3SOUA

Structure of uhrf1 phd finger in complex with histone h3 1-9 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
PSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title PHD Finger Recognition of Unmodified Histone H3R2 Links UHRF1 to Regulation of Euchromatic Gene Expression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3souA00
2G43A 4BHWA 4NN2A 5H9MA 3HCUA 4AVXA 5AIUA 2VJEB 4R2YA 5DINA 2C2LA 1WEQA 4QF2A 2LXHC 3GL6A 2M6MA 4MVTA 2E6RA 2YSMA 1X4UA 1WEMA 3LQJA 3KQIA 3U5MA 2MNYA 2YU4A 3EB5A 3KV5A 4LK9A 2HDPA 1G25A 1HYJA 1X4JA 2DX8A 4V3LC 3VK6A 2YURA 3N9NA 2MD8C 2D8SA 4S3OC 2PUYA 2KIZA 5B77A 3SOUA 5G0FA 3M62A 2RI7A 1BORA 4GNGA 2YSJA 3LRQA 4A4BA 1K2FA 4WZ3B 2OXQC 2FSAA 3L1XA 5B8DA 4F52B 2MNZA 4IC3A 2ZETC 1VFYA 4TKPB 5FEYA 3N9QA 1E4UA 4FK5A 4WA6A 1VD4A 4ZUXU 1WEVA 5D1LB 2KU3A 2K17A 1WGMA 2KWOA 1WEUA 2K1JA 3SOXA 2LGVA 5C11A 3MHSA 1MM3A 2F6NA 2LRIC 2KWNA 2Y43A 4UP0A 2KE1A 2LXPC 4Q6FA 2MUMA 2ECGA 4WZ2A 2KFTA 3O7AA 4L58A 1HYIA 3O35A 2EGPA 3SHBA 2XEUA 5KH7A 1Z2QA 2ECJA 4A0CD 2G6QA 2H0DA 3ZNIA 2M1RA 2AN6A 2E6SA 4ZQLA 2ECWA 1WFKA 4WZ0A 2KGIA 3I2DA 1WEWA 5EYAF 2CSYA 5J3XA 3PURA 2VPGA 2CT2A 3IHPA 3O33A 2LV9A 2YUCA 2F42A 1X4IA 5KH3A 2I50A 4A49A 2JMJA 1CHCA 4LJNA 2QJ0A 4YBSA 4V3KC 4L7XA 5B78A 5KH9A 4FO9A 5C13A 5TABA 2FUIA 4UI9B 5H1UA 3ZPVE 5JG6A 3M63A 4I7CA 4YBTA 1Z60A 1WE9A 2ECTA 5TRBA 1XWHA 3N9PA 3T7LA 2KWKA 1MM2A 4N4FA 3DQVR 2YQLA 5B75A 2Y1MA 3LQIA 2H0DB 2IDAA 1RMDA 4ZDTA 2C2VS 1DVPA 4PPEA 3ZYQA 4N3WA 2ECVA 3N9MA 4LLBA 4B86C 4FIPA 1FBVA 3QZVA 1LDJB 5LKTA 1F62A 4CA1A 2YREA 5LKUA 3PHDA 2YT5A 3O34A 1FP0A 3GV4A 4W4UA 3NG2A 4MSXA 3RPGB 4YATA 3O36A 1N87A 1T1HA 4AYCA 2JRJA 3O70A 2LGGA 2FUUA 4BBQA 4YC9A 3O37A 2KGGA 3EB6A 4IC2A 1WIMA 4YADA 2L75A 4S3OB 1V87A 4C9ZA 2VPDA 1WESA 4YAXA 5G05B 2L0BA 2L80A 2JMIA 2K4DA 3KV6A 2MA6A 3N9OA 2KREA 4R7EA 5FERA 1IYMA 3M99A 2BAYA 5D1KB 5TDRA 4GNEA 2ECNA 2Y1NA 1WEOA 2M3HA 5FB0A 5B79A 3LQHA 3C6WA 4GB0A 5LCWB 3U5OA 2CKLA 5LKZA 2XB1A 2UZGA 2VJFA 3ASLA 1ZBDB 2KWJA 2L5UA 4AYCB 3U5NA 2HYED 3N9LA 4I7BA 1WEPA 3RPGC 4X3GA 4A4CA 2LQ6A 3L11A 2QIZA 1WILA 2LDRA 5B76A 5AITA 5H1TA 4YBMA 4UP5A 1WEEA 2KYUA 3L1ZB 1JOCA 3PUQA 2F6JA 1JM7A 2YQMA 3MHHA 2YHNA 1VYXA 5I3LA 2K16A 2JMDA 2KR4A 2VP7A 4I7DA 3KNVA 2RSDA 2VJEA 3V43A 2L43A 2EA6A 4PTBA 2YYRA 2M85A 3HCSA 2YW8A 2CKLB 4R8PK 4P5OB 3ZVZB 5DKAA 2VJFB 4AUQB 1LDKC 2VPEA 4FJCA 3U5PA 3C5KA 4LADB 3HTKC 5D1MB 4XI1A 2ECIA 2LGKA 2MT5A 3ZPV1 3RTRB 3DPLR 3T6RA 2NAAA 5H1VA 5FB1A 5TDWA 4GNFA 3SOWA 4YABA 2LN0A 2YHOA 4B7YC 3ZTGA 1Z6UA 2QICA 4GNDA 3FL2A 4LKAA 5TBNA 5LKXA 2VNFA 4O64A 1WENA 4QF3A 4CCGX 3ZVYA 1U6GB 4AP4A 2PNXA 2LGLA 2MA5A 2VPBA 2G45A 2MD7B 2MIQA 5G04B 1JM7B 2CSZA 2EODA 3HCTA
