2L43A

Structural basis for histone code recognition by brpf2-phd1 finger
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
80
Chain Sequence
ARTKQTARKSTGGSSGSSQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-teminal domain from Histone H3.3, LINKER, PHD1 domain from
publication title Recognition of unmodified histone H3 by the first PHD finger of Bromodomain-PHD finger protein 2 provides insights into the regulation of histone acetyltransferases MOZ and MORF
rcsb
source organism Homo sapiens, synthetic, homo sapiens
molecule tags Transcription
total genus 9
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13831 PHD_2 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l43A00
2LGGA 1WEOA 2LXHC 4S3OB 4IC3A 3EB6A 2PNXA 2MNYA 2KWNA 3L11A 2ECNA 4YATA 1WESA 2K4DA 4W4UA 2Y1MA 4BBQA 3U5NA 3KV5A 2VPGA 2UZGA 4YBTA 2VJEA 2M6MA 2CKLA 3KV6A 2Y1NA 2G6QA 2BAYA 2PUYA 4GNFA 1WILA 4AYCB 1WFKA 5KH3A 3IHPA 2YREA 5TDRA 2MD8C 2VPEA 2MA6A 3QZVA 2LDRA 5FB1A 4YAXA 2VP7A 3HCSA 2L0BA 2NAAA 2G45A 2LV9A 5B78A 5KH9A 4NN2A 2KE1A 2LGVA 3N9MA 3SOWA 2YSJA 1HYIA 2OXQC 5AITA 1MM2A 4GNGA 1N87A 3ZPVE 4I7BA 5JG6A 2FUIA 4YADA 3SOXA 1WEEA 3HTKC 2ECGA 1WEUA 1XWHA 2M1RA 3LQHA 5D1KB 5C13A 2CSYA 2L43A 1JM7B 2YQMA 4B86C 3NG2A 3U5MA 4R8PK 1X4UA 3ZVZB 4I7CA 4IC2A 2QJ0A 4V3LC 1U6GB 2YURA 2YUCA 3M99A 3N9OA 4FJCA 4QF2A 2C2VS 1IYMA 5I3LA 2KGGA 3VK6A 4CA1A 4PPEA 2K17A 2K16A 5AIUA 2KIZA 3SOUA 2AN6A 2H0DA 4FO9A 2RI7A 3C5KA 4S3OC 1Z60A 4QF3A 3DPLR 4ZQLA 3O35A 2CSZA 2LXPC 5G0FA 2LRIC 5H1TA 3KNVA 4I7DA 3T7LA 3LQIA 3U5OA 1LDJB 2KGIA 3O70A 1HYJA 2K1JA 2YQLA 1BORA 3PUQA 1WEPA 3C6WA 3ZPV1 5LKTA 2MIQA 1DVPA 2MUMA 3N9LA 1WE9A 4MSXA 2L75A 3ZTGA 2EA6A 2ECVA 2D8SA 1FBVA 3ASLA 4YABA 2XB1A 1CHCA 2IDAA 1Z2QA 2KR4A 3PURA 4R2YA 3ZYQA 3GV4A 3U5PA 4F52B 2VNFA 5LKXA 2M3HA 3N9QA 3ZVYA 1VYXA 4FIPA 2YT5A 2F6JA 2HDPA 2EODA 5EYAF 4LJNA 4N3WA 2JMDA 3T6RA 4FK5A 2LN0A 3N9PA 2YSMA 3FL2A 2VJFA 4AUQB 4O64A 4A4BA 5FERA 3DQVR 2L5UA 4BHWA 4R7EA 2JRJA 2I50A 3LRQA 5KH7A 1WEQA 2M85A 5DINA 4A4CA 3I2DA 2YHOA 4V3KC 3RPGC 5B76A 3LQJA 1RMDA 3SHBA 5B77A 4LK9A 2L80A 2EGPA 1JM7A 5J3XA 5H1UA 5LKZA 1WENA 5FB0A 2HYED 4L58A 4L7XA 2XEUA 3M63A 3N9NA 4GNEA 2ECIA 3EB5A 4YC9A 2VJEB 2CKLB 5FEYA 1ZBDB 4YBSA 5LKUA 4P5OB 2KU3A 4LADB 5DKAA 2KFTA 2C2LA 3O33A 4CCGX 2RSDA 2LGLA 2CT2A 5B79A 1K2FA 3PHDA 1FP0A 2YW8A 1E4UA 2MNZA 3O7AA 5G04B 3MHHA 4Q6FA 4WA6A 4LLBA 2E6SA 3O36A 5TABA 4LKAA 2KYUA 5B75A 