2LXHC

Nmr structure of the ring domain in ubiquitin ligase gp78
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
58
structure length
58
Chain Sequence
AVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase AMFR
publication title Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 58
sequence length 58
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lxhC00
4N3WA 4L58A 1DVPA 2HYED 2F42A 2MT5A 1IYMA 1U6GB 2FUIA 1WEUA 3O33A 1X4JA 4ZDTA 4ZQLA 2ZETC 2G45A 2Y1NA 3U5OA 5D1MB 2ECJA 3HCSA 2C2VS 2LN0A 2M85A 1MM3A 3EB5A 2VJEA 4A4CA 4C9ZA 2E6RA 3LQIA 3FL2A 5LCWB 3N9NA 3ASLA 3KQIA 5B8DA 1WEPA 4NN2A 5G05B 3ZVYA 4R2YA 2C2LA 3N9PA 2CKLB 2E6SA 4B7YC 1E4UA 3LRQA 2YREA 4MVTA 2LV9A 1WESA 4YBTA 4P5OB 3ZPV1 4QF3A 5B77A 1WFKA 2K17A 4CA1A 5EYAF 3M99A 3KV5A 4YADA 3VK6A 2KWOA 5D1KB 4AYCA 5H1UA 5DKAA 4BHWA 3IHPA 2JMJA 2LGVA 1CHCA 3M63A 3QZVA 2YYRA 2F6JA 3L11A 3ZYQA 3MHSA 5C13A 3DPLR 2QICA 1Z6UA 2MD8C 3SOXA 2XEUA 4YBMA 5I3LA 2AN6A 3M62A 4V3LC 1WEOA 2G6QA 4GNFA 2FUUA 3MHHA 1WIMA 1JM7B 4R7EA 2LXHC 1WEMA 2KU3A 3NG2A 2KIZA 4LJNA 3C5KA 3N9LA 2EODA 4I7CA 5AIUA 4LK9A 3L1ZB 2YSJA 2M6MA 2YURA 1VD4A 4A0CD 5TDWA 2LGKA 3LQJA 2YHNA 3RTRB 2F6NA 5G04B 2MA6A 2XB1A 3HCUA 4AP4A 5TBNA 3O7AA 2KREA 2MA5A 2YHOA 1FBVA 2NAAA 2KFTA 2H0DA 3O37A 3ZPVE 5B78A 5FB0A 4CCGX 2Y43A 4FIPA 4YAXA 5LKTA 3LQHA 2PUYA 1WILA 1X4UA 3RPGC 2EGPA 3HTKC 1F62A 4PPEA 1HYJA 4XI1A 1WE9A 5KH3A 2RI7A 2L0BA 2VJEB 4FK5A 4TKPB 2LQ6A 2YQLA 2LGGA 4BBQA 3ZNIA 3N9QA 2L43A 2ECWA 4AUQB 2VNFA 3N9MA 4R8PK 3I2DA 2MNZA 2QIZA 4IC3A 1VFYA 2UZGA 4FO9A 4UI9B 1HYIA 2KWKA 4LLBA 2D8SA 2LGLA 2ECTA 3V43A 2ECGA 5H1TA 2HDPA 4WZ2A 2JMIA 4L7XA 3EB6A 2K16A 2ECIA 1V87A 2YQMA 4YABA 4O64A 1WENA 1WEEA 4AYCB 3U5PA 2YW8A 2MIQA 3U5NA 4YBSA 4PTBA 2VJFA 2ECVA 2L75A 2DX8A 2MD7B 5H1VA 5B75A 2L80A 3PHDA 1VYXA 2YT5A 5FERA 2JMDA 1WEWA 2RSDA 5FEYA 2EA6A 3ZVZB 3PUQA 4QF2A 4GB0A 5B76A 4UP5A 4Q6FA 4YC9A 3L1XA 1XWHA 5D1LB 5LKXA 3GV4A 2JRJA 2ECNA 2YSMA 4WZ3B 4S3OC 4A4BA 4FJCA 4LKAA 4V3KC 2VPBA 4W4UA 5FB1A 2FSAA 2L5UA 5B79A 1BORA 2K1JA 2OXQC 3O35A 5KH9A 5TRBA 3U5MA 1Z60A 4GNDA 2M3HA 4AVXA 1N87A 3SOWA 2H0DB 2QJ0A 1Z2QA 2I50A 1G25A 2PNXA 1WEVA 4I7DA 3O36A 2VPDA 2CSYA 4MSXA 3SHBA 2KWNA 4F52B 2CKLA 3KV6A 4ZUXU 3O70A 5C11A 4S3OB 2YUCA 4A49A 5G0FA 1MM2A 4N4FA 3PURA 1K2FA 5JG6A 4WA6A 3O34A 5LKUA 1T1HA 3T6RA 1X4IA 5KH7A 2YU4A 1RMDA 2G43A 2KGIA 2VPEA 2BAYA 2LRIC 3HCTA 5LKZA 1ZBDB 3N9OA 4I7BA 2M1RA 4B86C 2CT2A 1WEQA 4YATA 3DQVR 3C6WA 4UP0A 3T7LA 5AITA 2LXPC 3KNVA 4X3GA 1WGMA 1LDKC 3RPGB 3ZTGA 2K4DA 2KWJA 3SOUA 1JM7A 5TDRA 2KE1A 2LDRA 1FP0A 4GNGA 2Y1MA 5DINA 2VJFB 2KYUA 4LADB 5J3XA 2VPGA 1LDJB 2KGGA 2CSZA 1JOCA 5TABA 5H9MA 2MUMA 4GNEA 4WZ0A 4IC2A 3GL6A 2VP7A 2KR4A 2IDAA 2MNYA
