2L43A

Structural basis for histone code recognition by brpf2-phd1 finger
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
80
Chain Sequence
b'ARTKQTARKSTGGSSGSSQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-teminal domain from Histone H3.3, LINKER, PHD1 domain from
publication title Recognition of unmodified histone H3 by the first PHD finger of Bromodomain-PHD finger protein 2 provides insights into the regulation of histone acetyltransferases MOZ and MORF
rcsb
source organism Homo sapiens, synthetic, homo sapiens
molecule tags Transcription
total genus 9
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13831 PHD_2 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l43A00
4A4CA 2KGGA 4PTBA 2E6SA 2RI7A 5H9MA 3M62A 2VJEA 2L75A 1X4JA 4A49A 2VPEA 3GV4A 2G45A 1WFKA 2YHOA 1VFYA 2M6MA 4QF3A 4YC9A 2MNYA 5B75A 1LDKC 5G05B 1IYMA 1MM3A 5LKTA 5H1TA 2KE1A 2G6QA 3FL2A 5TDRA 2QIZA 4P5OB 3L1XA 5B8DA 3RPGB 2M1RA 2JRJA 3T6RA 2YREA 4LK9A 2KREA 1HYJA 4FO9A 2YSJA 4L58A 4BBQA 2QJ0A 4LADB 3LQIA 2VNFA 2LGVA 2YQMA 5EYAF 2Y1MA 2KIZA 1U6GB 2CSZA 2YQLA 5AIUA 2NAAA 2VJFA 3V43A 1WIMA 3C5KA 2F42A 3N9MA 1HYIA 4AP4A 3GL6A 4C9ZA 1E4UA 3ZYQA 2HYED 3KQIA 4GB0A 2ECNA 2CT2A 4N3WA 1LDJB 3SOWA 2H0DA 2I50A 5TDWA 2MUMA 3PUQA 5FB0A 3O33A 3LQJA 2FUUA 4IC3A 4UP5A 3EB6A 4FIPA 4LKAA 1VD4A 3C6WA 4W4UA 5FEYA 4ZUXU 5H1UA 2KWNA 2ECVA 2ECJA 3ZPVE 3SOUA 2FUIA 2IDAA 3VK6A 4F52B 4S3OB 2KU3A 4ZDTA 2MD7B 3KV6A 2ECTA 3ASLA 3NG2A 3O34A 1WEQA 1X4UA 4WZ3B 2KR4A 1FP0A 4ZQLA 4A0CD 4TKPB 5JG6A 2VPBA 1K2FA 4B7YC 2L0BA 3KNVA 3U5MA 2RSDA 3HTKC 1DVPA 5J3XA 5KH9A 2LGLA 5TABA 4YBMA 4FK5A 1VYXA 2F6NA 5KH7A 1WEPA 4FJCA 2EGPA 2ECIA 4L7XA 2YT5A 3M99A 4BHWA 2FSAA 5LCWB 1WGMA 2YUCA 4MVTA 5I3LA 2M85A 4I7CA 1WEUA 2KWKA 3RTRB 4CCGX 4I7BA 2YYRA 3U5PA 2K4DA 2CKLB 5LKXA 2YW8A 5B78A 4I7DA 2MNZA 1Z60A 2VP7A 5FB1A 2Y43A 2KWOA 2MT5A 2Y1NA 3IHPA 3PHDA 3ZVZB 2QICA 4GNFA 1JOCA 3RPGC 5D1MB 4LLBA 3DPLR 2MIQA 4N4FA 1WEMA 4R8PK 2KFTA 2ECGA 4YATA 4YAXA 3SHBA 4GNDA 3O70A 4WA6A 3HCUA 2OXQC 4YABA 5DINA 2EODA 2PUYA 2LGKA 2DX8A 4V3KC 5D1LB 5B77A 4LJNA 4XI1A 5LKUA 3U5NA 4R2YA 1MM2A 