3SOUA

Structure of uhrf1 phd finger in complex with histone h3 1-9 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
PSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title PHD Finger Recognition of Unmodified Histone H3R2 Links UHRF1 to Regulation of Euchromatic Gene Expression.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3souA00
4PPEA 2YHNA 2ZETC 2MA6A 3N9NA 4GB0A 1WEUA 3HCUA 4YADA 2FSAA 3KNVA 4AVXA 1FP0A 2M1RA 5LKXA 1WGMA 4MVTA 2KWOA 1G25A 2ECIA 3KQIA 2Y43A 3PUQA 1WEPA 4V3LC 5H9MA 3SHBA 2BAYA 1HYIA 2M6MA 2L75A 3U5MA 3V43A 2KREA 5KH7A 2XB1A 4XI1A 5H1TA 3N9MA 5D1MB 2YUCA 4A0CD 5B77A 4QF2A 2HDPA 2YQLA 5DINA 5I3LA 5J3XA 2RSDA 3IHPA 3KV6A 3LRQA 1JM7A 2Y1NA 1WE9A 2KE1A 2KFTA 1WEEA 5AIUA 4LKAA 5FB0A 3VK6A 2PNXA 4IC2A 5TBNA 4B7YC 1IYMA 3GV4A 4NN2A 1BORA 4CCGX 3NG2A 3T6RA 2EODA 2VNFA 4IC3A 2ECWA 3RPGC 3ZTGA 1VFYA 3ASLA 3RPGB 1DVPA 3RTRB 2UZGA 4GNDA 3EB6A 2I50A 5AITA 1Z2QA 4LJNA 5TDWA 3LQJA 1WEQA 4WZ2A 2QJ0A 4W4UA 4QF3A 3ZNIA 2L5UA 2VJEA 3N9PA 2NAAA 1V87A 3DQVR 4BBQA 2JMDA 5KH3A 2KGIA 5EYAF 2YW8A 4A4BA 4CA1A 2LXHC 5D1KB 1WEWA 4BHWA 2YSMA 2KWKA 1LDKC 1VYXA 4L58A 5LKZA 4ZDTA 2YHOA 1F62A 2JRJA 2MIQA 3O70A 2K4DA 4FK5A 5C11A 2OXQC 5LCWB 2G45A 2HYED 2CSZA 2MUMA 2ECJA 2F42A 4FJCA 4YATA 5B78A 2H0DA 1MM2A 4R8PK 4YBTA 2QIZA 1MM3A 4GNFA 3ZPV1 5D1LB 3M63A 5B76A 3ZVZB 2IDAA 3N9OA 3LQIA 3O7AA 2M3HA 4AYCA 2LGKA 2D8SA 3N9QA 2VPDA 1WESA 2MNZA 3SOUA 2YQMA 2E6SA 4A49A 4O64A 4GNGA 4FIPA 3KV5A 1JOCA 3O33A 2VPGA 4TKPB 5B8DA 1N87A 4WA6A 3HCTA 2LN0A 4R7EA 1Z60A 3U5PA 5FB1A 2CKLA 2KIZA 2KGGA 3ZPVE 3SOXA 2ECTA 2FUIA 1HYJA 4S3OC 4S3OB 2F6NA 4F52B 3M62A 1K2FA 5G0FA 2K16A 2Y1MA 1FBVA 1X4JA 4V3KC 5TDRA 4LK9A 5FERA 2MD7B 2VPBA 4AUQB 2KU3A 2YYRA 4YAXA 2M85A 2ECGA 2YSJA 4N4FA 1JM7B 3L11A 4N3WA 4C9ZA 4MSXA 3O35A 2EGPA 2L43A 1RMDA 4GNEA 1WEMA 4WZ3B 4LADB 2EA6A 4X3GA 3O37A 2JMJA 1WIMA 2MD8C 3M99A 1LDJB 2ECVA 2MA5A 5DKAA 3QZVA 2KWJA 2PUYA 2XEUA 1WILA 2QICA 2G6QA 2KWNA 2LGVA 3HCSA 1X4UA 3DPLR 2VJFB 2LGLA 2VJEB 2AN6A 4YBMA 5B75A 2YU4A 5H1VA 4I7BA 3GL6A 4UI9B 3N9LA 5JG6A 2YURA 2ECNA 3C5KA 3HTKC 1U6GB 3L1ZB 4Q6FA 5LKUA 4UP5A 1WFKA 2MNYA 5B79A 3U5NA 4ZUXU 5KH9A 4A4CA 1Z6UA 1ZBDB 2LGGA 3ZYQA 2FUUA 4LLBA 5G04B 3MHSA 2F6JA 2YT5A 1VD4A 4YBSA 3O36A 2H0DB 2E6RA 3PHDA 3C6WA 2LV9A 4PTBA 4I7CA 4R2YA 4P5OB 3LQHA 2L80A 1CHCA 2YREA 5C13A 3ZVYA 4YC9A 3I2DA 3PURA 5TRBA 2LDRA 4L7XA 2LXPC 2KR4A 2VPEA 4UP0A 2RI7A 4WZ0A 4AYCB 2C2LA 3MHHA 1E4UA 1XWHA 3EB5A 4YABA 2JMIA 3L1XA 1WENA 5G05B 1X4IA 2VP7A 3U5OA 2LRIC 2LQ6A 1T1HA 2VJFA 2K1JA 2DX8A 1WEOA 4AP4A 4I7DA 5H1UA 3SOWA 5TABA 4B86C 2L0BA 2KYUA 4FO9A 5LKTA 1WEVA 5FEYA 2CT2A 2G43A 2MT5A 3O34A 2K17A 2CSYA 3FL2A 4ZQLA 3T7LA 2CKLB 2C2VS