2VPDA 1X4JA 1JOCA 5G05B 4PTBA 2E6RA 2KWOA 5H1VA 1WEWA 4N4FA 2G43A 2MT5A 3M62A 4A0CD 4C9ZA 4AVXA 2VPBA 3ZNIA 5B8DA 5H9MA 4GB0A 2FUUA 2Y43A 2YU4A 1VFYA 4GNDA 2VJFB 4AYCA 2JMJA 1WEVA 2ZETC 3O34A 1VD4A 4UP5A 2DX8A 2LQ6A 4B7YC 2KWKA 5D1LB 2ECTA 2F42A 5LCWB 1MM3A 2ECJA 2QIZA 4UP0A 5TDWA 1V87A 3O37A 4TKPB 1WIMA 2KWJA 4YBMA 2FSAA 2H0DB 4UI9B 1F62A 4X3GA 2KREA 1WGMA 4ZDTA 2YHNA 4A49A 3HCUA 1Z6UA 3MHSA 1G25A 3L1XA 5D1MB 5C11A 2JMIA 2QICA 4WZ0A 1T1HA 5TRBA 3V43A 2YYRA 3HCTA 2MD7B 4XI1A 3RPGB 1WEMA 4WZ3B 4ZUXU 2ECWA 4AP4A 4MVTA 1X4IA 3KQIA 3RTRB 2F6NA 2LGKA 2MA5A 4WZ2A 1LDKC 5TBNA 3GL6A 3L1ZB
chains in the Genus database with same CATH superfamily
2LGGA 1WEOA 2LXHC 4S3OB 4IC3A 3EB6A 2PNXA 2MNYA 2KWNA 3L11A 2ECNA 2EXUA 4YATA 1WESA 2IQJA 2K4DA 4W4UA 2Y1MA 4BBQA 3U5NA 3KV5A 2VPGA 2UZGA 4YBTA 2VJEA 2M6MA 2CKLA 3KV6A 2OWAA 2Y1NA 2G6QA 2BAYA 2PUYA 4GNFA 1WILA 4AYCB 3LJUX 1WFKA 5KH3A 3IHPA 2YREA 5TDRA 2MD8C 2VPEA 2MA6A 3FEHA 3QZVA 2LDRA 5FB1A 4YAXA 2VP7A 3HCSA 2L0BA 2NAAA 2G45A 2LV9A 5B78A 5KH9A 4NN2A 2KE1A 2LGVA 3N9MA 3SOWA 2YSJA 2B0OE 1HYIA 2OXQC 5AITA 1MM2A 2XP0A 4GNGA 1N87A 3ZPVE 4I7BA 5JG6A 2FUIA 4YADA 3SOXA 1WEEA 3FAOA 3T9KA 3DWDA 3HTKC 2ECGA 1WEUA 1XWHA 1DCQA 2M1RA 3LQHA 5D1KB 5C13A 2CSYA 5SVXA 2L43A 1JM7B 2YQMA 4B86C 3NG2A 3U5MA 4R8PK 1X4UA 3ZVZB 2CSVA 4I7CA 4IC2A 2QJ0A 3FM8C 4V3LC 1U6GB 2YURA 2YUCA 3M99A 3N9OA 4FJCA 5K3QA 4QF2A 2C2VS 3FANA 1IYMA 5I3LA 2KGGA 3VK6A 4CA1A 4PPEA 2K17A 3LVQE 2K16A 5AIUA 2KIZA 3SOUA 2AN6A 2H0DA 4FO9A 2RI7A 3C5KA 4S3OC 1Z60A 4QF3A 4O62A 3DPLR 4ZQLA 3O35A 2CSZA 2LXPC 5G0FA 2LRIC 5H1TA 4Z0OA 3LVRE 3KNVA 4I7DA 3T7LA 3LQIA 3U5OA 3JUEA 1LDJB 2KGIA 3O70A 1HYJA 3PLWA 2K1JA 2KKYA 2YQLA 1BORA 3PUQA 3KDEC 1WEPA 3C6WA 3ZPV1 5LKTA 2D8UA 2MIQA 1DVPA 2MUMA 3N9LA 1WE9A 4MSXA 2L75A 3ZTGA 2JM3A 2EA6A 2ECVA 2D8SA 1FBVA 3ASLA 4Z0RA 4YABA 2XB1A 1CHCA 2CRWA 2EGMA 1MBMA 2IDAA 1Z2QA 2KR4A 3PURA 2XOYA 4R2YA 3ZYQA 3GV4A 3U5PA 5SVIB 2DJAA 4F52B 2VNFA 5LKXA 5SVYA 2M3HA 3N9QA 3ZVYA 1VYXA 4FIPA 2YT5A 2F6JA 3H7HA 2HDPA 2EODA 5EYAF 4LJNA 4N3WA 2JMDA 3T6RA 4FK5A 2LN0A 3N9PA 2YSMA 3FL2A 2VJFA 4AUQB 4O64A 4A4BA 5FERA 3DQVR 2L5UA 4BHWA 4R7EA 2JRJA 2I50A 3LRQA 3MDBC 5KH7A 1WEQA 2M85A 5DINA 4A4CA 3I2DA 2YHOA 4V3KC 3FJUB 3RPGC 2XOZA 5B76A 3LQJA 1RMDA 2E61A 3SHBA 5B77A 4LK9A 2L80A 2RR4A 2EGPA 1JM7A 5J3XA 5H1UA 5LKZA 1WENA 5FB0A 2HYED 4L58A 4L7XA 2XEUA 3M63A 2FD4A 3O47A 3N9NA 4GNEA 2ECIA 3EB5A 4YC9A 2VJEB 2CKLB 3M7KA 5FEYA 