chains in the Genus database with same CATH superfamily
3PLWA 4N3WA 4L58A 1DVPA 2HYED 2F42A 2MT5A 4OGCA 5SVXA 1IYMA 1U6GB 2FUIA 2JM3A 2YVRA 1WEUA 3O33A 1X4JA 4ZDTA 4ZQLA 5SVIA 2ZETC 2CRRA 2G45A 2Y1NA 3U5OA 5D1MB 2ECJA 3HCSA 2C2VS 2LN0A 2M85A 1MM3A 2EXUA 3EB5A 2VJEA 5SVIB 4A4CA 4C9ZA 2E6RA 3LQIA 3FL2A 5LCWB 2IQJA 3N9NA 3ASLA 3KQIA 5B8DA 1WEPA 4NN2A 5G05B 3ZVYA 2JUNA 2CSVA 4R2YA 2C2LA 3N9PA 2CKLB 2E6SA 4B7YC 1E4UA 3LRQA 2YREA 4MVTA 2FFWA 2LV9A 1WESA 4YBTA 4P5OB 3ZPV1 4QF3A 5B77A 1WFKA 2K17A 4Z0OA 3FM8C 4CA1A 3KDEC 2P57A 5EYAF 3M99A 3FJUB 3KV5A 4YADA 3VK6A 2KWOA 5D1KB 4AYCA 5H1UA 5DKAA 2D8UA 4BHWA 3IHPA 2JMJA 2LGVA 1CHCA 3M63A 3QZVA 2YYRA 2F6JA 3L11A 3ZYQA 1MBMA 3MHSA 5C13A 3DPLR 2QICA 1Z6UA 2MD8C 3SOXA 2XEUA 5K3QA 4YBMA 5I3LA 2AN6A 3M62A 4V3LC 4Z0RA 1WEOA 2G6QA 3LVRE 4GNFA 2FUUA 5SVYA 3MHHA 2KKXA 1WIMA 1JM7B 4R7EA 2LXHC 1WEMA 2KU3A 3NG2A 2KIZA 4LJNA 3C5KA 3N9LA 2EODA 4I7CA 5AIUA 4LK9A 3L1ZB 2YSJA 2M6MA 2YURA 1VD4A 2M13A 4A0CD 5TDWA 2LGKA 3LQJA 2XOCA 2YHNA 3RTRB 2F6NA 5G04B 2MA6A 2XB1A 3HCUA 4AP4A 5TBNA 3O7AA 2KREA 2MA5A 2YHOA 1FBVA 2NAAA 3Q1DA 2KFTA 2H0DA 3O37A 2CRWA 2EGMA 3ZPVE 5B78A 5FB0A 4CCGX 2Y43A 4FIPA 4YAXA 5LKTA 3LQHA 2PUYA 1WILA 1X4UA 3RPGC 2EGPA 3HTKC 3M7KA 4H9DA 4PPEA 1F62A 1HYJA 4XI1A 1WE9A 3MDBC 5KH3A 2RI7A 2L0BA 2VJEB 2KKYA 4FK5A 4TKPB 2LQ6A 2LAUA 3JUEA 2YQLA 2LGGA 4BBQA 3ZNIA 3N9QA 2L43A 2ECWA 3H7HA 4AUQB 2VNFA 3N9MA 4R8PK 3I2DA 1DCQA 2MNZA 2QIZA 4IC3A 1VFYA 2UZGA 4FO9A 4UI9B 1HYIA 2KWKA 4LLBA 2D8SA 2LGLA 2XP0A 2ECTA 3V43A 2ECGA 2DSMA 5H1TA 2HDPA 2OWAA 4WZ2A 2JMIA 4L7XA 3EB6A 2K16A 2ECIA 1V87A 2YQMA 4YABA 2E61A 2MKEA 4O64A 1WENA 1WEEA 4AYCB 3U5PA 2YW8A 2MIQA 3U5NA 4YBSA 4PTBA 2VJFA 2ECVA 2CONA 2L75A 2DX8A 2MD7B 5H1VA 5B75A 2L80A 3PHDA 2B0OE 1VYXA 2YT5A 5FERA 2JMDA 1WEWA 2RSDA 5FEYA 2EA6A 3ZVZB 3PUQA 4QF2A 4GB0A 5B76A 4F1PA 4UP5A 4Q6FA 4YC9A 3L1XA 1XWHA 5D1LB 5LKXA 3GV4A 4OGEA 2JRJA 2ECNA 2YSMA 4WZ3B 4S3OC 4A4BA 3DDTA 4FJCA 4O62A 4LKAA 4V3KC 2VPBA 4W4UA 5FB1A 3LJUX 2FSAA 3E2DA 2L5UA 2DJAA 5B79A 1BORA 2K1JA 2FD4A 2OXQC 3O35A 5KH9A 3FEHA 5TRBA 3U5MA 1Z60A 