chains in the Genus database with same CATH superfamily
4PPEA 2YHNA 2ZETC 2MA6A 3N9NA 4GB0A 1WEUA 3HCUA 4YADA 2FSAA 3KNVA 4AVXA 1FP0A 2M1RA 5SVIA 5LKXA 1WGMA 4MVTA 2KWOA 4H9DA 1G25A 3SUBA 3FANA 2ECIA 3KQIA 2Y43A 3PUQA 1WEPA 2L7PA 4V3LC 2CSVA 3PLWA 5H9MA 3SHBA 2BAYA 1HYIA 2M6MA 2L75A 3U5MA 3V43A 2KREA 5KH7A 2XB1A 4XI1A 2B0OE 5H1TA 3N9MA 5D1MB 2CONA 2YUCA 4A0CD 5B77A 4QF2A 3H7HA 2HDPA 2YQLA 5DINA 2P57A 5I3LA 5J3XA 2RSDA 3IHPA 3KV6A 3LRQA 1JM7A 2Y1NA 1WE9A 2KE1A 2KFTA 1WEEA 5AIUA 4LKAA 5FB0A 3VK6A 2PNXA 4IC2A 5TBNA 4B7YC 1IYMA 3GV4A 4NN2A 1BORA 4CCGX 3NG2A 3T6RA 2EODA 2VNFA 4IC3A 3FEHA 2ECWA 3RPGC 3ZTGA 1VFYA 3ASLA 3RPGB 1DVPA 3RTRB 2UZGA 4GNDA 3EB6A 1MBMA 2I50A 5AITA 1Z2QA 4LJNA 5TDWA 3LQJA 1WEQA 4WZ2A 2QJ0A 4W4UA 4QF3A 3ZNIA 2JM3A 2L5UA 2VJEA 3N9PA 2NAAA 2E61A 1V87A 3DQVR 4BBQA 2JMDA 5KH3A 2KGIA 3LVRE 5EYAF 2YW8A 4A4BA 2EGMA 4CA1A 2LXHC 2XOCA 5D1KB 1WEWA 3O47A 4BHWA 2YSMA 2KWKA 1LDKC 1VYXA 4L58A 3DDTA 5LKZA 4ZDTA 2YHOA 2XP0A 1F62A 2JRJA 2MIQA 3O70A 2K4DA 4FK5A 5C11A 2FFWA 2OXQC 5LCWB 2G45A 2HYED 4O62A 2CSZA 2MUMA 2ECJA 2F42A 4FJCA 4YATA 5B78A 2H0DA 1MM2A 4R8PK 4YBTA 2QIZA 1MM3A 4GNFA 3ZPV1 5D1LB 3M63A 5B76A 3ZVZB 3T9KA 2IDAA 3N9OA 3LQIA 3O7AA 2M3HA 4OGEA 4AYCA 2LGKA 2D8SA 3N9QA 2VPDA 1WESA 2MNZA 3JUEA 3SOUA 2YQMA 2E6SA 4A49A 4O64A 4GNGA 4FIPA 3KV5A 2FD4A 1JOCA 3O33A 2VPGA 4TKPB 5B8DA 2KKYA 5SVIB 4QQ4A 1N87A 4WA6A 3HCTA 2LN0A 2YVRA 4R7EA 1Z60A 3U5PA 2CRRA 5FB1A 2CKLA 2KIZA 5SVYA 2KGGA 3ZPVE 3SOXA 4F1PA 2ECTA 2FUIA 3FJUB 4S3OC 1HYJA 4S3OB 2F6NA 4F52B 3LDYA 3M62A 1K2FA 5G0FA 2K16A 2Y1MA 1FBVA 2D8UA 1X4JA 4V3KC 5TDRA 4LK9A 5FERA 2MD7B 2MKEA 2XOYA 3FAOA 2VPBA 2LAUA 4AUQB 2KU3A 2YYRA 4YAXA 2M85A 3M7KA 2ECGA 2YSJA 4N4FA 1JM7B 3L11A 4N3WA 4C9ZA 4MSXA 3O35A 2EGPA 2L43A 3KDEC 1RMDA 4GNEA 1WEMA 4WZ3B 4LADB 3DWDA 2EA6A 4X3GA 3O37A 2JMJA 1WIMA 2MD8C 3M99A 1LDJB 2ECVA 2MA5A 5DKAA 2IQJA 3QZVA 4Z0RA 2KWJA 2PUYA 2XEUA 1WILA 2CRWA 2QICA 3MDBC 2G6QA 2KWNA 2LGVA 2KKXA 3HCSA 1X4UA 3DPLR 2VJFB 2LGLA 2VJEB 2AN6A 4YBMA 5SVXA 2YU4A 5B75A 5H1VA 4I7BA 3GL6A 2DJAA 4UI9B 3N9LA 5JG6A 2YURA 2ECNA 3C5KA 3HTKC 1U6GB 