1N87A 2XEUA 3PURA 3M63A 5B76A 2MD8C 2K1JA 3O36A 3ZVYA 3KV5A 2K17A 5FERA 3T7LA 2MA5A 3N9LA 5G04B 3ZTGA 5DKAA 4AYCB 3LQHA 3HCTA 4PPEA 1Z2QA 3O7AA 2ECWA 5C11A 2XB1A 1BORA 2C2LA 3EB5A 1WEWA 3O37A 4S3OC 3N9QA 2YURA 2ZETC 2LDRA 1WE9A 1F62A 2L43A 2YHNA 1JM7B 3L11A 2YSMA 2CKLA 1V87A 2KGIA 1RMDA 3MHSA 3QZVA 2M3HA 2L5UA 4X3GA 4YADA 2VJEB 1FBVA 4QF2A 2C2VS 4Q6FA 5G0FA 2LN0A 2LGGA 3SOXA 4IC2A 3ZNIA 3O35A 5TBNA 5C13A 5D1KB 4YBTA 4A4BA 3L1ZB 2F6JA 4CA1A 1T1HA 1X4IA 4NN2A 1ZBDB 2KYUA 2MA6A 4V3LC 3HCSA 4WZ0A 2UZGA 4GNEA 3N9NA 3N9OA 4UP0A 4YBSA 4R7EA 5TRBA 2D8SA 2JMDA 2G43A 2HDPA 1WESA 1WILA 2AN6A 3N9PA 2JMJA 2VJFB 3ZPV1 4AUQB 2LV9A 2JMIA 3I2DA 5H1VA 5KH3A 2CSYA 2EA6A 5B79A 1WEOA 4WZ2A 4AYCA 2L80A 1CHCA 3MHHA 1Z6UA 2YU4A 1WEEA 2VPDA 1WEVA 4GNGA 4AVXA 2LXHC 3LRQA 4UI9B 2H0DB 4B86C 2LXPC 1WENA 3DQVR 3U5OA 5LKZA 2PNXA 1G25A 2LQ6A 5AITA 2K16A 2VPGA 4MSXA 4O64A 2BAYA 2LRIC 1JM7A 1XWHA 2KWJA 2E6RA
chains in the Genus database with same CATH superfamily
2OWAA 4A4CA 2KGGA 4PTBA 2E6SA 2RI7A 5H9MA 3M62A 2VJEA 2L75A 1X4JA 4A49A 2VPEA 3GV4A 2G45A 1WFKA 2YHOA 1VFYA 2M6MA 4QF3A 4YC9A 2MNYA 5B75A 3KDEC 1LDKC 5G05B 1IYMA 1MM3A 5LKTA 5H1TA 2KE1A 2G6QA 3FL2A 5TDRA 2QIZA 4P5OB 3L1XA 5B8DA 4Z0OA 3RPGB 2M1RA 2JRJA 3T6RA 2CSVA 2XOZA 4H9DA 2YREA 3LDYA 4LK9A 2KREA 1HYJA 4FO9A 3DWDA 2YSJA 4L58A 4BBQA 2LAUA 2QJ0A 4LADB 3LQIA 2VNFA 2LGVA 2YQMA 3DDTA 5EYAF 2Y1MA 2MKEA 2KIZA 1U6GB 2CSZA 2YQLA 5AIUA 2NAAA 2B0OE 2VJFA 3V43A 2CONA 1WIMA 3O47A 3C5KA 2F42A 3N9MA 1HYIA 4AP4A 3GL6A 4C9ZA 1E4UA 3ZYQA 5SVYA 2HYED 3KQIA 2L7PA 2XOCA 4GB0A 2ECNA 2CT2A 4N3WA 1LDJB 3SOWA 2H0DA 2I50A 5TDWA 2MUMA 3PUQA 3O33A 5FB0A 5SVIA 3LQJA 2FUUA 4IC3A 4UP5A 3EB6A 4FIPA 4LKAA 4OGCA 1VD4A 2E61A 2KKXA 3C6WA 4W4UA 5FEYA 4ZUXU 5H1UA 3LJUX 2KWNA 2CRWA 2ECVA 2ECJA 5SVXA 3ZPVE 3SOUA 2FUIA 2IDAA 3VK6A 4F52B 4S3OB 2KU3A 4ZDTA 2MD7B 3KV6A 2ECTA 3ASLA 3NG2A 3O34A 1WEQA 1X4UA 4WZ3B 2KR4A 3MDBC 1FP0A 4ZQLA 4A0CD 4TKPB 5JG6A 2VPBA 1K2FA 4B7YC 2L0BA 3KNVA 3U5MA 2RSDA 3HTKC 1DVPA 3FEHA 5J3XA 5KH9A 2LGLA 5TABA 4YBMA 4FK5A 1VYXA 2F6NA 5KH7A 1WEPA 4FJCA 2EGPA 2ECIA 3FANA 4L7XA 2YT5A 3M99A 4BHWA 