2FFWA

Solution structure of the rbcc/trim b-box1 domain of human mid1: b-box with a ring
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
78
structure length
78
Chain Sequence
QKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Midline-1
publication title Solution Structure of the RBCC/TRIM B-box1 Domain of Human MID1: B-box with a RING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 5
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.90 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2ffwA00
2FFWA
chains in the Genus database with same CATH superfamily
2MD7B 3FM8C 2K17A 2LDRA 2MIQA 2RSDA 3LRQA 2LRIC 3ZPV1 2LQ6A 5TDRA 3PHDA 2F6JA 3EB6A 1G25A 2RR4A 3QZVA 3LJUX 2QICA 3T9KA 5AIUA 1MBMA 3EB5A 2MA6A 3U5NA 4BBQA 4A4CA 3HCUA 5B8DA 4I7CA 4F52B 5D1KB 4YBSA 3L1XA 1MM2A 5LKXA 5H1TA 3PURA 2VJFA 2KWKA 4IC3A 4O64A 3LDYA 5KH3A 2MUMA 5K3QA 2D8SA 1Z6UA 4YATA 1WEUA 4GB0A 3V43A 2PUYA 2C2VS 5B78A 3PLWA 1Z60A 2M13A 3PUQA 4I7BA 4MVTA 3N9OA 1HYJA 3ZNIA 3O7AA 1U6GB 5FB0A 5DINA 2B0OE 2XP0A 3IHPA 5H1VA 2E6RA 2M85A 2KKYA 2JMJA 2LV9A 4N4FA 1FP0A 3KNVA 2LAUA 1WEPA 3KDEC 2ECNA 2KIZA 2VJEB 2M3HA 1WFKA 4LJNA 4Z0RA 2E61A 2MD8C 1DCQA 5I3LA 1HYIA 2VPEA 1K2FA 2ECWA 5H9MA 3M62A 4TKPB 2FD4A 2L75A 4YC9A 5TABA 1X4IA 2CSZA 2LGGA 4W4UA 5KH9A 2LGVA 2L0BA 5LCWB 4ZUXU 5SVXA 5FB1A 1F62A 2L5UA 4A49A 2CRRA 3LQIA 1WE9A 1T1HA 4GNGA 2ECVA 2CONA 5FERA 4YADA 2CRWA 3N9PA 4R7EA 4FIPA 3SOXA 1DVPA 2CT2A 4ZQLA 5AITA 4YAXA 3RPGC 4QF3A 2C2LA 2FUUA 1WIMA 3SOUA 3RTRB 4AUQB 4LLBA 2LGKA 5DKAA 1Z2QA 2JMIA 2XB1A 2CSVA 2JUNA 3N9LA 2KKXA 2K4DA 2EODA 2E6SA 2KWNA 5LKUA 2QIZA 4UI9B 4AYCA 2VJFB 4A0CD 3KQIA 1VD4A 5H1UA 5SVYA 2L80A 3ASLA 2DX8A 2YSMA 2OWAA 2ECGA 3M63A 4PPEA 4XI1A 5EYAF 5G05B 2QJ0A 4CCGX 2VPDA 4UP5A 3LQJA 1WESA 2YVRA 1MM3A 4CA1A 5J3XA 3C5KA 4B7YC 4I7DA 1WEVA 4NN2A 2D8UA 2L43A 3MHSA 5LKZA 3SOWA 4LADB 3ZVYA 4OGEA 3HCTA 2Y1MA 2HYED 4UP0A 4WZ3B 2KREA 4WZ2A 4V3KC 3ZVZB 4FO9A 4N3WA 1VFYA 5LKTA 1LDJB 3O70A 2I50A 2LXPC 1JM7A 2LXHC 1JOCA 5JG6A 4L7XA 5TRBA 2VNFA 2AN6A 3ZTGA 4GNDA 4LK9A 2YQMA 3M99A 3I2DA 5SVIB 2YW8A 4F1PA 2KU3A 3N9QA 4YABA 2RI7A 3FAOA 3O47A 4A4BA 1WEOA 3E2DA 5SVIA 5C13A 5B77A 2YUCA 3VK6A 