2M13A 3L1ZB 4Q6FA 5LKUA 4UP5A 1WFKA 2MNYA 5B79A 3U5NA 4ZUXU 5KH9A 4A4CA 1Z6UA 1ZBDB 2LGGA 3ZYQA 4Z0OA 3E2DA 2FUUA 4LLBA 5G04B 3MHSA 2F6JA 2YT5A 3FM8C 1VD4A 3LJUX 4YBSA 3O36A 2H0DB 2E6RA 3PHDA 2JUNA 3C6WA 2LV9A 4PTBA 4I7CA 4R2YA 4P5OB 3LQHA 2EXUA 2L80A 1CHCA 2YREA 3Q1DA 5C13A 3ZVYA 4YC9A 3I2DA 3PURA 5TRBA 2LDRA 2OWAA 4L7XA 2LXPC 2KR4A 2VPEA 2RR4A 4UP0A 2RI7A 3LVQE 4WZ0A 4AYCB 2C2LA 3MHHA 1E4UA 1XWHA 3EB5A 4YABA 2JMIA 3L1XA 1WENA 5G05B 2DSMA 4OGCA 1X4IA 1DCQA 2VP7A 3U5OA 2LRIC 2LQ6A 1T1HA 2VJFA 2K1JA 2DX8A 1WEOA 4AP4A 4I7DA 5H1UA 3SOWA 5TABA 4B86C 2L0BA 2KYUA 4FO9A 5LKTA 1WEVA 2XOZA 5FEYA 2CT2A 2G43A 2MT5A 5K3QA 3O34A 2K17A 2CSYA 3FL2A 4ZQLA 3T7LA 2CKLB 2C2VS
chains in the Genus database with same CATH topology
4PPEA 2YHNA 2ZETC 2MA6A 3N9NA 4GB0A 1WEUA 3HCUA 4YADA 2FSAA 3KNVA 4AVXA 1FP0A 2M1RA 5LKXA 1WGMA 4MVTA 2KWOA 1G25A 2ECIA 3KQIA 2Y43A 3PUQA 1WEPA 4V3LC 5H9MA 3SHBA 2BAYA 1HYIA 2M6MA 2L75A 3U5MA 3V43A 2KREA 5KH7A 2XB1A 4XI1A 5H1TA 3N9MA 5D1MB 2YUCA 4A0CD 5B77A 4QF2A 2HDPA 2YQLA 5DINA 5I3LA 5J3XA 2RSDA 3IHPA 3KV6A 3LRQA 1JM7A 2Y1NA 1WE9A 2KE1A 2KFTA 1WEEA 5AIUA 4LKAA 5FB0A 3VK6A 2PNXA 4IC2A 5TBNA 4B7YC 1IYMA 3GV4A 4NN2A 1BORA 4CCGX 3NG2A 3T6RA 2EODA 2VNFA 4IC3A 2ECWA 3RPGC 3ZTGA 1VFYA 3ASLA 3RPGB 1DVPA 3RTRB 2UZGA 4GNDA 3EB6A 2I50A 5AITA 1Z2QA 4LJNA 5TDWA 3LQJA 1WEQA 4WZ2A 2QJ0A 4W4UA 4QF3A 3ZNIA 2L5UA 2VJEA 3N9PA 2NAAA 1V87A 3DQVR 4BBQA 2JMDA 5KH3A 2KGIA 5EYAF 2YW8A 4A4BA 4CA1A 2LXHC 5D1KB 1WEWA 4BHWA 2YSMA 2KWKA 1LDKC 1VYXA 4L58A 5LKZA 4ZDTA 2YHOA 1F62A 2JRJA 2MIQA 3O70A 2K4DA 4FK5A 5C11A 2OXQC 5LCWB 2G45A 2HYED 2CSZA 2MUMA 2ECJA 2F42A 4FJCA 4YATA 5B78A 2H0DA 1MM2A 4R8PK 4YBTA 2QIZA 1MM3A 4GNFA 3ZPV1 5D1LB 3M63A 5B76A 3ZVZB 2IDAA 3N9OA 3LQIA 3O7AA 2M3HA 4AYCA 2LGKA 2D8SA 3N9QA 2VPDA 1WESA 2MNZA 3SOUA 2YQMA 2E6SA 4A49A 4O64A 4GNGA 4FIPA 3KV5A 1JOCA 3O33A 2VPGA 4TKPB 5B8DA 1N87A 4WA6A 3HCTA 2LN0A 4R7EA 1Z60A 3U5PA 5FB1A 2CKLA 2KIZA 2KGGA 3ZPVE 3SOXA 2ECTA 2FUIA 1HYJA 4S3OC 4S3OB 2F6NA 4F52B 3M62A 1K2FA 5G0FA 2K16A 2Y1MA 1FBVA 1X4JA 4V3KC 5TDRA 4LK9A 5FERA 2MD7B 2VPBA 4AUQB 2KU3A 2YYRA 4YAXA 2M85A 2ECGA 2YSJA 4N4FA 1JM7B 3L11A 4N3WA 4C9ZA 4MSXA 3O35A 2EGPA 2L43A 1RMDA 4GNEA 1WEMA 4WZ3B 4LADB 2EA6A 4X3GA 3O37A 2JMJA 1WIMA 2MD8C 3M99A 1LDJB 2ECVA 2MA5A 5DKAA 3QZVA 2KWJA 2PUYA 2XEUA 1WILA 2QICA 2G6QA 2KWNA 2LGVA 3HCSA 1X4UA 3DPLR 2VJFB 2LGLA 2VJEB 2AN6A 4YBMA 