2FFWA

Solution structure of the rbcc/trim b-box1 domain of human mid1: b-box with a ring
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
78
structure length
78
Chain Sequence
QKASVSGPNSPSETRRERAFDANTMTSAEKVLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Midline-1
publication title Solution Structure of the RBCC/TRIM B-box1 Domain of Human MID1: B-box with a RING.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.90 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2ffwA00
2FFWA
chains in the Genus database with same CATH superfamily
5SVIB 4YATA 1WFKA 3N9LA 5LCWB 3DPLR 4A4BA 2P57A 4BBQA 4CA1A 2JMIA 4Z0RA 3O37A 3SUBA 2KFTA 5TDWA 3SOXA 2MA5A 4W4UA 1WILA 1ZBDB 2LDRA 4B7YC 2IDAA 2LGGA 2F6JA 4LKAA 2LGLA 2VPEA 3N9QA 4GNGA 4R8PK 2VPBA 2LRIC 2LAUA 4A4CA 1JM7B 5TBNA 2DJAA 2ZETC 3KV5A 2CRRA 4GB0A 4AYCA 1WEUA 4QF2A 5H1TA 4I7CA 2ECTA 2RSDA 2FUUA 5B78A 3LDYA 3ZVYA 3PUQA 4V3KC 3T6RA 1CHCA 3C5KA 5G04B 3L1XA 2VP7A 1MM2A 3LRQA 2M85A 3PLWA 2YSJA 2XEUA 2KWJA 2ECJA 2L7PA 4L7XA 5TABA 1MBMA 2YHNA 1BORA 3LVRE 1X4IA 4S3OB 5JG6A 4OGCA 2KR4A 3RPGC 2KGIA 3N9NA 3KV6A 3LVQE 4FO9A 2LGKA 2K16A 4WZ3B 2MNYA 1MM3A 3T9KA 1WENA 4I7DA 4LK9A 2KE1A 2PUYA 2FD4A 2D8UA 2XOZA 3N9MA 3O34A 1Z60A 4PPEA 5H9MA 2CSZA 2OWAA 4GNEA 3O33A 4B86C 4TKPB 2YVRA 2VPGA 3EB5A 3HTKC 1E4UA 3KDEC 5G05B 3DDTA 3ZPV1 4PTBA 2YSMA 3SHBA 4GNFA 2E6SA 2XB1A 4IC2A 1LDKC 4A0CD 3V43A 2L43A 1XWHA 3Q1DA 2YQLA 4Z0OA 2MKEA 3DQVR 3ASLA 3HCUA 2Y1MA 5KH3A 4WZ2A 1DCQA 2KKXA 2UZGA 4Q6FA 4QF3A 4S3OC 2NAAA 2QIZA 1U6GB 1WEMA 2MNZA 3HCSA 2CKLB 3FEHA 4F1PA 3L11A 2HDPA 3RTRB 3T7LA 4IC3A 1WEPA 2CRWA 2KKYA 3HCTA 4X3GA 2M6MA 2VNFA 1WEQA 4ZQLA 2RR4A 5H1VA 1RMDA 4ZDTA 2VJFA 1T1HA 3KQIA 1WIMA 3ZYQA 2K17A 5I3LA 4CCGX 1VFYA 2YU4A 2JMJA 2KWOA 2EGPA 5DKAA 2C2VS 4YBTA 5C11A 4YBMA 3C6WA 3O36A 1WEWA 4UP0A 2C2LA 2VJEA 5SVYA 4AYCB 4AUQB 1HYIA 5K3QA 1WE9A 3FJUB 2LN0A 3MDBC 2MD8C 5AIUA 5FB1A 3L1ZB 2LV9A 4A49A 2H0DA 2YT5A 4FJCA 2QICA 2YQMA 3FAOA 5LKZA 4AVXA 1G25A 2LGVA 2YUCA 5D1KB 3FL2A 2KGGA 2RI7A 1X4UA 2L80A 2K4DA 1F62A 3ZVZB 4XI1A 2KWNA 2CONA 2DX8A 3U5NA 3KNVA 2JMDA 1Z2QA 2XOYA 5DINA 2EODA 1X4JA 4WA6A 4OGEA 2KREA 4P5OB 2FUIA 2I50A 3FM8C 