4GNDA 2M3HA 3LDYA 4AVXA 1N87A 3SOWA 3SUBA 2H0DB 2QJ0A 1Z2QA 2I50A 1G25A 2PNXA 3DWDA 1WEVA 4I7DA 3O36A 2VPDA 2CSYA 4MSXA 2XOZA 2KWNA 3SHBA 4F52B 2CKLA 3KV6A 4ZUXU 3O70A 5C11A 4S3OB 2YUCA 4A49A 5G0FA 1MM2A 4N4FA 3PURA 1K2FA 5JG6A 4WA6A 3O34A 5LKUA 1T1HA 3T6RA 1X4IA 5KH7A 2YU4A 1RMDA 2G43A 2KGIA 2VPEA 2BAYA 2LRIC 3HCTA 5LKZA 1ZBDB 3N9OA 4I7BA 2M1RA 4B86C 2CT2A 1WEQA 3LVQE 4YATA 3DQVR 3C6WA 4UP0A 3T7LA 5AITA 2LXPC 3KNVA 4X3GA 1WGMA 3O47A 1LDKC 3RPGB 3ZTGA 2K4DA 2KWJA 3SOUA 1JM7A 5TDRA 2KE1A 2LDRA 3T9KA 1FP0A 4GNGA 2Y1MA 5DINA 2VJFB 3FAOA 2KYUA 4LADB 5J3XA 2XOYA 2L7PA 2VPGA 1LDJB 3FANA 2RR4A 2KGGA 2CSZA 1JOCA 5TABA 5H9MA 2MUMA 4GNEA 4QQ4A 4WZ0A 4IC2A 3GL6A 2VP7A 2KR4A 2IDAA 2MNYA
chains in the Genus database with same CATH topology
4N3WA 4L58A 1DVPA 2HYED 2F42A 2MT5A 1IYMA 1U6GB 2FUIA 1WEUA 3O33A 1X4JA 4ZDTA 4ZQLA 2ZETC 2G45A 2Y1NA 3U5OA 5D1MB 2ECJA 3HCSA 2C2VS 2LN0A 2M85A 1MM3A 3EB5A 2VJEA 4A4CA 4C9ZA 2E6RA 3LQIA 3FL2A 5LCWB 3N9NA 3ASLA 3KQIA 5B8DA 1WEPA 4NN2A 5G05B 3ZVYA 4R2YA 2C2LA 3N9PA 2CKLB 2E6SA 4B7YC 1E4UA 3LRQA 2YREA 4MVTA 2LV9A 1WESA 4YBTA 4P5OB 3ZPV1 4QF3A 5B77A 1WFKA 2K17A 4CA1A 5EYAF 3M99A 3KV5A 4YADA 3VK6A 2KWOA 5D1KB 4AYCA 5H1UA 5DKAA 4BHWA 3IHPA 2JMJA 2LGVA 1CHCA 3M63A 3QZVA 2YYRA 2F6JA 3L11A 3ZYQA 3MHSA 5C13A 3DPLR 2QICA 1Z6UA 2MD8C 3SOXA 2XEUA 4YBMA 5I3LA 2AN6A 3M62A 4V3LC 1WEOA 2G6QA 4GNFA 2FUUA 3MHHA 1WIMA 1JM7B 4R7EA 2LXHC 1WEMA 2KU3A 3NG2A 2KIZA 4LJNA 3C5KA 3N9LA 2EODA 4I7CA 5AIUA 4LK9A 3L1ZB 2YSJA 2M6MA 2YURA 1VD4A 4A0CD 5TDWA 2LGKA 3LQJA 2YHNA 3RTRB 2F6NA 5G04B 2MA6A 2XB1A 3HCUA 4AP4A 5TBNA 3O7AA 2KREA 2MA5A 2YHOA 1FBVA 2NAAA 2KFTA 2H0DA 3O37A 3ZPVE 5B78A 5FB0A 4CCGX 2Y43A 4FIPA 4YAXA 5LKTA 3LQHA 2PUYA 1WILA 1X4UA 3RPGC 2EGPA 3HTKC 1F62A 4PPEA 1HYJA 4XI1A 1WE9A 5KH3A 2RI7A 2L0BA 2VJEB 4FK5A 4TKPB 2LQ6A 2YQLA 2LGGA 4BBQA 3ZNIA 3N9QA 2L43A 2ECWA 4AUQB 2VNFA 3N9MA 4R8PK 3I2DA 2MNZA 2QIZA 4IC3A 1VFYA 2UZGA 4FO9A 4UI9B 1HYIA 2KWKA 4LLBA 2D8SA 2LGLA 2ECTA 3V43A 2ECGA 5H1TA 2HDPA 4WZ2A 2JMIA 4L7XA 3EB6A 2K16A 2ECIA 1V87A 2YQMA 4YABA 4O64A 1WENA 1WEEA 4AYCB 3U5PA 2YW8A 2MIQA 3U5NA 4YBSA 4PTBA 2VJFA 2ECVA 2L75A 2DX8A 2MD7B 5H1VA 5B75A 2L80A 3PHDA 1VYXA 2YT5A 5FERA 2JMDA 1WEWA 2RSDA 5FEYA 2EA6A 3ZVZB 3PUQA 4QF2A 4GB0A 5B76A 4UP5A 4Q6FA 4YC9A 3L1XA 1XWHA 5D1LB 5LKXA 3GV4A 2JRJA 2ECNA 2YSMA 4WZ3B 4S3OC 4A4BA 4FJCA 4LKAA 4V3KC 2VPBA 4W4UA 5FB1A 2FSAA 