1ZBDB 4YBSA 5LKUA 4P5OB 2KU3A 4LADB 4H9DA 5DKAA 2KFTA 2C2LA 3O33A 4CCGX 2RSDA 2CONA 2LGLA 2CT2A 5B79A 1K2FA 3PHDA 1FP0A 2YW8A 1E4UA 2DSMA 2MNZA 3O7AA 3LDYA 5G04B 3MHHA 4Q6FA 4WA6A 4LLBA 2E6SA 3O36A 5TABA 4LKAA 2KYUA 5B75A 2VPDA 1X4JA 1JOCA 5G05B 4PTBA 2E6RA 2KWOA 5H1VA 1WEWA 4N4FA 2G43A 2LAUA 2MT5A 2YVRA 3M62A 4A0CD 4C9ZA 3DDTA 4AVXA 2VPBA 3ZNIA 5B8DA 2FFWA 5H9MA 4GB0A 2FUUA 2Y43A 2YU4A 1VFYA 4GNDA 2VJFB 4AYCA 2KKXA 2JMJA 1WEVA 2ZETC 3O34A 1VD4A 4UP5A 2DX8A 2LQ6A 2P57A 4B7YC 2KWKA 5D1LB 2ECTA 3E2DA 2F42A 4F1PA 5LCWB 1MM3A 3SUBA 2ECJA 2QIZA 4UP0A 5TDWA 1V87A 3O37A 4TKPB 1WIMA 2KWJA 4OGCA 4YBMA 2FSAA 2M13A 2H0DB 4UI9B 1F62A 2L7PA 4X3GA 2KREA 1WGMA 4ZDTA 5SVIA 2YHNA 4A49A 3HCUA 1Z6UA 2MKEA 3MHSA 1G25A 3L1XA 4OGEA 2XOCA 5D1MB 5C11A 2JMIA 2QICA 4WZ0A 1T1HA 5TRBA 2CRRA 4QQ4A 3V43A 2YYRA 3HCTA 2MD7B 4XI1A 3RPGB 2JUNA 1WEMA 4WZ3B 4ZUXU 2ECWA 4AP4A 4MVTA 1X4IA 3KQIA 3RTRB 2F6NA 2LGKA 2MA5A 4WZ2A 1LDKC 5TBNA 3GL6A 3L1ZB 3Q1DA
chains in the Genus database with same CATH topology
2LGGA 1WEOA 2LXHC 4S3OB 4IC3A 3EB6A 2PNXA 2MNYA 2KWNA 3L11A 2ECNA 4YATA 1WESA 2K4DA 4W4UA 2Y1MA 4BBQA 3U5NA 3KV5A 2VPGA 2UZGA 4YBTA 2VJEA 2M6MA 2CKLA 3KV6A 2Y1NA 2G6QA 2BAYA 2PUYA 4GNFA 1WILA 4AYCB 1WFKA 5KH3A 3IHPA 2YREA 5TDRA 2MD8C 2VPEA 2MA6A 3QZVA 2LDRA 5FB1A 4YAXA 2VP7A 3HCSA 2L0BA 2NAAA 2G45A 2LV9A 5B78A 5KH9A 4NN2A 2KE1A 2LGVA 3N9MA 3SOWA 2YSJA 1HYIA 2OXQC 5AITA 1MM2A 4GNGA 1N87A 3ZPVE 4I7BA 5JG6A 2FUIA 4YADA 3SOXA 1WEEA 3HTKC 2ECGA 1WEUA 1XWHA 2M1RA 3LQHA 5D1KB 5C13A 2CSYA 2L43A 1JM7B 2YQMA 4B86C 3NG2A 3U5MA 4R8PK 1X4UA 3ZVZB 4I7CA 4IC2A 2QJ0A 4V3LC 1U6GB 2YURA 2YUCA 3M99A 3N9OA 4FJCA 4QF2A 2C2VS 1IYMA 5I3LA 2KGGA 3VK6A 4CA1A 4PPEA 2K17A 2K16A 5AIUA 2KIZA 3SOUA 2AN6A 2H0DA 4FO9A 2RI7A 3C5KA 4S3OC 1Z60A 4QF3A 3DPLR 4ZQLA 3O35A 2CSZA 2LXPC 5G0FA 2LRIC 5H1TA 3KNVA 4I7DA 3T7LA 3LQIA 3U5OA 1LDJB 2KGIA 3O70A 1HYJA 2K1JA 2YQLA 1BORA 3PUQA 1WEPA 3C6WA 3ZPV1 5LKTA 2MIQA 1DVPA 2MUMA 3N9LA 1WE9A 4MSXA 2L75A 3ZTGA 2EA6A 2ECVA 2D8SA 1FBVA 3ASLA 4YABA 2XB1A 1CHCA 2IDAA 1Z2QA 2KR4A 3PURA 4R2YA 3ZYQA 3GV4A 3U5PA 4F52B 2VNFA 5LKXA 2M3HA 3N9QA 3ZVYA 1VYXA 4FIPA 2YT5A 2F6JA 2HDPA 2EODA 5EYAF 4LJNA 4N3WA 2JMDA 3T6RA 4FK5A 2LN0A 3N9PA 2YSMA 3FL2A 2VJFA 4AUQB 4O64A 4A4BA 5FERA 3DQVR 2L5UA 4BHWA 4R7EA 2JRJA 2I50A 3LRQA 5KH7A 1WEQA 2M85A 5DINA 4A4CA 3I2DA 2YHOA 4V3KC 3RPGC 5B76A 3LQJA 1RMDA 3SHBA 5B77A 4LK9A 2L80A 2EGPA 1JM7A 5J3XA 5H1UA 5LKZA 1WENA 