3LJUX 2XOCA 3O7AA 4O64A 4LADB 2FSAA 2FFWA 5KH7A 5SVIA 4FK5A 2KU3A 3JUEA 2ECVA 1DVPA 4MSXA 5SVXA 2KYUA 3VK6A 3U5MA 1K2FA 1WEOA 1WEVA 1WESA 2LXPC 2E61A 3M62A 3LQIA 3O35A 3GL6A 5B8DA 3MHHA 2VPDA 1JM7A 4V3LC 2YYRA 4BHWA 2MD7B 3QZVA 3O47A 3E2DA 5J3XA 3LQHA 4H9DA 1JOCA 2Y43A 2ECIA 4LJNA 2PNXA 5LKUA 3PURA 2G45A 2ECNA 4ZUXU 3EB6A 2OXQC 2YURA 4AP4A 2JRJA 5AITA 4N4FA 2G6QA 4UI9B 2IQJA 2QJ0A 4YABA 4I7BA 2L0BA 2M1RA 3M7KA 3ZNIA 5LKTA 1LDJB 2E6RA 3IHPA 4L58A 1Z6UA 2XP0A 2AN6A 2EXUA 4QQ4A 3PHDA 2M3HA 2KWKA 3M63A 5FB0A 1VD4A 4YBSA 5KH9A 5G0FA 2K1JA 2YW8A 2G43A 2MIQA 3SOWA 5D1LB 4WZ0A 3U5PA 2MT5A 5TRBA 1WEEA 3SOUA 2ECGA 2JUNA 2LQ6A 4N3WA 2HYED 5FEYA 3DWDA 1HYJA 5EYAF 1FP0A 4LLBA 3H7HA 2L5UA 4C9ZA 2VJFB 1N87A 1V87A 3LQJA 3O70A 4F52B 3ZTGA 3MHSA 4GNDA 2BAYA 3M99A 2ECWA 2F6NA 3N9OA 2L75A 5B79A 2CT2A 5B76A 2VJEB 2LXHC 4R7EA 1IYMA 5D1MB 2DSMA 4FIPA 2H0DB 2MA6A 3ZPVE 1FBVA 2Y1NA 3FANA 2MUMA 2F42A 2YHOA 5B77A 4YC9A 4YAXA 2JM3A 4YADA 2D8SA 2M13A 5TDRA 3RPGB 3GV4A 2B0OE 4UP5A 3I2DA 2EGMA 2YREA 2CKLA 5H1UA 3U5OA 5LKXA 5B75A 2CSVA 5FERA 1VYXA 3NG2A 2KIZA 3N9PA 5C13A 4MVTA 1WGMA 2EA6A 2CSYA 4NN2A 4O62A 4R2YA
chains in the Genus database with same CATH topology
5SVIB 3H7HA 4F1PA 2XP0A 2EXUA 3Q1DA 4QQ4A 3KDEC 2M13A 2E61A 2MKEA 4Z0OA 2FD4A 3FM8C 3LJUX 2XOCA 2P57A 2D8UA 2XOZA 3DDTA 3LVRE 2CRWA 2IQJA 4Z0RA 2B0OE 3LDYA 2KKYA 3SUBA 2EGMA 2YREA 4OGCA 2FFWA 1DCQA 2KKXA 3O47A 2OWAA 5SVIA 2RR4A 3E2DA 2CSVA 5SVYA 5K3QA 3M7KA 4H9DA 3JUEA 3LVQE 3PLWA 5SVXA 3FJUB 2CONA 3MDBC 2JUNA 2LAUA 2XOYA 2YVRA 3T9KA 4O62A 3DWDA 4OGEA 2L7PA 2DJAA 2CRRA 3FEHA 2JM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFW A; 
#chains in the Genus database with same CATH topology
 5SVI B;  4YAT A;  1WFK A;  3N9L A;  5LCW B;  3DPL R;  4A4B A;  2P57 A;  4BBQ A;  4CA1 A;  2JMI A;  4Z0R A;  3O37 A;  3SUB A;  2KFT A;  5TDW A;  3SOX A;  2MA5 A;  4W4U A;  1WIL A;  1ZBD B;  2LDR A;  4B7Y C;  2IDA A;  2LGG A;  2F6J A;  4LKA A;  2LGL A;  2VPE A;  3N9Q A;  4GNG A;  4R8P K;  2VPB A;  2LRI C;  2LAU A;  4A4C A;  1JM7 B;  5TBN A;  2DJA A;  2ZET C;  3KV5 A;  2CRR A;  4GB0 A;  4AYC A;  1WEU A;  4QF2 A;  5H1T A;  4I7C A;  2ECT A;  2RSD