2L5UA 5B79A 1BORA 2K1JA 2OXQC 3O35A 5KH9A 5TRBA 3U5MA 1Z60A 4GNDA 2M3HA 4AVXA 1N87A 3SOWA 2H0DB 2QJ0A 1Z2QA 2I50A 1G25A 2PNXA 1WEVA 4I7DA 3O36A 2VPDA 2CSYA 4MSXA 3SHBA 2KWNA 4F52B 2CKLA 3KV6A 4ZUXU 3O70A 5C11A 4S3OB 2YUCA 4A49A 5G0FA 1MM2A 4N4FA 3PURA 1K2FA 5JG6A 4WA6A 3O34A 5LKUA 1T1HA 3T6RA 1X4IA 5KH7A 2YU4A 1RMDA 2G43A 2KGIA 2VPEA 2BAYA 2LRIC 3HCTA 5LKZA 1ZBDB 3N9OA 4I7BA 2M1RA 4B86C 2CT2A 1WEQA 4YATA 3DQVR 3C6WA 4UP0A 3T7LA 5AITA 2LXPC 3KNVA 4X3GA 1WGMA 1LDKC 3RPGB 3ZTGA 2K4DA 2KWJA 3SOUA 1JM7A 5TDRA 2KE1A 2LDRA 1FP0A 4GNGA 2Y1MA 5DINA 2VJFB 2KYUA 4LADB 5J3XA 2VPGA 1LDJB 2KGGA 2CSZA 1JOCA 5TABA 5H9MA 2MUMA 4GNEA 4WZ0A 4IC2A 3GL6A 2VP7A 2KR4A 2IDAA 2MNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3W A;  4L58 A;  1DVP A;  2HYE D;  2F42 A;  2MT5 A;  1IYM A;  1U6G B;  2FUI A;  1WEU A;  3O33 A;  1X4J A;  4ZDT A;  4ZQL A;  2ZET C;  2G45 A;  2Y1N A;  3U5O A;  5D1M B;  2ECJ A;  3HCS A;  2C2V S;  2LN0 A;  2M85 A;  1MM3 A;  3EB5 A;  2VJE A;  4A4C A;  4C9Z A;  2E6R A;  3LQI A;  3FL2 A;  5LCW B;  3N9N A;  3ASL A;  3KQI A;  5B8D A;  1WEP A;  4NN2 A;  5G05 B;  3ZVY A;  4R2Y A;  2C2L A;  3N9P A;  2CKL B;  2E6S A;  4B7Y C;  1E4U A;  3LRQ A;  2YRE A;  4MVT A;  2LV9 A;  1WES A;  4YBT A;  4P5O B;  3ZPV 1;  4QF3 A;  5B77 A;  1WFK A;  2K17 A;  4CA1 A;  5EYA F;  3M99 A;  3KV5 A;  4YAD A;  3VK6 A;  2KWO A;  5D1K B;  4AYC A;  5H1U A;  5DKA A;  4BHW A;  3IHP A;  2JMJ A;  2LGV A;  1CHC A;  3M63 A;  3QZV A;  2YYR A;  2F6J A;  3L11 A;  3ZYQ A;  3MHS A;  5C13 A;  3DPL R;  2QIC A;  1Z6U A;  2MD8 C;  3SOX A;  2XEU A;  4YBM A;  5I3L A;  2AN6 A;  3M62 A;  4V3L C;  1WEO A;  2G6Q A;  4GNF A;  2FUU A;  3MHH A;  1WIM A;  1JM7 B;  4R7E A;  2LXH C;  1WEM A;  2KU3 A;  3NG2 A;  2KIZ A;  4LJN A;  3C5K A;  3N9L A;  2EOD A;  4I7C A;  5AIU A;  4LK9 A;  3L1Z B;  2YSJ A;  2M6M A;  2YUR A;  1VD4 A;  4A0C D;  5TDW A;  2LGK A;  3LQJ A;  2YHN A;  3RTR B;  2F6N A;  5G04 B;  2MA6 A;  2XB1 A;  3HCU A;  4AP4 A;  5TBN A;  3O7A A;  2KRE A;  2MA5 A;  2YHO A;  1FBV A;  2NAA A;  2KFT A;  2H0D A;  3O37 A;  3ZPV E;  5B78 A;  5FB0 A;  4CCG X;  2Y43 A;  4FIP A;  4YAX A;  5LKT A;  3LQH A;  2PUY A;  1WIL A;  1X4U A;  3RPG C;  2EGP A;  3HTK C;  1F62 A;  4PPE A;  1HYJ A;  4XI1 A;  1WE9 A;  5KH3 A;  2RI7 A;  2L0B A;  2VJE B;  4FK5 A;  4TKP B;  2LQ6 A;  2YQL A;  2LGG A;  4BBQ A;  3ZNI A;  3N9Q A;  2L43 A;  2ECW A;  