chains in the Genus database with same CATH superfamily
2G43A 4BHWA 4NN2A 5H9MA 3HCUA 4AVXA 5AIUA 2VJEB 4R2YA 5DINA 2DSMA 2C2LA 1WEQA 4QF2A 2LXHC 3GL6A 3H7HA 2M6MA 4MVTA 2E6RA 2YSMA 3DWDA 1X4UA 1WEMA 3LQJA 3FEHA 3KQIA 3U5MA 2MNYA 2YU4A 4QQ4A 3EB5A 3KV5A 4LK9A 2HDPA 1G25A 1HYJA 1X4JA 2DX8A 4V3LC 3VK6A 2YURA 2CONA 3N9NA 3SUBA 2M13A 2MD8C 2LAUA 2D8SA 4S3OC 2PUYA 2KIZA 5B77A 3SOUA 5G0FA 3M62A 2RI7A 1BORA 4GNGA 5SVIB 2YSJA 3LRQA 4A4BA 1K2FA 4WZ3B 3FAOA 2OXQC 2FSAA 3L1XA 2P57A 5B8DA 4F52B 2MNZA 4IC3A 2CSVA 2ZETC 1VFYA 4TKPB 4H9DA 5FEYA 3N9QA 1E4UA 4FK5A 2KKYA 1MBMA 4WA6A 1VD4A 4ZUXU 1WEVA 5D1LB 2KU3A 2K17A 3Q1DA 1WGMA 2KWOA 1WEUA 2K1JA 2LGVA 3SOXA 5C11A 3MHSA 1MM3A 2F6NA 2LRIC 2KWNA 3LJUX 2Y43A 4UP0A 2KE1A 2IQJA 2LXPC 4Q6FA 2MUMA 2ECGA 4WZ2A 2KFTA 3O7AA 2OWAA 4L58A 1HYIA 3O35A 4F1PA 2EGPA 3M7KA 3SHBA 2XEUA 3MDBC 5KH7A 1Z2QA 2ECJA 4A0CD 2G6QA 2H0DA 3ZNIA 2MKEA 2M1RA 2AN6A 2E6SA 2D8UA 4ZQLA 2ECWA 1WFKA 4WZ0A 2KGIA 3I2DA 1WEWA 5EYAF 2CSYA 2XOZA 5J3XA 3PURA 2VPGA 2CT2A 3IHPA 3O33A 5SVXA 2LV9A 2YUCA 2F42A 1X4IA 5KH3A 2I50A 4A49A 2JMJA 1CHCA 4LJNA 2QJ0A 4YBSA 4V3KC 4L7XA 5B78A 5KH9A 4FO9A 5C13A 5TABA 2FUIA 4UI9B 5H1UA 4Z0RA 3ZPVE 2B0OE 5JG6A 3M63A 4I7CA 4YBTA 1Z60A 1WE9A 2ECTA 5TRBA 1XWHA 3N9PA 3T7LA 2KWKA 1MM2A 4N4FA 2EXUA 3DQVR 3FM8C 2XOCA 2YQLA 5B75A 3LQIA 2Y1MA 2H0DB 2IDAA 1RMDA 2CRWA 4ZDTA 2C2VS 3E2DA 2XP0A 1DVPA 2FFWA 4PPEA 3ZYQA 4N3WA 2ECVA 3N9MA 4LLBA 4B86C 3PLWA 2FD4A 2KKXA 4FIPA 2E61A 1FBVA 3QZVA 1LDJB 5LKTA 1F62A 4CA1A 3JUEA 2YREA 5LKUA 3PHDA 2YT5A 3O34A 1FP0A 3GV4A 4W4UA 3NG2A 4MSXA 3RPGB 4YATA 3O36A 1N87A 3DDTA 3FANA 1T1HA 4AYCA 2JRJA 3LDYA 3O70A 2LGGA 2FUUA 4BBQA 4YC9A 3O37A 2KGGA 3EB6A 4IC2A 1WIMA 4YADA 2L7PA 1DCQA 2L75A 4S3OB 1V87A 4C9ZA 2VPDA 1WESA 4YAXA 5G05B 2L0BA 2L80A 2JMIA 2K4DA 3KV6A 2MA6A 3N9OA 2KREA 4R7EA 5FERA 1IYMA 3M99A 2BAYA 3T9KA 5D1KB 5TDRA 4GNEA 2ECNA 2Y1NA 1WEOA 2M3HA 5FB0A 5B79A 3LQHA 3C6WA 2EGMA 4GB0A 5LCWB 2DJAA 3U5OA 2CKLA 5LKZA 2XB1A 2CRRA 2UZGA 2VJFA 3ASLA 1ZBDB 2KWJA 2L5UA 4AYCB 3U5NA 2JUNA 2HYED 3N9LA 3LVRE 4I7BA 1WEPA 3RPGC 4X3GA 4A4CA 2LQ6A 3L11A 2QIZA 