2KE1A 2YREA 2NAAA 2XOZA 2OXQC 1VYXA 4YBTA 4V3LC 2FSAA 3MHHA 1XWHA 4S3OB 5B75A 2YQLA 2G6QA 4Z0OA 2DSMA 2JM3A 3O37A 2YURA 3DDTA 3DQVR 4P5OB 4AVXA 4H9DA 4ZDTA 2KGIA 5D1MB 3O34A 2XEUA 2YT5A 2LN0A 2F6NA 2M6MA 5FEYA 3NG2A 3C6WA 2FFWA 5KH7A 2EGPA 5G04B 2Y1NA 3GL6A 2H0DA 3HCSA 5B79A 1WEWA 2XOCA 1WILA 1FBVA 5TDWA 1E4UA 2HDPA 4AYCB 4MSXA 3ZPVE 2EGMA 4FJCA 2BAYA 2JMDA 2YYRA 3U5PA 2KFTA 2KGGA 2VP7A 2G45A 4GNFA 1WEEA 3M7KA 2FUIA 1RMDA 1WENA 2LGLA 4FK5A 3HTKC 2EA6A 1LDKC 2MNZA 2G43A 1BORA 2CSYA 1V87A 2F42A 1ZBDB 2JRJA 3GV4A 3KV5A 3H7HA 2ECIA 4R2YA 3ZYQA 2EXUA 2MKEA 4GNEA 3SHBA 3N9MA 4WA6A 1JM7B 5C11A 4Q6FA 3O35A 2KWJA 3O33A 4O62A 4PTBA 4WZ0A 3L11A 2KR4A 2IQJA 2P57A 2KWOA 3LVQE 3MDBC 3KV6A 2YU4A 2VPGA 3Q1DA 4QQ4A 2ECTA 2K16A 4AP4A 2PNXA 2MT5A 3SUBA 2ECJA 1WGMA 4R8PK 2YSJA 3FANA 4C9ZA 3L1ZB 2CKLB 2KYUA 5TBNA 4YBMA 4L58A 1X4JA 2XOYA 2MNYA 3U5MA 2CKLA 3RPGB 3FEHA 3JUEA 4IC2A 1WEQA 2YHOA 3DWDA 5G0FA 1CHCA 3FJUB 1N87A 2VJEA 2VPBA 4X3GA 2L7PA 3N9NA 3LVRE 2IDAA 2UZGA 2H0DB 2ZETC 3DPLR 4QF2A 4B86C 1X4UA 2Y43A 2MA5A 5D1LB 1IYMA 3U5OA 1WEMA 3T6RA 2DJAA 3T7LA 4LKAA 4BHWA 5B76A 4OGCA 2M1RA 4S3OC 3FL2A 3LQHA 3O36A 2YHNA 2K1JA
chains in the Genus database with same CATH topology
2XOYA 3FM8C 4Z0OA 2KKYA 2FD4A 2JM3A 3M7KA 4OGEA 5SVIB 4F1PA 2EXUA 2MKEA 3DDTA 3FEHA 2LAUA 3JUEA 3PLWA 3Q1DA 5SVYA 3KDEC 2M13A 4H9DA 4QQ4A 3LDYA 3O47A 2OWAA 3DWDA 5SVXA 2XOCA 3E2DA 3FJUB 5K3QA 5SVIA 2CRRA 2DJAA 2YVRA 3SUBA 2YREA 2CONA 2RR4A 4OGCA 2CSVA 2JUNA 2XOZA 3LJUX 4O62A 4Z0RA 2E61A 2KKXA 2CRWA 1DCQA 2IQJA 3T9KA 2L7PA 2D8UA 2B0OE 2P57A 3LVRE 2XP0A 2FFWA 3LVQE 2EGMA 3MDBC 3H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFW A; 
#chains in the Genus database with same CATH topology
 2MD7 B;  3FM8 C;  2K17 A;  2LDR A;  2MIQ A;  2RSD A;  3LRQ A;  2LRI C;  3ZPV 1;  2LQ6 A;  5TDR A;  3PHD A;  2F6J A;  3EB6 A;  1G25 A;  2RR4 A;  3QZV A;  3LJU X;  2QIC A;  3T9K A;  5AIU A;  1MBM A;  3EB5 A;  2MA6 A;  3U5N A;  4BBQ A;  4A4C A;  3HCU A;  5B8D A;  4I7C A;  4F52 B;  5D1K B;  4YBS A;  3L1X A;  1MM2 A;  5LKX A;  5H1T A;  3PUR A;  2VJF A;  2KWK A;  4IC3 A;  4O64 A;  3LDY A;  5KH3 A;  2MUM A;  5K3Q A;  2D8S A;  1Z6U A;  