4AUQ B;  2VNF A;  3N9M A;  4R8P K;  3I2D A;  2MNZ A;  2QIZ A;  4IC3 A;  1VFY A;  2UZG A;  4FO9 A;  4UI9 B;  1HYI A;  2KWK A;  4LLB A;  2D8S A;  2LGL A;  2ECT A;  3V43 A;  2ECG A;  5H1T A;  2HDP A;  4WZ2 A;  2JMI A;  4L7X A;  3EB6 A;  2K16 A;  2ECI A;  1V87 A;  2YQM A;  4YAB A;  4O64 A;  1WEN A;  1WEE A;  4AYC B;  3U5P A;  2YW8 A;  2MIQ A;  3U5N A;  4YBS A;  4PTB A;  2VJF A;  2ECV A;  2L75 A;  2DX8 A;  2MD7 B;  5H1V A;  5B75 A;  2L80 A;  3PHD A;  1VYX A;  2YT5 A;  5FER A;  2JMD A;  1WEW A;  2RSD A;  5FEY A;  2EA6 A;  3ZVZ B;  3PUQ A;  4QF2 A;  4GB0 A;  5B76 A;  4UP5 A;  4Q6F A;  4YC9 A;  3L1X A;  1XWH A;  5D1L B;  5LKX A;  3GV4 A;  2JRJ A;  2ECN A;  2YSM A;  4WZ3 B;  4S3O C;  4A4B A;  4FJC A;  4LKA A;  4V3K C;  2VPB A;  4W4U A;  5FB1 A;  2FSA A;  2L5U A;  5B79 A;  1BOR A;  2K1J A;  2OXQ C;  3O35 A;  5KH9 A;  5TRB A;  3U5M A;  1Z60 A;  4GND A;  2M3H A;  4AVX A;  1N87 A;  3SOW A;  2H0D B;  2QJ0 A;  1Z2Q A;  2I50 A;  1G25 A;  2PNX A;  1WEV A;  4I7D A;  3O36 A;  2VPD A;  2CSY A;  4MSX A;  3SHB A;  2KWN A;  4F52 B;  2CKL A;  3KV6 A;  4ZUX U;  3O70 A;  5C11 A;  4S3O B;  2YUC A;  4A49 A;  5G0F A;  1MM2 A;  4N4F A;  3PUR A;  1K2F A;  5JG6 A;  4WA6 A;  3O34 A;  5LKU A;  1T1H A;  3T6R A;  1X4I A;  5KH7 A;  2YU4 A;  1RMD A;  2G43 A;  2KGI A;  2VPE A;  2BAY A;  2LRI C;  3HCT A;  5LKZ A;  1ZBD B;  3N9O A;  4I7B A;  2M1R A;  4B86 C;  2CT2 A;  1WEQ A;  4YAT A;  3DQV R;  3C6W A;  4UP0 A;  3T7L A;  5AIT A;  2LXP C;  3KNV A;  4X3G A;  1WGM A;  1LDK C;  3RPG B;  3ZTG A;  2K4D A;  2KWJ A;  3SOU A;  1JM7 A;  5TDR A;  2KE1 A;  2LDR A;  1FP0 A;  4GNG A;  2Y1M A;  5DIN A;  2VJF B;  2KYU A;  4LAD B;  5J3X A;  2VPG A;  1LDJ B;  2KGG A;  2CSZ A;  1JOC A;  5TAB A;  5H9M A;  2MUM A;  4GNE A;  4WZ0 A;  4IC2 A;  3GL6 A;  2VP7 A;  2KR4 A;  2IDA A;  2MNY A; 
#chains in the Genus database with same CATH topology
 3PLW A;  4N3W A;  4L58 A;  1DVP A;  2HYE D;  2F42 A;  2MT5 A;  4OGC A;  5SVX A;  1IYM A;  1U6G B;  2FUI A;  2JM3 A;  2YVR A;  1WEU A;  3O33 A;  1X4J A;  4ZDT A;  4ZQL A;  5SVI A;  2ZET C;  2CRR A;  2G45 A;  2Y1N A;  3U5O A;  5D1M B;  2ECJ A;  3HCS A;  2C2V S;  2LN0 A;  2M85 A;  1MM3 A;  2EXU A;  3EB5 A;  2VJE A;  5SVI B;  4A4C A;  4C9Z A;  2E6R A;  3LQI A;  3FL2 A;  5LCW B;  2IQJ A;  3N9N A;  3ASL A;  3KQI A;  5B8D A;  1WEP A;  4NN2 A;  5G05 B;  3ZVY A;  2JUN A;  2CSV A;  4R2Y A;  2C2L