2FSAA 5LCWB 1WGMA 2YUCA 4MVTA 5I3LA 2M85A 4I7CA 1WEUA 2KWKA 3RTRB 4CCGX 4I7BA 4QQ4A 2YYRA 3U5PA 2K4DA 2CKLB 5LKXA 2YW8A 5B78A 4I7DA 2MNZA 1Z60A 2VP7A 5FB1A 2Y43A 2KWOA 2MT5A 2Y1NA 3IHPA 3PHDA 3ZVZB 2QICA 4GNFA 1JOCA 3RPGC 5D1MB 4LLBA 3DPLR 2MIQA 3PLWA 2CRRA 4N4FA 1WEMA 4R8PK 3H7HA 3JUEA 2KFTA 2ECGA 4YATA 4YAXA 2DSMA 3SHBA 4GNDA 2EGMA 3O70A 4WA6A 3HCUA 2OXQC 4YABA 5DINA 2EODA 2PUYA 2LGKA 2DX8A 4V3KC 2XP0A 5D1LB 5B77A 4LJNA 4XI1A 5LKUA 2XOYA 3U5NA 4R2YA 3LVRE 1MM2A 1N87A 2XEUA 3PURA 3M63A 5B76A 2MD8C 2K1JA 3O36A 3ZVYA 3KV5A 2K17A 5FERA 3T7LA 2FD4A 3E2DA 2MA5A 3N9LA 5G04B 2KKYA 3ZTGA 1DCQA 5DKAA 4AYCB 3LQHA 3M7KA 3HCTA 4PPEA 1Z2QA 3O7AA 2ECWA 5C11A 2EXUA 2XB1A 1BORA 2C2LA 3EB5A 1WEWA 3O37A 4S3OC 3N9QA 2YURA 2ZETC 2LDRA 3Q1DA 1WE9A 1F62A 2L43A 2YHNA 1JM7B 3L11A 2YSMA 2CKLA 1V87A 2KGIA 1RMDA 3MHSA 3QZVA 2M3HA 2L5UA 4X3GA 3T9KA 4YADA 2VJEB 1FBVA 3FM8C 2D8UA 4QF2A 2C2VS 4Q6FA 5G0FA 2LN0A 2M13A 2LGGA 3SOXA 4IC2A 3ZNIA 3O35A 5TBNA 5C13A 5D1KB 3FJUB 4YBTA 2RR4A 4A4BA 3L1ZB 2F6JA 4CA1A 2FFWA 2YVRA 1T1HA 1X4IA 3SUBA 4NN2A 1ZBDB 5K3QA 3LVQE 2KYUA 2MA6A 4OGEA 4V3LC 3HCSA 4WZ0A 2UZGA 4GNEA 3N9NA 3N9OA 4UP0A 4YBSA 2IQJA 2DJAA 4R7EA 5TRBA 2D8SA 2JMDA 2G43A 2HDPA 1WESA 1WILA 2AN6A 3N9PA 2JMJA 2VJFB 3ZPV1 4AUQB 2LV9A 2JMIA 3I2DA 5H1VA 4F1PA 5KH3A 2CSYA 2EA6A 2JUNA 5B79A 1WEOA 4WZ2A 4AYCA 2L80A 1CHCA 3MHHA 1Z6UA 2YU4A 1WEEA 3FAOA 2VPDA 1WEVA 4GNGA 4AVXA 2LXHC 3LRQA 4UI9B 2P57A 2H0DB 4B86C 2LXPC 1WENA 5SVIB 3DQVR 3U5OA 5LKZA 1MBMA 2PNXA 1G25A 2LQ6A 5AITA 2K16A 2VPGA 4MSXA 4O64A 2BAYA 2LRIC 1JM7A 1XWHA 4O62A 2KWJA 4Z0RA 2JM3A 2E6RA
chains in the Genus database with same CATH topology
4A4CA 2KGGA 4PTBA 2E6SA 2RI7A 5H9MA 3M62A 2VJEA 2L75A 1X4JA 4A49A 2VPEA 3GV4A 2G45A 1WFKA 2YHOA 1VFYA 2M6MA 4QF3A 4YC9A 2MNYA 5B75A 1LDKC 5G05B 1IYMA 1MM3A 5LKTA 5H1TA 2KE1A 2G6QA 3FL2A 5TDRA 2QIZA 4P5OB 3L1XA 5B8DA 3RPGB 2M1RA 2JRJA 3T6RA 2YREA 4LK9A 2KREA 1HYJA 4FO9A 2YSJA 4L58A 4BBQA 2QJ0A 4LADB 3LQIA 2VNFA 2LGVA 2YQMA 5EYAF 2Y1MA 2KIZA 1U6GB 2CSZA 2YQLA 5AIUA 2NAAA 2VJFA 3V43A 1WIMA 3C5KA 2F42A 3N9MA 1HYIA 4AP4A 3GL6A 4C9ZA 1E4UA 3ZYQA 2HYED 