;  2VNF A;  2L5U A;  2LN0 A;  2JRJ A;  3IHP A;  2M3H A;  2MD7 B;  5LCW B;  3KNV A;  4QF2 A;  2YSM A;  2LXP C;  4B7Y C;  2ECT A;  4ZUX U;  1WEP A;  5AIU A;  4N4F A;  1DVP A;  5B79 A;  5B77 A;  4QF3 A;  2ECN A;  1BOR A;  3O36 A;  1RMD A;  2LRI C;  1WIM A;  2PUY A;  4A4B A;  4UP5 A;  1MM3 A;  4GND A;  4TKP B;  5DIN A;  2MIQ A;  2Y43 A;  4LAD B;  4FJC A;  2C2V S;  2Y1N A;  4BHW A;  1WEE A;  2BAY A;  1WEN A;  4A0C D;  1VFY A;  1WEM A;  5FER A;  5JG6 A;  5H9M A;  2JMD A;  2G43 A;  3EB6 A;  5FEY A;  3U5O A;  3L1X A;  2EOD A;  4YBM A;  4L7X A;  3SOW A;  2I50 A;  1X4U A;  3RTR B;  2CSY A;  2FSA A;  1MM2 A;  2YYR A;  4YC9 A;  3DQV R;  5H1T A;  3FL2 A;  2MD8 C;  3LQJ A;  2DX8 A;  5G05 B;  4BBQ A;  2KR4 A;  2QJ0 A;  5LKT A;  2ZET C;  3DPL R;  4IC3 A;  4A49 A;  1WIL A;  1WEU A;  5I3L A;  2E6S A;  2MNY A;  2QIZ A;  2M6M A;  1FBV A;  3SOX A;  2L0B A;  2VPB A;  2VP7 A;  2LXH C;  4R8P K;  3T6R A;  5EYA F;  2AN6 A;  4PPE A;  4IC2 A;  3QZV A;  3HCT A;  4WZ0 A;  3PUQ A;  3NG2 A;  3ZPV 1;  2D8S A;  3RPG C;  2LGV A;  5FB1 A;  3L1Z B;  1VYX A;  4LKA A;  5J3X A;  2G45 A;  2LGL A;  3N9Q A;  4LK9 A;  5FB0 A;  3U5N A;  3KQI A;  5B75 A;  3SHB A;  1WEW A;  3HTK C;  3GL6 A;  2PNX A;  1ZBD B;  1WEQ A;  5C11 A;  2YQM A;  4CA1 A;  2CT2 A;  2UZG A;  3M62 A;  4AUQ B;  3M99 A;  4C9Z A;  2HYE D;  2QIC A;  4F52 B;  1T1H A;  3ZVY A;  3MHS A;  2YUC A;  2VPG A;  2KE1 A;  4AP4 A;  3ZNI A;  1LDK C;  2ECW A;  2ECI A;  5KH7 A;  1VD4 A;  5TAB A;  2E6R A;  4WZ2 A;  4N3W A;  4S3O C;  2LQ6 A;  3PHD A;  5H1U A;  2EA6 A;  2YHN A;  4MVT A;  2L80 A;  2G6Q A;  1JM7 B;  4I7C A;  2ECV A;  2MT5 A;  2KRE A;  4I7D A;  3SOU A;  2FUU A;  2YT5 A;  2YQL A;  5D1K B;  5B8D A;  4YAX A;  4GB0 A;  3LRQ A;  2KU3 A;  2CKL B;  2YSJ A;  2LGG A;  3N9L A;  4ZDT A;  5G04 B;  3O37 A;  4GNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...