5B75A 2YU4A 5H1VA 4I7BA 3GL6A 4UI9B 3N9LA 5JG6A 2YURA 2ECNA 3C5KA 3HTKC 1U6GB 3L1ZB 4Q6FA 5LKUA 4UP5A 1WFKA 2MNYA 5B79A 3U5NA 4ZUXU 5KH9A 4A4CA 1Z6UA 1ZBDB 2LGGA 3ZYQA 2FUUA 4LLBA 5G04B 3MHSA 2F6JA 2YT5A 1VD4A 4YBSA 3O36A 2H0DB 2E6RA 3PHDA 3C6WA 2LV9A 4PTBA 4I7CA 4R2YA 4P5OB 3LQHA 2L80A 1CHCA 2YREA 5C13A 3ZVYA 4YC9A 3I2DA 3PURA 5TRBA 2LDRA 4L7XA 2LXPC 2KR4A 2VPEA 4UP0A 2RI7A 4WZ0A 4AYCB 2C2LA 3MHHA 1E4UA 1XWHA 3EB5A 4YABA 2JMIA 3L1XA 1WENA 5G05B 1X4IA 2VP7A 3U5OA 2LRIC 2LQ6A 1T1HA 2VJFA 2K1JA 2DX8A 1WEOA 4AP4A 4I7DA 5H1UA 3SOWA 5TABA 4B86C 2L0BA 2KYUA 4FO9A 5LKTA 1WEVA 5FEYA 2CT2A 2G43A 2MT5A 3O34A 2K17A 2CSYA 3FL2A 4ZQLA 3T7LA 2CKLB 2C2VS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PPE A;  2YHN A;  2ZET C;  2MA6 A;  3N9N A;  4GB0 A;  1WEU A;  3HCU A;  4YAD A;  2FSA A;  3KNV A;  4AVX A;  1FP0 A;  2M1R A;  5LKX A;  1WGM A;  4MVT A;  2KWO A;  1G25 A;  2ECI A;  3KQI A;  2Y43 A;  3PUQ A;  1WEP A;  4V3L C;  5H9M A;  3SHB A;  2BAY A;  1HYI A;  2M6M A;  2L75 A;  3U5M A;  3V43 A;  2KRE A;  5KH7 A;  2XB1 A;  4XI1 A;  5H1T A;  3N9M A;  5D1M B;  2YUC A;  4A0C D;  5B77 A;  4QF2 A;  2HDP A;  2YQL A;  5DIN A;  5I3L A;  5J3X A;  2RSD A;  3IHP A;  3KV6 A;  3LRQ A;  1JM7 A;  2Y1N A;  1WE9 A;  2KE1 A;  2KFT A;  1WEE A;  5AIU A;  4LKA A;  5FB0 A;  3VK6 A;  2PNX A;  4IC2 A;  5TBN A;  4B7Y C;  1IYM A;  3GV4 A;  4NN2 A;  1BOR A;  4CCG X;  3NG2 A;  3T6R A;  2EOD A;  2VNF A;  4IC3 A;  2ECW A;  3RPG C;  3ZTG A;  1VFY A;  3ASL A;  3RPG B;  1DVP A;  3RTR B;  2UZG A;  4GND A;  3EB6 A;  2I50 A;  5AIT A;  1Z2Q A;  4LJN A;  5TDW A;  3LQJ A;  1WEQ A;  4WZ2 A;  2QJ0 A;  4W4U A;  4QF3 A;  3ZNI A;  2L5U A;  2VJE A;  3N9P A;  2NAA A;  1V87 A;  3DQV R;  4BBQ A;  2JMD A;  5KH3 A;  2KGI A;  5EYA F;  2YW8 A;  4A4B A;  4CA1 A;  2LXH C;  5D1K B;  1WEW A;  4BHW A;  2YSM A;  2KWK A;  1LDK C;  1VYX A;  4L58 A;  5LKZ A;  4ZDT A;  2YHO A;  1F62 A;  2JRJ A;  2MIQ A;  3O70 A;  2K4D A;  4FK5 A;  5C11 A;  2OXQ C;  5LCW B;  2G45 A;  2HYE D;  2CSZ A;  2MUM A;  2ECJ A;  2F42 A;  4FJC A;  4YAT A;  5B78 A;  2H0D A;  1MM2 A;  4R8P K;  4YBT A;  2QIZ A;  1MM3 A;  4GNF A;  3ZPV 1;  5D1L B;  3M63 A;  5B76 A;  3ZVZ B;  2IDA A;  3N9O A;  3LQI A;  3O7A A;  2M3H A;  4AYC A;  2LGK A;  2D8S A;  3N9Q A;  2VPD A;  1WES A;  2MNZ A;  3SOU A;  2YQM A;  2E6S A;  4A49 A;  4O64 A;  4GNG A;  4FIP A;  3KV5 A;  1JOC A;  3O33 