5FB0A 2HYED 4L58A 4L7XA 2XEUA 3M63A 3N9NA 4GNEA 2ECIA 3EB5A 4YC9A 2VJEB 2CKLB 5FEYA 1ZBDB 4YBSA 5LKUA 4P5OB 2KU3A 4LADB 5DKAA 2KFTA 2C2LA 3O33A 4CCGX 2RSDA 2LGLA 2CT2A 5B79A 1K2FA 3PHDA 1FP0A 2YW8A 1E4UA 2MNZA 3O7AA 5G04B 3MHHA 4Q6FA 4WA6A 4LLBA 2E6SA 3O36A 5TABA 4LKAA 2KYUA 5B75A 2VPDA 1X4JA 1JOCA 5G05B 4PTBA 2E6RA 2KWOA 5H1VA 1WEWA 4N4FA 2G43A 2MT5A 3M62A 4A0CD 4C9ZA 4AVXA 2VPBA 3ZNIA 5B8DA 5H9MA 4GB0A 2FUUA 2Y43A 2YU4A 1VFYA 4GNDA 2VJFB 4AYCA 2JMJA 1WEVA 2ZETC 3O34A 1VD4A 4UP5A 2DX8A 2LQ6A 4B7YC 2KWKA 5D1LB 2ECTA 2F42A 5LCWB 1MM3A 2ECJA 2QIZA 4UP0A 5TDWA 1V87A 3O37A 4TKPB 1WIMA 2KWJA 4YBMA 2FSAA 2H0DB 4UI9B 1F62A 4X3GA 2KREA 1WGMA 4ZDTA 2YHNA 4A49A 3HCUA 1Z6UA 3MHSA 1G25A 3L1XA 5D1MB 5C11A 2JMIA 2QICA 4WZ0A 1T1HA 5TRBA 3V43A 2YYRA 3HCTA 2MD7B 4XI1A 3RPGB 1WEMA 4WZ3B 4ZUXU 2ECWA 4AP4A 4MVTA 1X4IA 3KQIA 3RTRB 2F6NA 2LGKA 2MA5A 4WZ2A 1LDKC 5TBNA 3GL6A 3L1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGG A;  1WEO A;  2LXH C;  4S3O B;  4IC3 A;  3EB6 A;  2PNX A;  2MNY A;  2KWN A;  3L11 A;  2ECN A;  4YAT A;  1WES A;  2K4D A;  4W4U A;  2Y1M A;  4BBQ A;  3U5N A;  3KV5 A;  2VPG A;  2UZG A;  4YBT A;  2VJE A;  2M6M A;  2CKL A;  3KV6 A;  2Y1N A;  2G6Q A;  2BAY A;  2PUY A;  4GNF A;  1WIL A;  4AYC B;  1WFK A;  5KH3 A;  3IHP A;  2YRE A;  5TDR A;  2MD8 C;  2VPE A;  2MA6 A;  3QZV A;  2LDR A;  5FB1 A;  4YAX A;  2VP7 A;  3HCS A;  2L0B A;  2NAA A;  2G45 A;  2LV9 A;  5B78 A;  5KH9 A;  4NN2 A;  2KE1 A;  2LGV A;  3N9M A;  3SOW A;  2YSJ A;  1HYI A;  2OXQ C;  5AIT A;  1MM2 A;  4GNG A;  1N87 A;  3ZPV E;  4I7B A;  5JG6 A;  2FUI A;  4YAD A;  3SOX A;  1WEE A;  3HTK C;  2ECG A;  1WEU A;  1XWH A;  2M1R A;  3LQH A;  5D1K B;  5C13 A;  2CSY A;  2L43 A;  1JM7 B;  2YQM A;  4B86 C;  3NG2 A;  3U5M A;  4R8P K;  1X4U A;  3ZVZ B;  4I7C A;  4IC2 A;  2QJ0 A;  4V3L C;  1U6G B;  2YUR A;  2YUC A;  3M99 A;  3N9O A;  4FJC A;  4QF2 A;  2C2V S;  1IYM A;  5I3L A;  2KGG A;  3VK6 A;  4CA1 A;  4PPE A;  2K17 A;  2K16 A;  5AIU A;  2KIZ A;  3SOU A;  2AN6 A;  2H0D A;  4FO9 A;  2RI7 A;  3C5K A;  4S3O C;  1Z60 A;  4QF3 A;  3DPL R;  4ZQL A;  3O35 A;  2CSZ A;  2LXP C;  5G0F A;  2LRI C;  5H1T A;  3KNV A;  4I7D A;  3T7L A;  3LQI A;  3U5O A;  1LDJ B;  2KGI A;  3O70 A;  1HYJ A;  2K1J A;  2YQL A;  1BOR A;  3PUQ A;  1WEP A;  3C6W A;  3ZPV 1;  5LKT A;  2MIQ A;  1DVP A;  2MUM A;  3N9L A;  1WE9 A;  4MSX A;  2L75 A;  3ZTG A;  2EA6 A;  2ECV A;  2D8S A;  1FBV A;  