1WILA 2LDRA 2XOYA 5B76A 5AITA 5H1TA 4YBMA 4UP5A 1WEEA 2KYUA 3L1ZB 1JOCA 3PUQA 2F6JA 1JM7A 2YQMA 3MHHA 2YHNA 1VYXA 5I3LA 2K16A 2JMDA 5K3QA 2KR4A 2VP7A 4I7DA 3KNVA 2RSDA 2VJEA 3V43A 2L43A 2EA6A 4PTBA 2YYRA 2M85A 3HCSA 2YW8A 2CKLB 4R8PK 4P5OB 4OGEA 3ZVZB 5DKAA 2VJFB 4AUQB 1LDKC 2VPEA 4FJCA 3U5PA 3C5KA 4LADB 3HTKC 5D1MB 4XI1A 2ECIA 2LGKA 2MT5A 3ZPV1 3RTRB 3DPLR 3FJUB 3T6RA 2NAAA 4Z0OA 5H1VA 5FB1A 5TDWA 4GNFA 3LVQE 3SOWA 4YABA 2LN0A 2YHOA 4B7YC 3ZTGA 3O47A 1Z6UA 2QICA 4GNDA 3FL2A 4LKAA 5TBNA 5LKXA 2VNFA 3KDEC 4O64A 1WENA 4QF3A 4CCGX 2YVRA 5SVYA 3ZVYA 1U6GB 4AP4A 2JM3A 2PNXA 4O62A 2LGLA 2MA5A 5SVIA 2VPBA 2G45A 2MD7B 2MIQA 5G04B 1JM7B 2CSZA 2EODA 2RR4A 3HCTA 4OGCA
chains in the Genus database with same CATH topology
2G43A 4BHWA 4NN2A 5H9MA 3HCUA 4AVXA 5AIUA 2VJEB 4R2YA 5DINA 2C2LA 1WEQA 4QF2A 2LXHC 3GL6A 2M6MA 4MVTA 2E6RA 2YSMA 1X4UA 1WEMA 3LQJA 3KQIA 3U5MA 2MNYA 2YU4A 3EB5A 3KV5A 4LK9A 2HDPA 1G25A 1HYJA 1X4JA 2DX8A 4V3LC 3VK6A 2YURA 3N9NA 2MD8C 2D8SA 4S3OC 2PUYA 2KIZA 5B77A 3SOUA 5G0FA 3M62A 2RI7A 1BORA 4GNGA 2YSJA 3LRQA 4A4BA 1K2FA 4WZ3B 2OXQC 2FSAA 3L1XA 5B8DA 4F52B 2MNZA 4IC3A 2ZETC 1VFYA 4TKPB 5FEYA 3N9QA 1E4UA 4FK5A 4WA6A 1VD4A 4ZUXU 1WEVA 5D1LB 2KU3A 2K17A 1WGMA 2KWOA 1WEUA 2K1JA 3SOXA 2LGVA 5C11A 3MHSA 1MM3A 2F6NA 2LRIC 2KWNA 2Y43A 4UP0A 2KE1A 2LXPC 4Q6FA 2MUMA 2ECGA 4WZ2A 2KFTA 3O7AA 4L58A 1HYIA 3O35A 2EGPA 3SHBA 2XEUA 5KH7A 1Z2QA 2ECJA 4A0CD 2G6QA 2H0DA 3ZNIA 2M1RA 2AN6A 2E6SA 4ZQLA 2ECWA 1WFKA 4WZ0A 2KGIA 3I2DA 1WEWA 5EYAF 2CSYA 5J3XA 3PURA 2VPGA 2CT2A 3IHPA 3O33A 2LV9A 2YUCA 2F42A 1X4IA 5KH3A 2I50A 4A49A 2JMJA 1CHCA 4LJNA 2QJ0A 4YBSA 4V3KC 4L7XA 5B78A 5KH9A 4FO9A 5C13A 5TABA 2FUIA 4UI9B 5H1UA 3ZPVE 5JG6A 3M63A 4I7CA 4YBTA 1Z60A 1WE9A 2ECTA 5TRBA 1XWHA 3N9PA 3T7LA 2KWKA 1MM2A 4N4FA 3DQVR 2YQLA 5B75A 2Y1MA 3LQIA 2H0DB 2IDAA 1RMDA 4ZDTA 2C2VS 1DVPA 4PPEA 3ZYQA 4N3WA 2ECVA 3N9MA 4LLBA 4B86C 4FIPA 1FBVA 3QZVA 1LDJB 5LKTA 1F62A 4CA1A 2YREA 5LKUA 3PHDA 2YT5A 3O34A 1FP0A 3GV4A 4W4UA 3NG2A 4MSXA 3RPGB 4YATA 3O36A 1N87A 1T1HA 4AYCA 2JRJA 3O70A 2LGGA 2FUUA 4BBQA 4YC9A 3O37A 2KGGA 3EB6A 4IC2A 1WIMA 4YADA 2L75A 4S3OB 1V87A 4C9ZA 2VPDA 1WESA 4YAXA 5G05B 2L0BA 2L80A 2JMIA 2K4DA 3KV6A 2MA6A 3N9OA 2KREA 4R7EA 5FERA 1IYMA 3M99A 2BAYA 5D1KB 5TDRA 4GNEA 2ECNA 2Y1NA 1WEOA 2M3HA 5FB0A 5B79A 3LQHA 3C6WA 4GB0A 5LCWB 3U5OA 2CKLA 5LKZA 2XB1A 2UZGA 2VJFA 3ASLA 1ZBDB 2KWJA 