A;  3N9P A;  2CKL B;  2E6S A;  4B7Y C;  1E4U A;  3LRQ A;  2YRE A;  4MVT A;  2FFW A;  2LV9 A;  1WES A;  4YBT A;  4P5O B;  3ZPV 1;  4QF3 A;  5B77 A;  1WFK A;  2K17 A;  4Z0O A;  3FM8 C;  4CA1 A;  3KDE C;  2P57 A;  5EYA F;  3M99 A;  3FJU B;  3KV5 A;  4YAD A;  3VK6 A;  2KWO A;  5D1K B;  4AYC A;  5H1U A;  5DKA A;  2D8U A;  4BHW A;  3IHP A;  2JMJ A;  2LGV A;  1CHC A;  3M63 A;  3QZV A;  2YYR A;  2F6J A;  3L11 A;  3ZYQ A;  1MBM A;  3MHS A;  5C13 A;  3DPL R;  2QIC A;  1Z6U A;  2MD8 C;  3SOX A;  2XEU A;  5K3Q A;  4YBM A;  5I3L A;  2AN6 A;  3M62 A;  4V3L C;  4Z0R A;  1WEO A;  2G6Q A;  3LVR E;  4GNF A;  2FUU A;  5SVY A;  3MHH A;  2KKX A;  1WIM A;  1JM7 B;  4R7E A;  2LXH C;  1WEM A;  2KU3 A;  3NG2 A;  2KIZ A;  4LJN A;  3C5K A;  3N9L A;  2EOD A;  4I7C A;  5AIU A;  4LK9 A;  3L1Z B;  2YSJ A;  2M6M A;  2YUR A;  1VD4 A;  2M13 A;  4A0C D;  5TDW A;  2LGK A;  3LQJ A;  2XOC A;  2YHN A;  3RTR B;  2F6N A;  5G04 B;  2MA6 A;  2XB1 A;  3HCU A;  4AP4 A;  5TBN A;  3O7A A;  2KRE A;  2MA5 A;  2YHO A;  1FBV A;  2NAA A;  3Q1D A;  2KFT A;  2H0D A;  3O37 A;  2CRW A;  2EGM A;  3ZPV E;  5B78 A;  5FB0 A;  4CCG X;  2Y43 A;  4FIP A;  4YAX A;  5LKT A;  3LQH A;  2PUY A;  1WIL A;  1X4U A;  3RPG C;  2EGP A;  3HTK C;  3M7K A;  4H9D A;  4PPE A;  1F62 A;  1HYJ A;  4XI1 A;  1WE9 A;  3MDB C;  5KH3 A;  2RI7 A;  2L0B A;  2VJE B;  2KKY A;  4FK5 A;  4TKP B;  2LQ6 A;  2LAU A;  3JUE A;  2YQL A;  2LGG A;  4BBQ A;  3ZNI A;  3N9Q A;  2L43 A;  2ECW A;  3H7H A;  4AUQ B;  2VNF A;  3N9M A;  4R8P K;  3I2D A;  1DCQ A;  2MNZ A;  2QIZ A;  4IC3 A;  1VFY A;  2UZG A;  4FO9 A;  4UI9 B;  1HYI A;  2KWK A;  4LLB A;  2D8S A;  2LGL A;  2XP0 A;  2ECT A;  3V43 A;  2ECG A;  2DSM A;  5H1T A;  2HDP A;  2OWA A;  4WZ2 A;  2JMI A;  4L7X A;  3EB6 A;  2K16 A;  2ECI A;  1V87 A;  2YQM A;  4YAB A;  2E61 A;  2MKE A;  4O64 A;  1WEN A;  1WEE A;  4AYC B;  3U5P A;  2YW8 A;  2MIQ A;  3U5N A;  4YBS A;  4PTB A;  2VJF A;  2ECV A;  2CON A;  2L75 A;  2DX8 A;  2MD7 B;  5H1V A;  5B75 A;  2L80 A;  3PHD A;  2B0O E;  1VYX A;  2YT5 A;  5FER A;  2JMD A;  1WEW A;  2RSD A;  5FEY A;  2EA6 A;  3ZVZ B;  3PUQ A;  4QF2 A;  4GB0 A;  5B76 A;  4F1P A;  4UP5 A;  4Q6F A;  4YC9 A;  3L1X A;  1XWH A;  5D1L B;  5LKX A;  3GV4 A;  4OGE A;  2JRJ A;  2ECN A;  2YSM A;  4WZ3 B;  4S3O C;  4A4B A;  3DDT A;  4FJC A;  4O62 A;  4LKA A;  4V3K C;  2VPB A;  4W4U A;  5FB1 A;  3LJU X;  2FSA A;  