3ASL A;  4YAB A;  2XB1 A;  1CHC A;  2IDA A;  1Z2Q A;  2KR4 A;  3PUR A;  4R2Y A;  3ZYQ A;  3GV4 A;  3U5P A;  4F52 B;  2VNF A;  5LKX A;  2M3H A;  3N9Q A;  3ZVY A;  1VYX A;  4FIP A;  2YT5 A;  2F6J A;  2HDP A;  2EOD A;  5EYA F;  4LJN A;  4N3W A;  2JMD A;  3T6R A;  4FK5 A;  2LN0 A;  3N9P A;  2YSM A;  3FL2 A;  2VJF A;  4AUQ B;  4O64 A;  4A4B A;  5FER A;  3DQV R;  2L5U A;  4BHW A;  4R7E A;  2JRJ A;  2I50 A;  3LRQ A;  5KH7 A;  1WEQ A;  2M85 A;  5DIN A;  4A4C A;  3I2D A;  2YHO A;  4V3K C;  3RPG C;  5B76 A;  3LQJ A;  1RMD A;  3SHB A;  5B77 A;  4LK9 A;  2L80 A;  2EGP A;  1JM7 A;  5J3X A;  5H1U A;  5LKZ A;  1WEN A;  5FB0 A;  2HYE D;  4L58 A;  4L7X A;  2XEU A;  3M63 A;  3N9N A;  4GNE A;  2ECI A;  3EB5 A;  4YC9 A;  2VJE B;  2CKL B;  5FEY A;  1ZBD B;  4YBS A;  5LKU A;  4P5O B;  2KU3 A;  4LAD B;  5DKA A;  2KFT A;  2C2L A;  3O33 A;  4CCG X;  2RSD A;  2LGL A;  2CT2 A;  5B79 A;  1K2F A;  3PHD A;  1FP0 A;  2YW8 A;  1E4U A;  2MNZ A;  3O7A A;  5G04 B;  3MHH A;  4Q6F A;  4WA6 A;  4LLB A;  2E6S A;  3O36 A;  5TAB A;  4LKA A;  2KYU A;  5B75 A;  2VPD A;  1X4J A;  1JOC A;  5G05 B;  4PTB A;  2E6R A;  2KWO A;  5H1V A;  1WEW A;  4N4F A;  2G43 A;  2MT5 A;  3M62 A;  4A0C D;  4C9Z A;  4AVX A;  2VPB A;  3ZNI A;  5B8D A;  5H9M A;  4GB0 A;  2FUU A;  2Y43 A;  2YU4 A;  1VFY A;  4GND A;  2VJF B;  4AYC A;  2JMJ A;  1WEV A;  2ZET C;  3O34 A;  1VD4 A;  4UP5 A;  2DX8 A;  2LQ6 A;  4B7Y C;  2KWK A;  5D1L B;  2ECT A;  2F42 A;  5LCW B;  1MM3 A;  2ECJ A;  2QIZ A;  4UP0 A;  5TDW A;  1V87 A;  3O37 A;  4TKP B;  1WIM A;  2KWJ A;  4YBM A;  2FSA A;  2H0D B;  4UI9 B;  1F62 A;  4X3G A;  2KRE A;  1WGM A;  4ZDT A;  2YHN A;  4A49 A;  3HCU A;  1Z6U A;  3MHS A;  1G25 A;  3L1X A;  5D1M B;  5C11 A;  2JMI A;  2QIC A;  4WZ0 A;  1T1H A;  5TRB A;  3V43 A;  2YYR A;  3HCT A;  2MD7 B;  4XI1 A;  3RPG B;  1WEM A;  4WZ3 B;  4ZUX U;  2ECW A;  4AP4 A;  4MVT A;  1X4I A;  3KQI A;  3RTR B;  2F6N A;  2LGK A;  2MA5 A;  4WZ2 A;  1LDK C;  5TBN A;  3GL6 A;  3L1Z B; 
#chains in the Genus database with same CATH topology
 2LGG A;  1WEO A;  2LXH C;  4S3O B;  4IC3 A;  3EB6 A;  2PNX A;  2MNY A;  2KWN A;  3L11 A;  2ECN A;  2EXU A;  4YAT A;  1WES A;  2IQJ A;  2K4D A;  4W4U A;  2Y1M A;  4BBQ A;  3U5N A;  3KV5 A;  2VPG A;  2UZG A;  4YBT A;  2VJE A;  2M6M A;  2CKL A;  3KV6 A;  2OWA A;  2Y1N A;  2G6Q A;  2BAY A;  2PUY A;  4GNF A;  1WIL A;  4AYC B;  3LJU X;  1WFK A;  5KH3 A;  3IHP A;  2YRE A;  