2L5UA 4AYCB 3U5NA 2HYED 3N9LA 4I7BA 1WEPA 3RPGC 4X3GA 4A4CA 2LQ6A 3L11A 2QIZA 1WILA 2LDRA 5B76A 5AITA 5H1TA 4YBMA 4UP5A 1WEEA 2KYUA 3L1ZB 1JOCA 3PUQA 2F6JA 1JM7A 2YQMA 3MHHA 2YHNA 1VYXA 5I3LA 2K16A 2JMDA 2KR4A 2VP7A 4I7DA 3KNVA 2RSDA 2VJEA 3V43A 2L43A 2EA6A 4PTBA 2YYRA 2M85A 3HCSA 2YW8A 2CKLB 4R8PK 4P5OB 3ZVZB 5DKAA 2VJFB 4AUQB 1LDKC 2VPEA 4FJCA 3U5PA 3C5KA 4LADB 3HTKC 5D1MB 4XI1A 2ECIA 2LGKA 2MT5A 3ZPV1 3RTRB 3DPLR 3T6RA 2NAAA 5H1VA 5FB1A 5TDWA 4GNFA 3SOWA 4YABA 2LN0A 2YHOA 4B7YC 3ZTGA 1Z6UA 2QICA 4GNDA 3FL2A 4LKAA 5TBNA 5LKXA 2VNFA 4O64A 1WENA 4QF3A 4CCGX 3ZVYA 1U6GB 4AP4A 2PNXA 2LGLA 2MA5A 2VPBA 2G45A 2MD7B 2MIQA 5G04B 1JM7B 2CSZA 2EODA 3HCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G43 A;  4BHW A;  4NN2 A;  5H9M A;  3HCU A;  4AVX A;  5AIU A;  2VJE B;  4R2Y A;  5DIN A;  2C2L A;  1WEQ A;  4QF2 A;  2LXH C;  3GL6 A;  2M6M A;  4MVT A;  2E6R A;  2YSM A;  1X4U A;  1WEM A;  3LQJ A;  3KQI A;  3U5M A;  2MNY A;  2YU4 A;  3EB5 A;  3KV5 A;  4LK9 A;  2HDP A;  1G25 A;  1HYJ A;  1X4J A;  2DX8 A;  4V3L C;  3VK6 A;  2YUR A;  3N9N A;  2MD8 C;  2D8S A;  4S3O C;  2PUY A;  2KIZ A;  5B77 A;  3SOU A;  5G0F A;  3M62 A;  2RI7 A;  1BOR A;  4GNG A;  2YSJ A;  3LRQ A;  4A4B A;  1K2F A;  4WZ3 B;  2OXQ C;  2FSA A;  3L1X A;  5B8D A;  4F52 B;  2MNZ A;  4IC3 A;  2ZET C;  1VFY A;  4TKP B;  5FEY A;  3N9Q A;  1E4U A;  4FK5 A;  4WA6 A;  1VD4 A;  4ZUX U;  1WEV A;  5D1L B;  2KU3 A;  2K17 A;  1WGM A;  2KWO A;  1WEU A;  2K1J A;  3SOX A;  2LGV A;  5C11 A;  3MHS A;  1MM3 A;  2F6N A;  2LRI C;  2KWN A;  2Y43 A;  4UP0 A;  2KE1 A;  2LXP C;  4Q6F A;  2MUM A;  2ECG A;  4WZ2 A;  2KFT A;  3O7A A;  4L58 A;  1HYI A;  3O35 A;  2EGP A;  3SHB A;  2XEU A;  5KH7 A;  1Z2Q A;  2ECJ A;  4A0C D;  2G6Q A;  2H0D A;  3ZNI A;  2M1R A;  2AN6 A;  2E6S A;  4ZQL A;  2ECW A;  1WFK A;  4WZ0 A;  2KGI A;  3I2D A;  1WEW A;  5EYA F;  2CSY A;  5J3X A;  3PUR A;  2VPG A;  2CT2 A;  3IHP A;  3O33 A;  2LV9 A;  2YUC A;  2F42 A;  1X4I A;  5KH3 A;  2I50 A;  4A49 A;  2JMJ A;  1CHC A;  4LJN A;  2QJ0 A;  4YBS A;  4V3K C;  4L7X A;  5B78 A;  5KH9 A;  4FO9 A;  5C13 A;  5TAB A;  2FUI A;  4UI9 B;  5H1U A;  3ZPV E;  5JG6 A;  3M63 A;  4I7C A;  4YBT A;  1Z60 A;  1WE9 A;  2ECT A;  5TRB A;  1XWH A;  3N9P A;  3T7L A;  2KWK A;  1MM2 A;  4N4F A;  3DQV R;  2YQL A;  5B75 A;  2Y1M A;  3LQI A;  2H0D B;  2IDA A;  1RMD A;  4ZDT A;  2C2V S;  1DVP A;  4PPE