4YAT A;  1WEU A;  4GB0 A;  3V43 A;  2PUY A;  2C2V S;  5B78 A;  3PLW A;  1Z60 A;  2M13 A;  3PUQ A;  4I7B A;  4MVT A;  3N9O A;  1HYJ A;  3ZNI A;  3O7A A;  1U6G B;  5FB0 A;  5DIN A;  2B0O E;  2XP0 A;  3IHP A;  5H1V A;  2E6R A;  2M85 A;  2KKY A;  2JMJ A;  2LV9 A;  4N4F A;  1FP0 A;  3KNV A;  2LAU A;  1WEP A;  3KDE C;  2ECN A;  2KIZ A;  2VJE B;  2M3H A;  1WFK A;  4LJN A;  4Z0R A;  2E61 A;  2MD8 C;  1DCQ A;  5I3L A;  1HYI A;  2VPE A;  1K2F A;  2ECW A;  5H9M A;  3M62 A;  4TKP B;  2FD4 A;  2L75 A;  4YC9 A;  5TAB A;  1X4I A;  2CSZ A;  2LGG A;  4W4U A;  5KH9 A;  2LGV A;  2L0B A;  5LCW B;  4ZUX U;  5SVX A;  5FB1 A;  1F62 A;  2L5U A;  4A49 A;  2CRR A;  3LQI A;  1WE9 A;  1T1H A;  4GNG A;  2ECV A;  2CON A;  5FER A;  4YAD A;  2CRW A;  3N9P A;  4R7E A;  4FIP A;  3SOX A;  1DVP A;  2CT2 A;  4ZQL A;  5AIT A;  4YAX A;  3RPG C;  4QF3 A;  2C2L A;  2FUU A;  1WIM A;  3SOU A;  3RTR B;  4AUQ B;  4LLB A;  2LGK A;  5DKA A;  1Z2Q A;  2JMI A;  2XB1 A;  2CSV A;  2JUN A;  3N9L A;  2KKX A;  2K4D A;  2EOD A;  2E6S A;  2KWN A;  5LKU A;  2QIZ A;  4UI9 B;  4AYC A;  2VJF B;  4A0C D;  3KQI A;  1VD4 A;  5H1U A;  5SVY A;  2L80 A;  3ASL A;  2DX8 A;  2YSM A;  2OWA A;  2ECG A;  3M63 A;  4PPE A;  4XI1 A;  5EYA F;  5G05 B;  2QJ0 A;  4CCG X;  2VPD A;  4UP5 A;  3LQJ A;  1WES A;  2YVR A;  1MM3 A;  4CA1 A;  5J3X A;  3C5K A;  4B7Y C;  4I7D A;  1WEV A;  4NN2 A;  2D8U A;  2L43 A;  3MHS A;  5LKZ A;  3SOW A;  4LAD B;  3ZVY A;  4OGE A;  3HCT A;  2Y1M A;  2HYE D;  4UP0 A;  4WZ3 B;  2KRE A;  4WZ2 A;  4V3K C;  3ZVZ B;  4FO9 A;  4N3W A;  1VFY A;  5LKT A;  1LDJ B;  3O70 A;  2I50 A;  2LXP C;  1JM7 A;  2LXH C;  1JOC A;  5JG6 A;  4L7X A;  5TRB A;  2VNF A;  2AN6 A;  3ZTG A;  4GND A;  4LK9 A;  2YQM A;  3M99 A;  3I2D A;  5SVI B;  2YW8 A;  4F1P A;  2KU3 A;  3N9Q A;  4YAB A;  2RI7 A;  3FAO A;  3O47 A;  4A4B A;  1WEO A;  3E2D A;  5SVI A;  5C13 A;  5B77 A;  2YUC A;  3VK6 A;  2KE1 A;  2YRE A;  2NAA A;  2XOZ A;  2OXQ C;  1VYX A;  4YBT A;  4V3L C;  2FSA A;  3MHH A;  1XWH A;  4S3O B;  5B75 A;  2YQL A;  2G6Q A;  4Z0O A;  2DSM A;  2JM3 A;  3O37 A;  2YUR A;  3DDT A;  3DQV R;  4P5O B;  4AVX A;  4H9D A;  4ZDT A;  2KGI A;  5D1M B;  3O34 