5TDR A;  2MD8 C;  2VPE A;  2MA6 A;  3FEH A;  3QZV A;  2LDR A;  5FB1 A;  4YAX A;  2VP7 A;  3HCS A;  2L0B A;  2NAA A;  2G45 A;  2LV9 A;  5B78 A;  5KH9 A;  4NN2 A;  2KE1 A;  2LGV A;  3N9M A;  3SOW A;  2YSJ A;  2B0O E;  1HYI A;  2OXQ C;  5AIT A;  1MM2 A;  2XP0 A;  4GNG A;  1N87 A;  3ZPV E;  4I7B A;  5JG6 A;  2FUI A;  4YAD A;  3SOX A;  1WEE A;  3FAO A;  3T9K A;  3DWD A;  3HTK C;  2ECG A;  1WEU A;  1XWH A;  1DCQ A;  2M1R A;  3LQH A;  5D1K B;  5C13 A;  2CSY A;  5SVX A;  2L43 A;  1JM7 B;  2YQM A;  4B86 C;  3NG2 A;  3U5M A;  4R8P K;  1X4U A;  3ZVZ B;  2CSV A;  4I7C A;  4IC2 A;  2QJ0 A;  3FM8 C;  4V3L C;  1U6G B;  2YUR A;  2YUC A;  3M99 A;  3N9O A;  4FJC A;  5K3Q A;  4QF2 A;  2C2V S;  3FAN A;  1IYM A;  5I3L A;  2KGG A;  3VK6 A;  4CA1 A;  4PPE A;  2K17 A;  3LVQ E;  2K16 A;  5AIU A;  2KIZ A;  3SOU A;  2AN6 A;  2H0D A;  4FO9 A;  2RI7 A;  3C5K A;  4S3O C;  1Z60 A;  4QF3 A;  4O62 A;  3DPL R;  4ZQL A;  3O35 A;  2CSZ A;  2LXP C;  5G0F A;  2LRI C;  5H1T A;  4Z0O A;  3LVR E;  3KNV A;  4I7D A;  3T7L A;  3LQI A;  3U5O A;  3JUE A;  1LDJ B;  2KGI A;  3O70 A;  1HYJ A;  3PLW A;  2K1J A;  2KKY A;  2YQL A;  1BOR A;  3PUQ A;  3KDE C;  1WEP A;  3C6W A;  3ZPV 1;  5LKT A;  2D8U A;  2MIQ A;  1DVP A;  2MUM A;  3N9L A;  1WE9 A;  4MSX A;  2L75 A;  3ZTG A;  2JM3 A;  2EA6 A;  2ECV A;  2D8S A;  1FBV A;  3ASL A;  4Z0R A;  4YAB A;  2XB1 A;  1CHC A;  2CRW A;  2EGM A;  1MBM A;  2IDA A;  1Z2Q A;  2KR4 A;  3PUR A;  2XOY A;  4R2Y A;  3ZYQ A;  3GV4 A;  3U5P A;  5SVI B;  2DJA A;  4F52 B;  2VNF A;  5LKX A;  5SVY A;  2M3H A;  3N9Q A;  3ZVY A;  1VYX A;  4FIP A;  2YT5 A;  2F6J A;  3H7H A;  2HDP A;  2EOD A;  5EYA F;  4LJN A;  4N3W A;  2JMD A;  3T6R A;  4FK5 A;  2LN0 A;  3N9P A;  2YSM A;  3FL2 A;  2VJF A;  4AUQ B;  4O64 A;  4A4B A;  5FER A;  3DQV R;  2L5U A;  4BHW A;  4R7E A;  2JRJ A;  2I50 A;  3LRQ A;  3MDB C;  5KH7 A;  1WEQ A;  2M85 A;  5DIN A;  4A4C A;  3I2D A;  2YHO A;  4V3K C;  3FJU B;  3RPG C;  2XOZ A;  5B76 A;  3LQJ A;  1RMD A;  2E61 A;  3SHB A;  5B77 A;  4LK9 A;  2L80 A;  2RR4 A;  2EGP A;  1JM7 A;  5J3X A;  5H1U A;  5LKZ A;  1WEN A;  5FB0 A;  2HYE D;  4L58 A;  4L7X A;  2XEU A;  3M63 A;  2FD4 A;  3O47 A;  3N9N A;  4GNE A;  2ECI A;  3EB5 A;  4YC9 A;  2VJE B;  2CKL B;  3M7K A;  5FEY A;  1ZBD B;  4YBS A;  5LKU A;  4P5O B;  2KU3 A;  4LAD B;  4H9D A;  5DKA A;  2KFT A;  2C2L A;  3O33 A;  4CCG X;  2RSD A;  2CON A;  2LGL A;  2CT2 A;  5B79 A;  1K2F