A;  2VPG A;  4TKP B;  5B8D A;  1N87 A;  4WA6 A;  3HCT A;  2LN0 A;  4R7E A;  1Z60 A;  3U5P A;  5FB1 A;  2CKL A;  2KIZ A;  2KGG A;  3ZPV E;  3SOX A;  2ECT A;  2FUI A;  1HYJ A;  4S3O C;  4S3O B;  2F6N A;  4F52 B;  3M62 A;  1K2F A;  5G0F A;  2K16 A;  2Y1M A;  1FBV A;  1X4J A;  4V3K C;  5TDR A;  4LK9 A;  5FER A;  2MD7 B;  2VPB A;  4AUQ B;  2KU3 A;  2YYR A;  4YAX A;  2M85 A;  2ECG A;  2YSJ A;  4N4F A;  1JM7 B;  3L11 A;  4N3W A;  4C9Z A;  4MSX A;  3O35 A;  2EGP A;  2L43 A;  1RMD A;  4GNE A;  1WEM A;  4WZ3 B;  4LAD B;  2EA6 A;  4X3G A;  3O37 A;  2JMJ A;  1WIM A;  2MD8 C;  3M99 A;  1LDJ B;  2ECV A;  2MA5 A;  5DKA A;  3QZV A;  2KWJ A;  2PUY A;  2XEU A;  1WIL A;  2QIC A;  2G6Q A;  2KWN A;  2LGV A;  3HCS A;  1X4U A;  3DPL R;  2VJF B;  2LGL A;  2VJE B;  2AN6 A;  4YBM A;  5B75 A;  2YU4 A;  5H1V A;  4I7B A;  3GL6 A;  4UI9 B;  3N9L A;  5JG6 A;  2YUR A;  2ECN A;  3C5K A;  3HTK C;  1U6G B;  3L1Z B;  4Q6F A;  5LKU A;  4UP5 A;  1WFK A;  2MNY A;  5B79 A;  3U5N A;  4ZUX U;  5KH9 A;  4A4C A;  1Z6U A;  1ZBD B;  2LGG A;  3ZYQ A;  2FUU A;  4LLB A;  5G04 B;  3MHS A;  2F6J A;  2YT5 A;  1VD4 A;  4YBS A;  3O36 A;  2H0D B;  2E6R A;  3PHD A;  3C6W A;  2LV9 A;  4PTB A;  4I7C A;  4R2Y A;  4P5O B;  3LQH A;  2L80 A;  1CHC A;  2YRE A;  5C13 A;  3ZVY A;  4YC9 A;  3I2D A;  3PUR A;  5TRB A;  2LDR A;  4L7X A;  2LXP C;  2KR4 A;  2VPE A;  4UP0 A;  2RI7 A;  4WZ0 A;  4AYC B;  2C2L A;  3MHH A;  1E4U A;  1XWH A;  3EB5 A;  4YAB A;  2JMI A;  3L1X A;  1WEN A;  5G05 B;  1X4I A;  2VP7 A;  3U5O A;  2LRI C;  2LQ6 A;  1T1H A;  2VJF A;  2K1J A;  2DX8 A;  1WEO A;  4AP4 A;  4I7D A;  5H1U A;  3SOW A;  5TAB A;  4B86 C;  2L0B A;  2KYU A;  4FO9 A;  5LKT A;  1WEV A;  5FEY A;  2CT2 A;  2G43 A;  2MT5 A;  3O34 A;  2K17 A;  2CSY A;  3FL2 A;  4ZQL A;  3T7L A;  2CKL B;  2C2V S; 
#chains in the Genus database with same CATH topology
 4PPE A;  2YHN A;  2ZET C;  2MA6 A;  3N9N A;  4GB0 A;  1WEU A;  3HCU A;  4YAD A;  2FSA A;  3KNV A;  4AVX A;  1FP0 A;  2M1R A;  5SVI A;  5LKX A;  1WGM A;  4MVT A;  2KWO A;  4H9D A;  1G25 A;  3SUB A;  3FAN A;  2ECI A;  3KQI A;  2Y43 A;  3PUQ A;  1WEP A;  2L7P A;  4V3L C;  2CSV A;  3PLW A;  5H9M A;  3SHB A;  2BAY A;  1HYI A;  2M6M A;  2L75 A;  3U5M A;  3V43 A;  2KRE A;  5KH7 A;  2XB1 A;  4XI1 A;  2B0O E;  5H1T A;  3N9M A;  5D1M B;  2CON A;  2YUC A;  4A0C D;  5B77 A;  4QF2 A;  3H7H A;  2HDP A;  2YQL