A;  3ZYQ A;  4N3W A;  2ECV A;  3N9M A;  4LLB A;  4B86 C;  4FIP A;  1FBV A;  3QZV A;  1LDJ B;  5LKT A;  1F62 A;  4CA1 A;  2YRE A;  5LKU A;  3PHD A;  2YT5 A;  3O34 A;  1FP0 A;  3GV4 A;  4W4U A;  3NG2 A;  4MSX A;  3RPG B;  4YAT A;  3O36 A;  1N87 A;  1T1H A;  4AYC A;  2JRJ A;  3O70 A;  2LGG A;  2FUU A;  4BBQ A;  4YC9 A;  3O37 A;  2KGG A;  3EB6 A;  4IC2 A;  1WIM A;  4YAD A;  2L75 A;  4S3O B;  1V87 A;  4C9Z A;  2VPD A;  1WES A;  4YAX A;  5G05 B;  2L0B A;  2L80 A;  2JMI A;  2K4D A;  3KV6 A;  2MA6 A;  3N9O A;  2KRE A;  4R7E A;  5FER A;  1IYM A;  3M99 A;  2BAY A;  5D1K B;  5TDR A;  4GNE A;  2ECN A;  2Y1N A;  1WEO A;  2M3H A;  5FB0 A;  5B79 A;  3LQH A;  3C6W A;  4GB0 A;  5LCW B;  3U5O A;  2CKL A;  5LKZ A;  2XB1 A;  2UZG A;  2VJF A;  3ASL A;  1ZBD B;  2KWJ A;  2L5U A;  4AYC B;  3U5N A;  2HYE D;  3N9L A;  4I7B A;  1WEP A;  3RPG C;  4X3G A;  4A4C A;  2LQ6 A;  3L11 A;  2QIZ A;  1WIL A;  2LDR A;  5B76 A;  5AIT A;  5H1T A;  4YBM A;  4UP5 A;  1WEE A;  2KYU A;  3L1Z B;  1JOC A;  3PUQ A;  2F6J A;  1JM7 A;  2YQM A;  3MHH A;  2YHN A;  1VYX A;  5I3L A;  2K16 A;  2JMD A;  2KR4 A;  2VP7 A;  4I7D A;  3KNV A;  2RSD A;  2VJE A;  3V43 A;  2L43 A;  2EA6 A;  4PTB A;  2YYR A;  2M85 A;  3HCS A;  2YW8 A;  2CKL B;  4R8P K;  4P5O B;  3ZVZ B;  5DKA A;  2VJF B;  4AUQ B;  1LDK C;  2VPE A;  4FJC A;  3U5P A;  3C5K A;  4LAD B;  3HTK C;  5D1M B;  4XI1 A;  2ECI A;  2LGK A;  2MT5 A;  3ZPV 1;  3RTR B;  3DPL R;  3T6R A;  2NAA A;  5H1V A;  5FB1 A;  5TDW A;  4GNF A;  3SOW A;  4YAB A;  2LN0 A;  2YHO A;  4B7Y C;  3ZTG A;  1Z6U A;  2QIC A;  4GND A;  3FL2 A;  4LKA A;  5TBN A;  5LKX A;  2VNF A;  4O64 A;  1WEN A;  4QF3 A;  4CCG X;  3ZVY A;  1U6G B;  4AP4 A;  2PNX A;  2LGL A;  2MA5 A;  2VPB A;  2G45 A;  2MD7 B;  2MIQ A;  5G04 B;  1JM7 B;  2CSZ A;  2EOD A;  3HCT A; 
#chains in the Genus database with same CATH topology
 2G43 A;  4BHW A;  4NN2 A;  5H9M A;  3HCU A;  4AVX A;  5AIU A;  2VJE B;  4R2Y A;  5DIN A;  2DSM A;  2C2L A;  1WEQ A;  4QF2 A;  2LXH C;  3GL6 A;  3H7H A;  2M6M A;  4MVT A;  2E6R A;  2YSM A;  3DWD A;  1X4U A;  1WEM A;  3LQJ A;  3FEH A;  3KQI A;  3U5M A;  2MNY A;  2YU4 A;  4QQ4 A;  3EB5 A;  3KV5 A;  4LK9 A;  2HDP A;  1G25 A;  1HYJ A;  1X4J A;  2DX8 A;  4V3L C;  3VK6 A;  2YUR A;  2CON A;  3N9N A;  3SUB A;  2M13 A;  2MD8 C;  2LAU A;  2D8S A;  4S3O C;  2PUY A;  2KIZ A;  5B77 A;  3SOU A;  5G0F A;  3M62 