3KQIA 4GB0A 2ECNA 2CT2A 4N3WA 1LDJB 3SOWA 2H0DA 2I50A 5TDWA 2MUMA 3PUQA 5FB0A 3O33A 3LQJA 2FUUA 4IC3A 4UP5A 3EB6A 4FIPA 4LKAA 1VD4A 3C6WA 4W4UA 5FEYA 4ZUXU 5H1UA 2KWNA 2ECVA 2ECJA 3ZPVE 3SOUA 2FUIA 2IDAA 3VK6A 4F52B 4S3OB 2KU3A 4ZDTA 2MD7B 3KV6A 2ECTA 3ASLA 3NG2A 3O34A 1WEQA 1X4UA 4WZ3B 2KR4A 1FP0A 4ZQLA 4A0CD 4TKPB 5JG6A 2VPBA 1K2FA 4B7YC 2L0BA 3KNVA 3U5MA 2RSDA 3HTKC 1DVPA 5J3XA 5KH9A 2LGLA 5TABA 4YBMA 4FK5A 1VYXA 2F6NA 5KH7A 1WEPA 4FJCA 2EGPA 2ECIA 4L7XA 2YT5A 3M99A 4BHWA 2FSAA 5LCWB 1WGMA 2YUCA 4MVTA 5I3LA 2M85A 4I7CA 1WEUA 2KWKA 3RTRB 4CCGX 4I7BA 2YYRA 3U5PA 2K4DA 2CKLB 5LKXA 2YW8A 5B78A 4I7DA 2MNZA 1Z60A 2VP7A 5FB1A 2Y43A 2KWOA 2MT5A 2Y1NA 3IHPA 3PHDA 3ZVZB 2QICA 4GNFA 1JOCA 3RPGC 5D1MB 4LLBA 3DPLR 2MIQA 4N4FA 1WEMA 4R8PK 2KFTA 2ECGA 4YATA 4YAXA 3SHBA 4GNDA 3O70A 4WA6A 3HCUA 2OXQC 4YABA 5DINA 2EODA 2PUYA 2LGKA 2DX8A 4V3KC 5D1LB 5B77A 4LJNA 4XI1A 5LKUA 3U5NA 4R2YA 1MM2A 1N87A 2XEUA 3PURA 3M63A 5B76A 2MD8C 2K1JA 3O36A 3ZVYA 3KV5A 2K17A 5FERA 3T7LA 2MA5A 3N9LA 5G04B 3ZTGA 5DKAA 4AYCB 3LQHA 3HCTA 4PPEA 1Z2QA 3O7AA 2ECWA 5C11A 2XB1A 1BORA 2C2LA 3EB5A 1WEWA 3O37A 4S3OC 3N9QA 2YURA 2ZETC 2LDRA 1WE9A 1F62A 2L43A 2YHNA 1JM7B 3L11A 2YSMA 2CKLA 1V87A 2KGIA 1RMDA 3MHSA 3QZVA 2M3HA 2L5UA 4X3GA 4YADA 2VJEB 1FBVA 4QF2A 2C2VS 4Q6FA 5G0FA 2LN0A 2LGGA 3SOXA 4IC2A 3ZNIA 3O35A 5TBNA 5C13A 5D1KB 4YBTA 4A4BA 3L1ZB 2F6JA 4CA1A 1T1HA 1X4IA 4NN2A 1ZBDB 2KYUA 2MA6A 4V3LC 3HCSA 4WZ0A 2UZGA 4GNEA 3N9NA 3N9OA 4UP0A 4YBSA 4R7EA 5TRBA 2D8SA 2JMDA 2G43A 2HDPA 1WESA 1WILA 2AN6A 3N9PA 2JMJA 2VJFB 3ZPV1 4AUQB 2LV9A 2JMIA 3I2DA 5H1VA 5KH3A 2CSYA 2EA6A 5B79A 1WEOA 4WZ2A 4AYCA 2L80A 1CHCA 3MHHA 1Z6UA 2YU4A 1WEEA 2VPDA 1WEVA 4GNGA 4AVXA 2LXHC 3LRQA 4UI9B 2H0DB 4B86C 2LXPC 1WENA 3DQVR 3U5OA 5LKZA 2PNXA 1G25A 2LQ6A 5AITA 2K16A 2VPGA 4MSXA 4O64A 2BAYA 2LRIC 1JM7A 1XWHA 2KWJA 2E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4C A;  2KGG A;  4PTB A;  2E6S A;  2RI7 A;  5H9M A;  3M62 A;  2VJE A;  2L75 A;  1X4J A;  4A49 A;  2VPE A;  3GV4 A;  2G45 A;  1WFK A;  2YHO A;  1VFY A;  2M6M A;  4QF3 A;  4YC9 A;  2MNY A;  5B75 A;  1LDK C;  5G05 