A;  2XEU A;  2YT5 A;  2LN0 A;  2F6N A;  2M6M A;  5FEY A;  3NG2 A;  3C6W A;  2FFW A;  5KH7 A;  2EGP A;  5G04 B;  2Y1N A;  3GL6 A;  2H0D A;  3HCS A;  5B79 A;  1WEW A;  2XOC A;  1WIL A;  1FBV A;  5TDW A;  1E4U A;  2HDP A;  4AYC B;  4MSX A;  3ZPV E;  2EGM A;  4FJC A;  2BAY A;  2JMD A;  2YYR A;  3U5P A;  2KFT A;  2KGG A;  2VP7 A;  2G45 A;  4GNF A;  1WEE A;  3M7K A;  2FUI A;  1RMD A;  1WEN A;  2LGL A;  4FK5 A;  3HTK C;  2EA6 A;  1LDK C;  2MNZ A;  2G43 A;  1BOR A;  2CSY A;  1V87 A;  2F42 A;  1ZBD B;  2JRJ A;  3GV4 A;  3KV5 A;  3H7H A;  2ECI A;  4R2Y A;  3ZYQ A;  2EXU A;  2MKE A;  4GNE A;  3SHB A;  3N9M A;  4WA6 A;  1JM7 B;  5C11 A;  4Q6F A;  3O35 A;  2KWJ A;  3O33 A;  4O62 A;  4PTB A;  4WZ0 A;  3L11 A;  2KR4 A;  2IQJ A;  2P57 A;  2KWO A;  3LVQ E;  3MDB C;  3KV6 A;  2YU4 A;  2VPG A;  3Q1D A;  4QQ4 A;  2ECT A;  2K16 A;  4AP4 A;  2PNX A;  2MT5 A;  3SUB A;  2ECJ A;  1WGM A;  4R8P K;  2YSJ A;  3FAN A;  4C9Z A;  3L1Z B;  2CKL B;  2KYU A;  5TBN A;  4YBM A;  4L58 A;  1X4J A;  2XOY A;  2MNY A;  3U5M A;  2CKL A;  3RPG B;  3FEH A;  3JUE A;  4IC2 A;  1WEQ A;  2YHO A;  3DWD A;  5G0F A;  1CHC A;  3FJU B;  1N87 A;  2VJE A;  2VPB A;  4X3G A;  2L7P A;  3N9N A;  3LVR E;  2IDA A;  2UZG A;  2H0D B;  2ZET C;  3DPL R;  4QF2 A;  4B86 C;  1X4U A;  2Y43 A;  2MA5 A;  5D1L B;  1IYM A;  3U5O A;  1WEM A;  3T6R A;  2DJA A;  3T7L A;  4LKA A;  4BHW A;  5B76 A;  4OGC A;  2M1R A;  4S3O C;  3FL2 A;  3LQH A;  3O36 A;  2YHN A;  2K1J A; 
#chains in the Genus database with same CATH homology
 2XOY A;  3FM8 C;  4Z0O A;  2KKY A;  2FD4 A;  2JM3 A;  3M7K A;  4OGE A;  5SVI B;  4F1P A;  2EXU A;  2MKE A;  3DDT A;  3FEH A;  2LAU A;  3JUE A;  3PLW A;  3Q1D A;  5SVY A;  3KDE C;  2M13 A;  4H9D A;  4QQ4 A;  3LDY A;  3O47 A;  2OWA A;  3DWD A;  5SVX A;  2XOC A;  3E2D A;  3FJU B;  5K3Q A;  5SVI A;  2CRR A;  2DJA A;  2YVR A;  3SUB A;  2YRE A;  2CON A;  2RR4 A;  4OGC A;  2CSV A;  2JUN A;  2XOZ A;  3LJU X;  4O62 A;  4Z0R A;  2E61 A;  2KKX A;  2CRW A;  1DCQ A;  2IQJ A;  3T9K A;  2L7P A;  2D8U A;  2B0O E;  2P57 A;  3LVR E;  2XP0 A;  2FFW A;  3LVQ E;  2EGM A;  3MDB C;  3H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...