A;  3PHD A;  1FP0 A;  2YW8 A;  1E4U A;  2DSM A;  2MNZ A;  3O7A A;  3LDY A;  5G04 B;  3MHH A;  4Q6F A;  4WA6 A;  4LLB A;  2E6S A;  3O36 A;  5TAB A;  4LKA A;  2KYU A;  5B75 A;  2VPD A;  1X4J A;  1JOC A;  5G05 B;  4PTB A;  2E6R A;  2KWO A;  5H1V A;  1WEW A;  4N4F A;  2G43 A;  2LAU A;  2MT5 A;  2YVR A;  3M62 A;  4A0C D;  4C9Z A;  3DDT A;  4AVX A;  2VPB A;  3ZNI A;  5B8D A;  2FFW A;  5H9M A;  4GB0 A;  2FUU A;  2Y43 A;  2YU4 A;  1VFY A;  4GND A;  2VJF B;  4AYC A;  2KKX A;  2JMJ A;  1WEV A;  2ZET C;  3O34 A;  1VD4 A;  4UP5 A;  2DX8 A;  2LQ6 A;  2P57 A;  4B7Y C;  2KWK A;  5D1L B;  2ECT A;  3E2D A;  2F42 A;  4F1P A;  5LCW B;  1MM3 A;  3SUB A;  2ECJ A;  2QIZ A;  4UP0 A;  5TDW A;  1V87 A;  3O37 A;  4TKP B;  1WIM A;  2KWJ A;  4OGC A;  4YBM A;  2FSA A;  2M13 A;  2H0D B;  4UI9 B;  1F62 A;  2L7P A;  4X3G A;  2KRE A;  1WGM A;  4ZDT A;  5SVI A;  2YHN A;  4A49 A;  3HCU A;  1Z6U A;  2MKE A;  3MHS A;  1G25 A;  3L1X A;  4OGE A;  2XOC A;  5D1M B;  5C11 A;  2JMI A;  2QIC A;  4WZ0 A;  1T1H A;  5TRB A;  2CRR A;  4QQ4 A;  3V43 A;  2YYR A;  3HCT A;  2MD7 B;  4XI1 A;  3RPG B;  2JUN A;  1WEM A;  4WZ3 B;  4ZUX U;  2ECW A;  4AP4 A;  4MVT A;  1X4I A;  3KQI A;  3RTR B;  2F6N A;  2LGK A;  2MA5 A;  4WZ2 A;  1LDK C;  5TBN A;  3GL6 A;  3L1Z B;  3Q1D A; 
#chains in the Genus database with same CATH homology
 2LGG A;  1WEO A;  2LXH C;  4S3O B;  4IC3 A;  3EB6 A;  2PNX A;  2MNY A;  2KWN A;  3L11 A;  2ECN A;  4YAT A;  1WES A;  2K4D A;  4W4U A;  2Y1M A;  4BBQ A;  3U5N A;  3KV5 A;  2VPG A;  2UZG A;  4YBT A;  2VJE A;  2M6M A;  2CKL A;  3KV6 A;  2Y1N A;  2G6Q A;  2BAY A;  2PUY A;  4GNF A;  1WIL A;  4AYC B;  1WFK A;  5KH3 A;  3IHP A;  2YRE A;  5TDR A;  2MD8 C;  2VPE A;  2MA6 A;  3QZV A;  2LDR A;  5FB1 A;  4YAX A;  2VP7 A;  3HCS A;  2L0B A;  2NAA A;  2G45 A;  2LV9 A;  5B78 A;  5KH9 A;  4NN2 A;  2KE1 A;  2LGV A;  3N9M A;  3SOW A;  2YSJ A;  1HYI A;  2OXQ C;  5AIT A;  1MM2 A;  4GNG A;  1N87 A;  3ZPV E;  4I7B A;  5JG6 A;  2FUI A;  4YAD A;  3SOX A;  1WEE A;  3HTK C;  2ECG A;  1WEU A;  1XWH A;  2M1R A;  3LQH A;  5D1K B;  5C13 A;  2CSY A;  2L43 A;  1JM7 B;  2YQM A;  4B86 C;  3NG2 A;  3U5M A;  4R8P K;  1X4U A;  3ZVZ B;  4I7C A;  4IC2 A;  2QJ0 A;  4V3L C;  1U6G B;  2YUR A;  2YUC A;  3M99 A;  3N9O A;  4FJC A;  4QF2 A;  2C2V S;  1IYM A;  5I3L A;  2KGG A;  3VK6 A;  4CA1 A;  4PPE A;  2K17 A;  2K16 A;  5AIU A;  2KIZ A;  3SOU A;  2AN6 A;  2H0D A;  4FO9 A;  2RI7 