A;  5DIN A;  2P57 A;  5I3L A;  5J3X A;  2RSD A;  3IHP A;  3KV6 A;  3LRQ A;  1JM7 A;  2Y1N A;  1WE9 A;  2KE1 A;  2KFT A;  1WEE A;  5AIU A;  4LKA A;  5FB0 A;  3VK6 A;  2PNX A;  4IC2 A;  5TBN A;  4B7Y C;  1IYM A;  3GV4 A;  4NN2 A;  1BOR A;  4CCG X;  3NG2 A;  3T6R A;  2EOD A;  2VNF A;  4IC3 A;  3FEH A;  2ECW A;  3RPG C;  3ZTG A;  1VFY A;  3ASL A;  3RPG B;  1DVP A;  3RTR B;  2UZG A;  4GND A;  3EB6 A;  1MBM A;  2I50 A;  5AIT A;  1Z2Q A;  4LJN A;  5TDW A;  3LQJ A;  1WEQ A;  4WZ2 A;  2QJ0 A;  4W4U A;  4QF3 A;  3ZNI A;  2JM3 A;  2L5U A;  2VJE A;  3N9P A;  2NAA A;  2E61 A;  1V87 A;  3DQV R;  4BBQ A;  2JMD A;  5KH3 A;  2KGI A;  3LVR E;  5EYA F;  2YW8 A;  4A4B A;  2EGM A;  4CA1 A;  2LXH C;  2XOC A;  5D1K B;  1WEW A;  3O47 A;  4BHW A;  2YSM A;  2KWK A;  1LDK C;  1VYX A;  4L58 A;  3DDT A;  5LKZ A;  4ZDT A;  2YHO A;  2XP0 A;  1F62 A;  2JRJ A;  2MIQ A;  3O70 A;  2K4D A;  4FK5 A;  5C11 A;  2FFW A;  2OXQ C;  5LCW B;  2G45 A;  2HYE D;  4O62 A;  2CSZ A;  2MUM A;  2ECJ A;  2F42 A;  4FJC A;  4YAT A;  5B78 A;  2H0D A;  1MM2 A;  4R8P K;  4YBT A;  2QIZ A;  1MM3 A;  4GNF A;  3ZPV 1;  5D1L B;  3M63 A;  5B76 A;  3ZVZ B;  3T9K A;  2IDA A;  3N9O A;  3LQI A;  3O7A A;  2M3H A;  4OGE A;  4AYC A;  2LGK A;  2D8S A;  3N9Q A;  2VPD A;  1WES A;  2MNZ A;  3JUE A;  3SOU A;  2YQM A;  2E6S A;  4A49 A;  4O64 A;  4GNG A;  4FIP A;  3KV5 A;  2FD4 A;  1JOC A;  3O33 A;  2VPG A;  4TKP B;  5B8D A;  2KKY A;  5SVI B;  4QQ4 A;  1N87 A;  4WA6 A;  3HCT A;  2LN0 A;  2YVR A;  4R7E A;  1Z60 A;  3U5P A;  2CRR A;  5FB1 A;  2CKL A;  2KIZ A;  5SVY A;  2KGG A;  3ZPV E;  3SOX A;  4F1P A;  2ECT A;  2FUI A;  3FJU B;  4S3O C;  1HYJ A;  4S3O B;  2F6N A;  4F52 B;  3LDY A;  3M62 A;  1K2F A;  5G0F A;  2K16 A;  2Y1M A;  1FBV A;  2D8U A;  1X4J A;  4V3K C;  5TDR A;  4LK9 A;  5FER A;  2MD7 B;  2MKE A;  2XOY A;  3FAO A;  2VPB A;  2LAU A;  4AUQ B;  2KU3 A;  2YYR A;  4YAX A;  2M85 A;  3M7K A;  2ECG A;  2YSJ A;  4N4F A;  1JM7 B;  3L11 A;  4N3W A;  4C9Z A;  4MSX A;  3O35 A;  2EGP A;  2L43 A;  3KDE C;  1RMD A;  4GNE A;  1WEM A;  4WZ3 B;  4LAD B;  3DWD A;  2EA6 A;  4X3G A;  3O37 A;  2JMJ A;  1WIM A;  2MD8 C;  3M99 A;  1LDJ B;  2ECV A;  2MA5 A;  5DKA A;  2IQJ A;  3QZV A;  4Z0R A;  2KWJ A;  2PUY A;  2XEU A;  1WIL A;  2CRW A;  2QIC A;  3MDB C;  2G6Q A;  2KWN A;  2LGV A;  2KKX A;  3HCS A;  1X4U A;  3DPL R;  2VJF B;  2LGL A;  2VJE B;  2AN6 