3E2D A;  2L5U A;  2DJA A;  5B79 A;  1BOR A;  2K1J A;  2FD4 A;  2OXQ C;  3O35 A;  5KH9 A;  3FEH A;  5TRB A;  3U5M A;  1Z60 A;  4GND A;  2M3H A;  3LDY A;  4AVX A;  1N87 A;  3SOW A;  3SUB A;  2H0D B;  2QJ0 A;  1Z2Q A;  2I50 A;  1G25 A;  2PNX A;  3DWD A;  1WEV A;  4I7D A;  3O36 A;  2VPD A;  2CSY A;  4MSX A;  2XOZ A;  2KWN A;  3SHB A;  4F52 B;  2CKL A;  3KV6 A;  4ZUX U;  3O70 A;  5C11 A;  4S3O B;  2YUC A;  4A49 A;  5G0F A;  1MM2 A;  4N4F A;  3PUR A;  1K2F A;  5JG6 A;  4WA6 A;  3O34 A;  5LKU A;  1T1H A;  3T6R A;  1X4I A;  5KH7 A;  2YU4 A;  1RMD A;  2G43 A;  2KGI A;  2VPE A;  2BAY A;  2LRI C;  3HCT A;  5LKZ A;  1ZBD B;  3N9O A;  4I7B A;  2M1R A;  4B86 C;  2CT2 A;  1WEQ A;  3LVQ E;  4YAT A;  3DQV R;  3C6W A;  4UP0 A;  3T7L A;  5AIT A;  2LXP C;  3KNV A;  4X3G A;  1WGM A;  3O47 A;  1LDK C;  3RPG B;  3ZTG A;  2K4D A;  2KWJ A;  3SOU A;  1JM7 A;  5TDR A;  2KE1 A;  2LDR A;  3T9K A;  1FP0 A;  4GNG A;  2Y1M A;  5DIN A;  2VJF B;  3FAO A;  2KYU A;  4LAD B;  5J3X A;  2XOY A;  2L7P A;  2VPG A;  1LDJ B;  3FAN A;  2RR4 A;  2KGG A;  2CSZ A;  1JOC A;  5TAB A;  5H9M A;  2MUM A;  4GNE A;  4QQ4 A;  4WZ0 A;  4IC2 A;  3GL6 A;  2VP7 A;  2KR4 A;  2IDA A;  2MNY A; 
#chains in the Genus database with same CATH homology
 4N3W A;  4L58 A;  1DVP A;  2HYE D;  2F42 A;  2MT5 A;  1IYM A;  1U6G B;  2FUI A;  1WEU A;  3O33 A;  1X4J A;  4ZDT A;  4ZQL A;  2ZET C;  2G45 A;  2Y1N A;  3U5O A;  5D1M B;  2ECJ A;  3HCS A;  2C2V S;  2LN0 A;  2M85 A;  1MM3 A;  3EB5 A;  2VJE A;  4A4C A;  4C9Z A;  2E6R A;  3LQI A;  3FL2 A;  5LCW B;  3N9N A;  3ASL A;  3KQI A;  5B8D A;  1WEP A;  4NN2 A;  5G05 B;  3ZVY A;  4R2Y A;  2C2L A;  3N9P A;  2CKL B;  2E6S A;  4B7Y C;  1E4U A;  3LRQ A;  2YRE A;  4MVT A;  2LV9 A;  1WES A;  4YBT A;  4P5O B;  3ZPV 1;  4QF3 A;  5B77 A;  1WFK A;  2K17 A;  4CA1 A;  5EYA F;  3M99 A;  3KV5 A;  4YAD A;  3VK6 A;  2KWO A;  5D1K B;  4AYC A;  5H1U A;  5DKA A;  4BHW A;  3IHP A;  2JMJ A;  2LGV A;  1CHC A;  3M63 A;  3QZV A;  2YYR A;  2F6J A;  3L11 A;  3ZYQ A;  3MHS A;  5C13 A;  3DPL R;  2QIC A;  1Z6U A;  2MD8 C;  3SOX A;  2XEU A;  4YBM A;  5I3L A;  2AN6 A;  3M62 A;  4V3L C;  1WEO A;  2G6Q A;  4GNF A;  2FUU A;  3MHH A;  1WIM A;  1JM7 B;  4R7E A;  2LXH C;  1WEM A;  2KU3 A;  3NG2 A;  2KIZ A;  4LJN A;  3C5K A;  3N9L A;  2EOD A;  4I7C A;  5AIU A;  4LK9 A;  3L1Z B;  2YSJ A;  2M6M A;  2YUR A;  1VD4 A;  4A0C D;  