A;  2FUU A;  5B78 A;  3LDY A;  3ZVY A;  3PUQ A;  4V3K C;  3T6R A;  1CHC A;  3C5K A;  5G04 B;  3L1X A;  2VP7 A;  1MM2 A;  3LRQ A;  2M85 A;  3PLW A;  2YSJ A;  2XEU A;  2KWJ A;  2ECJ A;  2L7P A;  4L7X A;  5TAB A;  1MBM A;  2YHN A;  1BOR A;  3LVR E;  1X4I A;  4S3O B;  5JG6 A;  4OGC A;  2KR4 A;  3RPG C;  2KGI A;  3N9N A;  3KV6 A;  3LVQ E;  4FO9 A;  2LGK A;  2K16 A;  4WZ3 B;  2MNY A;  1MM3 A;  3T9K A;  1WEN A;  4I7D A;  4LK9 A;  2KE1 A;  2PUY A;  2FD4 A;  2D8U A;  2XOZ A;  3N9M A;  3O34 A;  1Z60 A;  4PPE A;  5H9M A;  2CSZ A;  2OWA A;  4GNE A;  3O33 A;  4B86 C;  4TKP B;  2YVR A;  2VPG A;  3EB5 A;  3HTK C;  1E4U A;  3KDE C;  5G05 B;  3DDT A;  3ZPV 1;  4PTB A;  2YSM A;  3SHB A;  4GNF A;  2E6S A;  2XB1 A;  4IC2 A;  1LDK C;  4A0C D;  3V43 A;  2L43 A;  1XWH A;  3Q1D A;  2YQL A;  4Z0O A;  2MKE A;  3DQV R;  3ASL A;  3HCU A;  2Y1M A;  5KH3 A;  4WZ2 A;  1DCQ A;  2KKX A;  2UZG A;  4Q6F A;  4QF3 A;  4S3O C;  2NAA A;  2QIZ A;  1U6G B;  1WEM A;  2MNZ A;  3HCS A;  2CKL B;  3FEH A;  4F1P A;  3L11 A;  2HDP A;  3RTR B;  3T7L A;  4IC3 A;  1WEP A;  2CRW A;  2KKY A;  3HCT A;  4X3G A;  2M6M A;  2VNF A;  1WEQ A;  4ZQL A;  2RR4 A;  5H1V A;  1RMD A;  4ZDT A;  2VJF A;  1T1H A;  3KQI A;  1WIM A;  3ZYQ A;  2K17 A;  5I3L A;  4CCG X;  1VFY A;  2YU4 A;  2JMJ A;  2KWO A;  2EGP A;  5DKA A;  2C2V S;  4YBT A;  5C11 A;  4YBM A;  3C6W A;  3O36 A;  1WEW A;  4UP0 A;  2C2L A;  2VJE A;  5SVY A;  4AYC B;  4AUQ B;  1HYI A;  5K3Q A;  1WE9 A;  3FJU B;  2LN0 A;  3MDB C;  2MD8 C;  5AIU A;  5FB1 A;  3L1Z B;  2LV9 A;  4A49 A;  2H0D A;  2YT5 A;  4FJC A;  2QIC A;  2YQM A;  3FAO A;  5LKZ A;  4AVX A;  1G25 A;  2LGV A;  2YUC A;  5D1K B;  3FL2 A;  2KGG A;  2RI7 A;  1X4U A;  2L80 A;  2K4D A;  1F62 A;  3ZVZ B;  4XI1 A;  2KWN A;  2CON A;  2DX8 A;  3U5N A;  3KNV A;  2JMD A;  1Z2Q A;  2XOY A;  5DIN A;  2EOD A;  1X4J A;  4WA6 A;  4OGE A;  2KRE A;  4P5O B;  2FUI A;  2I50 A;  3FM8 C;  3LJU X;  2XOC A;  3O7A A;  4O64 A;  4LAD B;  2FSA A;  2FFW A;  5KH7 A;  5SVI A;  4FK5 A;  2KU3 A;  3JUE A;  2ECV A;  1DVP A;  4MSX A;  5SVX A;  2KYU A;  3VK6 A;  3U5M A;  1K2F A;  1WEO A;  1WEV A;  1WES A;  2LXP C;  2E61 A;  3M62 A;  3LQI