A;  2RI7 A;  1BOR A;  4GNG A;  5SVI B;  2YSJ A;  3LRQ A;  4A4B A;  1K2F A;  4WZ3 B;  3FAO A;  2OXQ C;  2FSA A;  3L1X A;  2P57 A;  5B8D A;  4F52 B;  2MNZ A;  4IC3 A;  2CSV A;  2ZET C;  1VFY A;  4TKP B;  4H9D A;  5FEY A;  3N9Q A;  1E4U A;  4FK5 A;  2KKY A;  1MBM A;  4WA6 A;  1VD4 A;  4ZUX U;  1WEV A;  5D1L B;  2KU3 A;  2K17 A;  3Q1D A;  1WGM A;  2KWO A;  1WEU A;  2K1J A;  2LGV A;  3SOX A;  5C11 A;  3MHS A;  1MM3 A;  2F6N A;  2LRI C;  2KWN A;  3LJU X;  2Y43 A;  4UP0 A;  2KE1 A;  2IQJ A;  2LXP C;  4Q6F A;  2MUM A;  2ECG A;  4WZ2 A;  2KFT A;  3O7A A;  2OWA A;  4L58 A;  1HYI A;  3O35 A;  4F1P A;  2EGP A;  3M7K A;  3SHB A;  2XEU A;  3MDB C;  5KH7 A;  1Z2Q A;  2ECJ A;  4A0C D;  2G6Q A;  2H0D A;  3ZNI A;  2MKE A;  2M1R A;  2AN6 A;  2E6S A;  2D8U A;  4ZQL A;  2ECW A;  1WFK A;  4WZ0 A;  2KGI A;  3I2D A;  1WEW A;  5EYA F;  2CSY A;  2XOZ A;  5J3X A;  3PUR A;  2VPG A;  2CT2 A;  3IHP A;  3O33 A;  5SVX A;  2LV9 A;  2YUC A;  2F42 A;  1X4I A;  5KH3 A;  2I50 A;  4A49 A;  2JMJ A;  1CHC A;  4LJN A;  2QJ0 A;  4YBS A;  4V3K C;  4L7X A;  5B78 A;  5KH9 A;  4FO9 A;  5C13 A;  5TAB A;  2FUI A;  4UI9 B;  5H1U A;  4Z0R A;  3ZPV E;  2B0O E;  5JG6 A;  3M63 A;  4I7C A;  4YBT A;  1Z60 A;  1WE9 A;  2ECT A;  5TRB A;  1XWH A;  3N9P A;  3T7L A;  2KWK A;  1MM2 A;  4N4F A;  2EXU A;  3DQV R;  3FM8 C;  2XOC A;  2YQL A;  5B75 A;  3LQI A;  2Y1M A;  2H0D B;  2IDA A;  1RMD A;  2CRW A;  4ZDT A;  2C2V S;  3E2D A;  2XP0 A;  1DVP A;  2FFW A;  4PPE A;  3ZYQ A;  4N3W A;  2ECV A;  3N9M A;  4LLB A;  4B86 C;  3PLW A;  2FD4 A;  2KKX A;  4FIP A;  2E61 A;  1FBV A;  3QZV A;  1LDJ B;  5LKT A;  1F62 A;  4CA1 A;  3JUE A;  2YRE A;  5LKU A;  3PHD A;  2YT5 A;  3O34 A;  1FP0 A;  3GV4 A;  4W4U A;  3NG2 A;  4MSX A;  3RPG B;  4YAT A;  3O36 A;  1N87 A;  3DDT A;  3FAN A;  1T1H A;  4AYC A;  2JRJ A;  3LDY A;  3O70 A;  2LGG A;  2FUU A;  4BBQ A;  4YC9 A;  3O37 A;  2KGG A;  3EB6 A;  4IC2 A;  1WIM A;  4YAD A;  2L7P A;  1DCQ A;  2L75 A;  4S3O B;  1V87 A;  4C9Z A;  2VPD A;  1WES A;  4YAX A;  5G05 B;  2L0B A;  2L80 A;  2JMI A;  2K4D A;  3KV6 A;  2MA6 A;  3N9O A;  2KRE A;  4R7E A;  5FER A;  1IYM A;  3M99 A;  2BAY A;  3T9K A;  5D1K B;  5TDR A;  4GNE A;  2ECN A;  2Y1N A;  1WEO A;  2M3H A;  5FB0 A;  5B79 A;  3LQH A;  3C6W A;  2EGM A;  4GB0 A;  5LCW B;  2DJA A;  3U5O A;  2CKL A;  5LKZ A;  2XB1 A;  2CRR A;  2UZG A;  2VJF A;  3ASL A;  1ZBD