5TDW A;  2LGK A;  3LQJ A;  2YHN A;  3RTR B;  2F6N A;  5G04 B;  2MA6 A;  2XB1 A;  3HCU A;  4AP4 A;  5TBN A;  3O7A A;  2KRE A;  2MA5 A;  2YHO A;  1FBV A;  2NAA A;  2KFT A;  2H0D A;  3O37 A;  3ZPV E;  5B78 A;  5FB0 A;  4CCG X;  2Y43 A;  4FIP A;  4YAX A;  5LKT A;  3LQH A;  2PUY A;  1WIL A;  1X4U A;  3RPG C;  2EGP A;  3HTK C;  1F62 A;  4PPE A;  1HYJ A;  4XI1 A;  1WE9 A;  5KH3 A;  2RI7 A;  2L0B A;  2VJE B;  4FK5 A;  4TKP B;  2LQ6 A;  2YQL A;  2LGG A;  4BBQ A;  3ZNI A;  3N9Q A;  2L43 A;  2ECW A;  4AUQ B;  2VNF A;  3N9M A;  4R8P K;  3I2D A;  2MNZ A;  2QIZ A;  4IC3 A;  1VFY A;  2UZG A;  4FO9 A;  4UI9 B;  1HYI A;  2KWK A;  4LLB A;  2D8S A;  2LGL A;  2ECT A;  3V43 A;  2ECG A;  5H1T A;  2HDP A;  4WZ2 A;  2JMI A;  4L7X A;  3EB6 A;  2K16 A;  2ECI A;  1V87 A;  2YQM A;  4YAB A;  4O64 A;  1WEN A;  1WEE A;  4AYC B;  3U5P A;  2YW8 A;  2MIQ A;  3U5N A;  4YBS A;  4PTB A;  2VJF A;  2ECV A;  2L75 A;  2DX8 A;  2MD7 B;  5H1V A;  5B75 A;  2L80 A;  3PHD A;  1VYX A;  2YT5 A;  5FER A;  2JMD A;  1WEW A;  2RSD A;  5FEY A;  2EA6 A;  3ZVZ B;  3PUQ A;  4QF2 A;  4GB0 A;  5B76 A;  4UP5 A;  4Q6F A;  4YC9 A;  3L1X A;  1XWH A;  5D1L B;  5LKX A;  3GV4 A;  2JRJ A;  2ECN A;  2YSM A;  4WZ3 B;  4S3O C;  4A4B A;  4FJC A;  4LKA A;  4V3K C;  2VPB A;  4W4U A;  5FB1 A;  2FSA A;  2L5U A;  5B79 A;  1BOR A;  2K1J A;  2OXQ C;  3O35 A;  5KH9 A;  5TRB A;  3U5M A;  1Z60 A;  4GND A;  2M3H A;  4AVX A;  1N87 A;  3SOW A;  2H0D B;  2QJ0 A;  1Z2Q A;  2I50 A;  1G25 A;  2PNX A;  1WEV A;  4I7D A;  3O36 A;  2VPD A;  2CSY A;  4MSX A;  3SHB A;  2KWN A;  4F52 B;  2CKL A;  3KV6 A;  4ZUX U;  3O70 A;  5C11 A;  4S3O B;  2YUC A;  4A49 A;  5G0F A;  1MM2 A;  4N4F A;  3PUR A;  1K2F A;  5JG6 A;  4WA6 A;  3O34 A;  5LKU A;  1T1H A;  3T6R A;  1X4I A;  5KH7 A;  2YU4 A;  1RMD A;  2G43 A;  2KGI A;  2VPE A;  2BAY A;  2LRI C;  3HCT A;  5LKZ A;  1ZBD B;  3N9O A;  4I7B A;  2M1R A;  4B86 C;  2CT2 A;  1WEQ A;  4YAT A;  3DQV R;  3C6W A;  4UP0 A;  3T7L A;  5AIT A;  2LXP C;  3KNV A;  4X3G A;  1WGM A;  1LDK C;  3RPG B;  3ZTG A;  2K4D A;  2KWJ A;  3SOU A;  1JM7 A;  5TDR A;  2KE1 A;  2LDR A;  1FP0 A;  4GNG A;  2Y1M A;  5DIN A;  2VJF B;  2KYU A;  4LAD B;  5J3X A;  2VPG A;  1LDJ B;  2KGG A;  2CSZ A;  1JOC A;  5TAB A;  5H9M A;  2MUM A;  4GNE A;  4WZ0 A;  4IC2 A;  3GL6 A;  2VP7 A;  2KR4 A;  2IDA A;  2MNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...