A;  4YBM A;  5SVX A;  2YU4 A;  5B75 A;  5H1V A;  4I7B A;  3GL6 A;  2DJA A;  4UI9 B;  3N9L A;  5JG6 A;  2YUR A;  2ECN A;  3C5K A;  3HTK C;  1U6G B;  2M13 A;  3L1Z B;  4Q6F A;  5LKU A;  4UP5 A;  1WFK A;  2MNY A;  5B79 A;  3U5N A;  4ZUX U;  5KH9 A;  4A4C A;  1Z6U A;  1ZBD B;  2LGG A;  3ZYQ A;  4Z0O A;  3E2D A;  2FUU A;  4LLB A;  5G04 B;  3MHS A;  2F6J A;  2YT5 A;  3FM8 C;  1VD4 A;  3LJU X;  4YBS A;  3O36 A;  2H0D B;  2E6R A;  3PHD A;  2JUN A;  3C6W A;  2LV9 A;  4PTB A;  4I7C A;  4R2Y A;  4P5O B;  3LQH A;  2EXU A;  2L80 A;  1CHC A;  2YRE A;  3Q1D A;  5C13 A;  3ZVY A;  4YC9 A;  3I2D A;  3PUR A;  5TRB A;  2LDR A;  2OWA A;  4L7X A;  2LXP C;  2KR4 A;  2VPE A;  2RR4 A;  4UP0 A;  2RI7 A;  3LVQ E;  4WZ0 A;  4AYC B;  2C2L A;  3MHH A;  1E4U A;  1XWH A;  3EB5 A;  4YAB A;  2JMI A;  3L1X A;  1WEN A;  5G05 B;  2DSM A;  4OGC A;  1X4I A;  1DCQ A;  2VP7 A;  3U5O A;  2LRI C;  2LQ6 A;  1T1H A;  2VJF A;  2K1J A;  2DX8 A;  1WEO A;  4AP4 A;  4I7D A;  5H1U A;  3SOW A;  5TAB A;  4B86 C;  2L0B A;  2KYU A;  4FO9 A;  5LKT A;  1WEV A;  2XOZ A;  5FEY A;  2CT2 A;  2G43 A;  2MT5 A;  5K3Q A;  3O34 A;  2K17 A;  2CSY A;  3FL2 A;  4ZQL A;  3T7L A;  2CKL B;  2C2V S; 
#chains in the Genus database with same CATH homology
 4PPE A;  2YHN A;  2ZET C;  2MA6 A;  3N9N A;  4GB0 A;  1WEU A;  3HCU A;  4YAD A;  2FSA A;  3KNV A;  4AVX A;  1FP0 A;  2M1R A;  5LKX A;  1WGM A;  4MVT A;  2KWO A;  1G25 A;  2ECI A;  3KQI A;  2Y43 A;  3PUQ A;  1WEP A;  4V3L C;  5H9M A;  3SHB A;  2BAY A;  1HYI A;  2M6M A;  2L75 A;  3U5M A;  3V43 A;  2KRE A;  5KH7 A;  2XB1 A;  4XI1 A;  5H1T A;  3N9M A;  5D1M B;  2YUC A;  4A0C D;  5B77 A;  4QF2 A;  2HDP A;  2YQL A;  5DIN A;  5I3L A;  5J3X A;  2RSD A;  3IHP A;  3KV6 A;  3LRQ A;  1JM7 A;  2Y1N A;  1WE9 A;  2KE1 A;  2KFT A;  1WEE A;  5AIU A;  4LKA A;  5FB0 A;  3VK6 A;  2PNX A;  4IC2 A;  5TBN A;  4B7Y C;  1IYM A;  3GV4 A;  4NN2 A;  1BOR A;  4CCG X;  3NG2 A;  3T6R A;  2EOD A;  2VNF A;  4IC3 A;  2ECW A;  3RPG C;  3ZTG A;  1VFY A;  3ASL A;  3RPG B;  1DVP A;  3RTR B;  2UZG A;  4GND A;  3EB6 A;  2I50 A;  5AIT A;  1Z2Q A;  4LJN A;  5TDW A;  3LQJ A;  1WEQ A;  4WZ2 A;  2QJ0 A;  4W4U A;  4QF3 A;  3ZNI A;  2L5U A;  2VJE A;  3N9P A;  2NAA A;  1V87 A;  3DQV R;  4BBQ A;  2JMD A;  5KH3 A;  2KGI A;  5EYA F;  2YW8 A;  4A4B A;  4CA1 A;  2LXH C;  5D1K B;  1WEW A;  4BHW A;  2YSM A;  2KWK A;  1LDK C;  1VYX