B;  2KWJ A;  2L5U A;  4AYC B;  3U5N A;  2JUN A;  2HYE D;  3N9L A;  3LVR E;  4I7B A;  1WEP A;  3RPG C;  4X3G A;  4A4C A;  2LQ6 A;  3L11 A;  2QIZ A;  1WIL A;  2LDR A;  2XOY A;  5B76 A;  5AIT A;  5H1T A;  4YBM A;  4UP5 A;  1WEE A;  2KYU A;  3L1Z B;  1JOC A;  3PUQ A;  2F6J A;  1JM7 A;  2YQM A;  3MHH A;  2YHN A;  1VYX A;  5I3L A;  2K16 A;  2JMD A;  5K3Q A;  2KR4 A;  2VP7 A;  4I7D A;  3KNV A;  2RSD A;  2VJE A;  3V43 A;  2L43 A;  2EA6 A;  4PTB A;  2YYR A;  2M85 A;  3HCS A;  2YW8 A;  2CKL B;  4R8P K;  4P5O B;  4OGE A;  3ZVZ B;  5DKA A;  2VJF B;  4AUQ B;  1LDK C;  2VPE A;  4FJC A;  3U5P A;  3C5K A;  4LAD B;  3HTK C;  5D1M B;  4XI1 A;  2ECI A;  2LGK A;  2MT5 A;  3ZPV 1;  3RTR B;  3DPL R;  3FJU B;  3T6R A;  2NAA A;  4Z0O A;  5H1V A;  5FB1 A;  5TDW A;  4GNF A;  3LVQ E;  3SOW A;  4YAB A;  2LN0 A;  2YHO A;  4B7Y C;  3ZTG A;  3O47 A;  1Z6U A;  2QIC A;  4GND A;  3FL2 A;  4LKA A;  5TBN A;  5LKX A;  2VNF A;  3KDE C;  4O64 A;  1WEN A;  4QF3 A;  4CCG X;  2YVR A;  5SVY A;  3ZVY A;  1U6G B;  4AP4 A;  2JM3 A;  2PNX A;  4O62 A;  2LGL A;  2MA5 A;  5SVI A;  2VPB A;  2G45 A;  2MD7 B;  2MIQ A;  5G04 B;  1JM7 B;  2CSZ A;  2EOD A;  2RR4 A;  3HCT A;  4OGC A; 
#chains in the Genus database with same CATH homology
 2G43 A;  4BHW A;  4NN2 A;  5H9M A;  3HCU A;  4AVX A;  5AIU A;  2VJE B;  4R2Y A;  5DIN A;  2C2L A;  1WEQ A;  4QF2 A;  2LXH C;  3GL6 A;  2M6M A;  4MVT A;  2E6R A;  2YSM A;  1X4U A;  1WEM A;  3LQJ A;  3KQI A;  3U5M A;  2MNY A;  2YU4 A;  3EB5 A;  3KV5 A;  4LK9 A;  2HDP A;  1G25 A;  1HYJ A;  1X4J A;  2DX8 A;  4V3L C;  3VK6 A;  2YUR A;  3N9N A;  2MD8 C;  2D8S A;  4S3O C;  2PUY A;  2KIZ A;  5B77 A;  3SOU A;  5G0F A;  3M62 A;  2RI7 A;  1BOR A;  4GNG A;  2YSJ A;  3LRQ A;  4A4B A;  1K2F A;  4WZ3 B;  2OXQ C;  2FSA A;  3L1X A;  5B8D A;  4F52 B;  2MNZ A;  4IC3 A;  2ZET C;  1VFY A;  4TKP B;  5FEY A;  3N9Q A;  1E4U A;  4FK5 A;  4WA6 A;  1VD4 A;  4ZUX U;  1WEV A;  5D1L B;  2KU3 A;  2K17 A;  1WGM A;  2KWO A;  1WEU A;  2K1J A;  3SOX A;  2LGV A;  5C11 A;  3MHS A;  1MM3 A;  2F6N A;  2LRI C;  2KWN A;  2Y43 A;  4UP0 A;  2KE1 A;  2LXP C;  4Q6F A;  2MUM A;  2ECG A;  4WZ2 A;  2KFT A;  3O7A A;  4L58 A;  1HYI A;  3O35 A;  2EGP A;  3SHB A;  2XEU A;  5KH7 A;  1Z2Q A;  2ECJ A;  4A0C D;  2G6Q A;  2H0D A;  3ZNI A;  2M1R A;  2AN6 A;  2E6S A;  4ZQL A;  2ECW A;  1WFK A;  4WZ0 A;  2KGI A;  3I2D A;  1WEW A;  5EYA