A;  3C5K A;  4S3O C;  1Z60 A;  4QF3 A;  3DPL R;  4ZQL A;  3O35 A;  2CSZ A;  2LXP C;  5G0F A;  2LRI C;  5H1T A;  3KNV A;  4I7D A;  3T7L A;  3LQI A;  3U5O A;  1LDJ B;  2KGI A;  3O70 A;  1HYJ A;  2K1J A;  2YQL A;  1BOR A;  3PUQ A;  1WEP A;  3C6W A;  3ZPV 1;  5LKT A;  2MIQ A;  1DVP A;  2MUM A;  3N9L A;  1WE9 A;  4MSX A;  2L75 A;  3ZTG A;  2EA6 A;  2ECV A;  2D8S A;  1FBV A;  3ASL A;  4YAB A;  2XB1 A;  1CHC A;  2IDA A;  1Z2Q A;  2KR4 A;  3PUR A;  4R2Y A;  3ZYQ A;  3GV4 A;  3U5P A;  4F52 B;  2VNF A;  5LKX A;  2M3H A;  3N9Q A;  3ZVY A;  1VYX A;  4FIP A;  2YT5 A;  2F6J A;  2HDP A;  2EOD A;  5EYA F;  4LJN A;  4N3W A;  2JMD A;  3T6R A;  4FK5 A;  2LN0 A;  3N9P A;  2YSM A;  3FL2 A;  2VJF A;  4AUQ B;  4O64 A;  4A4B A;  5FER A;  3DQV R;  2L5U A;  4BHW A;  4R7E A;  2JRJ A;  2I50 A;  3LRQ A;  5KH7 A;  1WEQ A;  2M85 A;  5DIN A;  4A4C A;  3I2D A;  2YHO A;  4V3K C;  3RPG C;  5B76 A;  3LQJ A;  1RMD A;  3SHB A;  5B77 A;  4LK9 A;  2L80 A;  2EGP A;  1JM7 A;  5J3X A;  5H1U A;  5LKZ A;  1WEN A;  5FB0 A;  2HYE D;  4L58 A;  4L7X A;  2XEU A;  3M63 A;  3N9N A;  4GNE A;  2ECI A;  3EB5 A;  4YC9 A;  2VJE B;  2CKL B;  5FEY A;  1ZBD B;  4YBS A;  5LKU A;  4P5O B;  2KU3 A;  4LAD B;  5DKA A;  2KFT A;  2C2L A;  3O33 A;  4CCG X;  2RSD A;  2LGL A;  2CT2 A;  5B79 A;  1K2F A;  3PHD A;  1FP0 A;  2YW8 A;  1E4U A;  2MNZ A;  3O7A A;  5G04 B;  3MHH A;  4Q6F A;  4WA6 A;  4LLB A;  2E6S A;  3O36 A;  5TAB A;  4LKA A;  2KYU A;  5B75 A;  2VPD A;  1X4J A;  1JOC A;  5G05 B;  4PTB A;  2E6R A;  2KWO A;  5H1V A;  1WEW A;  4N4F A;  2G43 A;  2MT5 A;  3M62 A;  4A0C D;  4C9Z A;  4AVX A;  2VPB A;  3ZNI A;  5B8D A;  5H9M A;  4GB0 A;  2FUU A;  2Y43 A;  2YU4 A;  1VFY A;  4GND A;  2VJF B;  4AYC A;  2JMJ A;  1WEV A;  2ZET C;  3O34 A;  1VD4 A;  4UP5 A;  2DX8 A;  2LQ6 A;  4B7Y C;  2KWK A;  5D1L B;  2ECT A;  2F42 A;  5LCW B;  1MM3 A;  2ECJ A;  2QIZ A;  4UP0 A;  5TDW A;  1V87 A;  3O37 A;  4TKP B;  1WIM A;  2KWJ A;  4YBM A;  2FSA A;  2H0D B;  4UI9 B;  1F62 A;  4X3G A;  2KRE A;  1WGM A;  4ZDT A;  2YHN A;  4A49 A;  3HCU A;  1Z6U A;  3MHS A;  1G25 A;  3L1X A;  5D1M B;  5C11 A;  2JMI A;  2QIC A;  4WZ0 A;  1T1H A;  5TRB A;  3V43 A;  2YYR A;  3HCT A;  2MD7 B;  4XI1 A;  3RPG B;  1WEM A;  4WZ3 B;  4ZUX U;  2ECW A;  4AP4 A;  4MVT A;  1X4I A;  3KQI A;  3RTR B;  2F6N A;  2LGK A;  2MA5 A;  4WZ2 A;  1LDK C;  5TBN A;  3GL6 A;  3L1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...