A;  4L58 A;  5LKZ A;  4ZDT A;  2YHO A;  1F62 A;  2JRJ A;  2MIQ A;  3O70 A;  2K4D A;  4FK5 A;  5C11 A;  2OXQ C;  5LCW B;  2G45 A;  2HYE D;  2CSZ A;  2MUM A;  2ECJ A;  2F42 A;  4FJC A;  4YAT A;  5B78 A;  2H0D A;  1MM2 A;  4R8P K;  4YBT A;  2QIZ A;  1MM3 A;  4GNF A;  3ZPV 1;  5D1L B;  3M63 A;  5B76 A;  3ZVZ B;  2IDA A;  3N9O A;  3LQI A;  3O7A A;  2M3H A;  4AYC A;  2LGK A;  2D8S A;  3N9Q A;  2VPD A;  1WES A;  2MNZ A;  3SOU A;  2YQM A;  2E6S A;  4A49 A;  4O64 A;  4GNG A;  4FIP A;  3KV5 A;  1JOC A;  3O33 A;  2VPG A;  4TKP B;  5B8D A;  1N87 A;  4WA6 A;  3HCT A;  2LN0 A;  4R7E A;  1Z60 A;  3U5P A;  5FB1 A;  2CKL A;  2KIZ A;  2KGG A;  3ZPV E;  3SOX A;  2ECT A;  2FUI A;  1HYJ A;  4S3O C;  4S3O B;  2F6N A;  4F52 B;  3M62 A;  1K2F A;  5G0F A;  2K16 A;  2Y1M A;  1FBV A;  1X4J A;  4V3K C;  5TDR A;  4LK9 A;  5FER A;  2MD7 B;  2VPB A;  4AUQ B;  2KU3 A;  2YYR A;  4YAX A;  2M85 A;  2ECG A;  2YSJ A;  4N4F A;  1JM7 B;  3L11 A;  4N3W A;  4C9Z A;  4MSX A;  3O35 A;  2EGP A;  2L43 A;  1RMD A;  4GNE A;  1WEM A;  4WZ3 B;  4LAD B;  2EA6 A;  4X3G A;  3O37 A;  2JMJ A;  1WIM A;  2MD8 C;  3M99 A;  1LDJ B;  2ECV A;  2MA5 A;  5DKA A;  3QZV A;  2KWJ A;  2PUY A;  2XEU A;  1WIL A;  2QIC A;  2G6Q A;  2KWN A;  2LGV A;  3HCS A;  1X4U A;  3DPL R;  2VJF B;  2LGL A;  2VJE B;  2AN6 A;  4YBM A;  5B75 A;  2YU4 A;  5H1V A;  4I7B A;  3GL6 A;  4UI9 B;  3N9L A;  5JG6 A;  2YUR A;  2ECN A;  3C5K A;  3HTK C;  1U6G B;  3L1Z B;  4Q6F A;  5LKU A;  4UP5 A;  1WFK A;  2MNY A;  5B79 A;  3U5N A;  4ZUX U;  5KH9 A;  4A4C A;  1Z6U A;  1ZBD B;  2LGG A;  3ZYQ A;  2FUU A;  4LLB A;  5G04 B;  3MHS A;  2F6J A;  2YT5 A;  1VD4 A;  4YBS A;  3O36 A;  2H0D B;  2E6R A;  3PHD A;  3C6W A;  2LV9 A;  4PTB A;  4I7C A;  4R2Y A;  4P5O B;  3LQH A;  2L80 A;  1CHC A;  2YRE A;  5C13 A;  3ZVY A;  4YC9 A;  3I2D A;  3PUR A;  5TRB A;  2LDR A;  4L7X A;  2LXP C;  2KR4 A;  2VPE A;  4UP0 A;  2RI7 A;  4WZ0 A;  4AYC B;  2C2L A;  3MHH A;  1E4U A;  1XWH A;  3EB5 A;  4YAB A;  2JMI A;  3L1X A;  1WEN A;  5G05 B;  1X4I A;  2VP7 A;  3U5O A;  2LRI C;  2LQ6 A;  1T1H A;  2VJF A;  2K1J A;  2DX8 A;  1WEO A;  4AP4 A;  4I7D A;  5H1U A;  3SOW A;  5TAB A;  4B86 C;  2L0B A;  2KYU A;  4FO9 A;  5LKT A;  1WEV A;  5FEY A;  2CT2 A;  2G43 A;  2MT5 A;  3O34 A;  2K17 A;  2CSY A;  3FL2 A;  4ZQL A;  3T7L A;  2CKL B;  2C2V S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...