F;  2CSY A;  5J3X A;  3PUR A;  2VPG A;  2CT2 A;  3IHP A;  3O33 A;  2LV9 A;  2YUC A;  2F42 A;  1X4I A;  5KH3 A;  2I50 A;  4A49 A;  2JMJ A;  1CHC A;  4LJN A;  2QJ0 A;  4YBS A;  4V3K C;  4L7X A;  5B78 A;  5KH9 A;  4FO9 A;  5C13 A;  5TAB A;  2FUI A;  4UI9 B;  5H1U A;  3ZPV E;  5JG6 A;  3M63 A;  4I7C A;  4YBT A;  1Z60 A;  1WE9 A;  2ECT A;  5TRB A;  1XWH A;  3N9P A;  3T7L A;  2KWK A;  1MM2 A;  4N4F A;  3DQV R;  2YQL A;  5B75 A;  2Y1M A;  3LQI A;  2H0D B;  2IDA A;  1RMD A;  4ZDT A;  2C2V S;  1DVP A;  4PPE A;  3ZYQ A;  4N3W A;  2ECV A;  3N9M A;  4LLB A;  4B86 C;  4FIP A;  1FBV A;  3QZV A;  1LDJ B;  5LKT A;  1F62 A;  4CA1 A;  2YRE A;  5LKU A;  3PHD A;  2YT5 A;  3O34 A;  1FP0 A;  3GV4 A;  4W4U A;  3NG2 A;  4MSX A;  3RPG B;  4YAT A;  3O36 A;  1N87 A;  1T1H A;  4AYC A;  2JRJ A;  3O70 A;  2LGG A;  2FUU A;  4BBQ A;  4YC9 A;  3O37 A;  2KGG A;  3EB6 A;  4IC2 A;  1WIM A;  4YAD A;  2L75 A;  4S3O B;  1V87 A;  4C9Z A;  2VPD A;  1WES A;  4YAX A;  5G05 B;  2L0B A;  2L80 A;  2JMI A;  2K4D A;  3KV6 A;  2MA6 A;  3N9O A;  2KRE A;  4R7E A;  5FER A;  1IYM A;  3M99 A;  2BAY A;  5D1K B;  5TDR A;  4GNE A;  2ECN A;  2Y1N A;  1WEO A;  2M3H A;  5FB0 A;  5B79 A;  3LQH A;  3C6W A;  4GB0 A;  5LCW B;  3U5O A;  2CKL A;  5LKZ A;  2XB1 A;  2UZG A;  2VJF A;  3ASL A;  1ZBD B;  2KWJ A;  2L5U A;  4AYC B;  3U5N A;  2HYE D;  3N9L A;  4I7B A;  1WEP A;  3RPG C;  4X3G A;  4A4C A;  2LQ6 A;  3L11 A;  2QIZ A;  1WIL A;  2LDR A;  5B76 A;  5AIT A;  5H1T A;  4YBM A;  4UP5 A;  1WEE A;  2KYU A;  3L1Z B;  1JOC A;  3PUQ A;  2F6J A;  1JM7 A;  2YQM A;  3MHH A;  2YHN A;  1VYX A;  5I3L A;  2K16 A;  2JMD A;  2KR4 A;  2VP7 A;  4I7D A;  3KNV A;  2RSD A;  2VJE A;  3V43 A;  2L43 A;  2EA6 A;  4PTB A;  2YYR A;  2M85 A;  3HCS A;  2YW8 A;  2CKL B;  4R8P K;  4P5O B;  3ZVZ B;  5DKA A;  2VJF B;  4AUQ B;  1LDK C;  2VPE A;  4FJC A;  3U5P A;  3C5K A;  4LAD B;  3HTK C;  5D1M B;  4XI1 A;  2ECI A;  2LGK A;  2MT5 A;  3ZPV 1;  3RTR B;  3DPL R;  3T6R A;  2NAA A;  5H1V A;  5FB1 A;  5TDW A;  4GNF A;  3SOW A;  4YAB A;  2LN0 A;  2YHO A;  4B7Y C;  3ZTG A;  1Z6U A;  2QIC A;  4GND A;  3FL2 A;  4LKA A;  5TBN A;  5LKX A;  2VNF A;  4O64 A;  1WEN A;  4QF3 A;  4CCG X;  3ZVY A;  1U6G B;  4AP4 A;  2PNX A;  2LGL A;  2MA5 A;  2VPB A;  2G45 A;  2MD7 B;  2MIQ A;  5G04 B;  1JM7 B;  2CSZ A;  2EOD A;  3HCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...