A;  3O35 A;  3GL6 A;  5B8D A;  3MHH A;  2VPD A;  1JM7 A;  4V3L C;  2YYR A;  4BHW A;  2MD7 B;  3QZV A;  3O47 A;  3E2D A;  5J3X A;  3LQH A;  4H9D A;  1JOC A;  2Y43 A;  2ECI A;  4LJN A;  2PNX A;  5LKU A;  3PUR A;  2G45 A;  2ECN A;  4ZUX U;  3EB6 A;  2OXQ C;  2YUR A;  4AP4 A;  2JRJ A;  5AIT A;  4N4F A;  2G6Q A;  4UI9 B;  2IQJ A;  2QJ0 A;  4YAB A;  4I7B A;  2L0B A;  2M1R A;  3M7K A;  3ZNI A;  5LKT A;  1LDJ B;  2E6R A;  3IHP A;  4L58 A;  1Z6U A;  2XP0 A;  2AN6 A;  2EXU A;  4QQ4 A;  3PHD A;  2M3H A;  2KWK A;  3M63 A;  5FB0 A;  1VD4 A;  4YBS A;  5KH9 A;  5G0F A;  2K1J A;  2YW8 A;  2G43 A;  2MIQ A;  3SOW A;  5D1L B;  4WZ0 A;  3U5P A;  2MT5 A;  5TRB A;  1WEE A;  3SOU A;  2ECG A;  2JUN A;  2LQ6 A;  4N3W A;  2HYE D;  5FEY A;  3DWD A;  1HYJ A;  5EYA F;  1FP0 A;  4LLB A;  3H7H A;  2L5U A;  4C9Z A;  2VJF B;  1N87 A;  1V87 A;  3LQJ A;  3O70 A;  4F52 B;  3ZTG A;  3MHS A;  4GND A;  2BAY A;  3M99 A;  2ECW A;  2F6N A;  3N9O A;  2L75 A;  5B79 A;  2CT2 A;  5B76 A;  2VJE B;  2LXH C;  4R7E A;  1IYM A;  5D1M B;  2DSM A;  4FIP A;  2H0D B;  2MA6 A;  3ZPV E;  1FBV A;  2Y1N A;  3FAN A;  2MUM A;  2F42 A;  2YHO A;  5B77 A;  4YC9 A;  4YAX A;  2JM3 A;  4YAD A;  2D8S A;  2M13 A;  5TDR A;  3RPG B;  3GV4 A;  2B0O E;  4UP5 A;  3I2D A;  2EGM A;  2YRE A;  2CKL A;  5H1U A;  3U5O A;  5LKX A;  5B75 A;  2CSV A;  5FER A;  1VYX A;  3NG2 A;  2KIZ A;  3N9P A;  5C13 A;  4MVT A;  1WGM A;  2EA6 A;  2CSY A;  4NN2 A;  4O62 A;  4R2Y A; 
#chains in the Genus database with same CATH homology
 5SVI B;  3H7H A;  4F1P A;  2XP0 A;  2EXU A;  3Q1D A;  4QQ4 A;  3KDE C;  2M13 A;  2E61 A;  2MKE A;  4Z0O A;  2FD4 A;  3FM8 C;  3LJU X;  2XOC A;  2P57 A;  2D8U A;  2XOZ A;  3DDT A;  3LVR E;  2CRW A;  2IQJ A;  4Z0R A;  2B0O E;  3LDY A;  2KKY A;  3SUB A;  2EGM A;  2YRE A;  4OGC A;  2FFW A;  1DCQ A;  2KKX A;  3O47 A;  2OWA A;  5SVI A;  2RR4 A;  3E2D A;  2CSV A;  5SVY A;  5K3Q A;  3M7K A;  4H9D A;  3JUE A;  3LVQ E;  3PLW A;  5SVX A;  3FJU B;  2CON A;  3MDB C;  2JUN A;  2LAU A;  2XOY A;  2YVR A;  3T9K A;  4O62 A;  3DWD A;  4OGE A;  2L7P A;  2DJA A;  2CRR A;  3FEH A;  2JM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...