B;  1IYM A;  1MM3 A;  5LKT A;  5H1T A;  2KE1 A;  2G6Q A;  3FL2 A;  5TDR A;  2QIZ A;  4P5O B;  3L1X A;  5B8D A;  3RPG B;  2M1R A;  2JRJ A;  3T6R A;  2YRE A;  4LK9 A;  2KRE A;  1HYJ A;  4FO9 A;  2YSJ A;  4L58 A;  4BBQ A;  2QJ0 A;  4LAD B;  3LQI A;  2VNF A;  2LGV A;  2YQM A;  5EYA F;  2Y1M A;  2KIZ A;  1U6G B;  2CSZ A;  2YQL A;  5AIU A;  2NAA A;  2VJF A;  3V43 A;  1WIM A;  3C5K A;  2F42 A;  3N9M A;  1HYI A;  4AP4 A;  3GL6 A;  4C9Z A;  1E4U A;  3ZYQ A;  2HYE D;  3KQI A;  4GB0 A;  2ECN A;  2CT2 A;  4N3W A;  1LDJ B;  3SOW A;  2H0D A;  2I50 A;  5TDW A;  2MUM A;  3PUQ A;  5FB0 A;  3O33 A;  3LQJ A;  2FUU A;  4IC3 A;  4UP5 A;  3EB6 A;  4FIP A;  4LKA A;  1VD4 A;  3C6W A;  4W4U A;  5FEY A;  4ZUX U;  5H1U A;  2KWN A;  2ECV A;  2ECJ A;  3ZPV E;  3SOU A;  2FUI A;  2IDA A;  3VK6 A;  4F52 B;  4S3O B;  2KU3 A;  4ZDT A;  2MD7 B;  3KV6 A;  2ECT A;  3ASL A;  3NG2 A;  3O34 A;  1WEQ A;  1X4U A;  4WZ3 B;  2KR4 A;  1FP0 A;  4ZQL A;  4A0C D;  4TKP B;  5JG6 A;  2VPB A;  1K2F A;  4B7Y C;  2L0B A;  3KNV A;  3U5M A;  2RSD A;  3HTK C;  1DVP A;  5J3X A;  5KH9 A;  2LGL A;  5TAB A;  4YBM A;  4FK5 A;  1VYX A;  2F6N A;  5KH7 A;  1WEP A;  4FJC A;  2EGP A;  2ECI A;  4L7X A;  2YT5 A;  3M99 A;  4BHW A;  2FSA A;  5LCW B;  1WGM A;  2YUC A;  4MVT A;  5I3L A;  2M85 A;  4I7C A;  1WEU A;  2KWK A;  3RTR B;  4CCG X;  4I7B A;  2YYR A;  3U5P A;  2K4D A;  2CKL B;  5LKX A;  2YW8 A;  5B78 A;  4I7D A;  2MNZ A;  1Z60 A;  2VP7 A;  5FB1 A;  2Y43 A;  2KWO A;  2MT5 A;  2Y1N A;  3IHP A;  3PHD A;  3ZVZ B;  2QIC A;  4GNF A;  1JOC A;  3RPG C;  5D1M B;  4LLB A;  3DPL R;  2MIQ A;  4N4F A;  1WEM A;  4R8P K;  2KFT A;  2ECG A;  4YAT A;  4YAX A;  3SHB A;  4GND A;  3O70 A;  4WA6 A;  3HCU A;  2OXQ C;  4YAB A;  5DIN A;  2EOD A;  2PUY A;  2LGK A;  2DX8 A;  4V3K C;  5D1L B;  5B77 A;  4LJN A;  4XI1 A;  5LKU A;  3U5N A;  4R2Y A;  1MM2 A;  1N87 A;  2XEU A;  3PUR A;  3M63 A;  5B76 A;  2MD8 C;  2K1J A;  3O36 A;  3ZVY A;  3KV5 A;  2K17 A;  5FER A;  3T7L A;  2MA5 A;  3N9L A;  5G04 B;  3ZTG A;  5DKA A;  4AYC B;  3LQH A;  3HCT A;  4PPE A;  1Z2Q A;  3O7A A;  2ECW A;  5C11 A;  2XB1 A;  1BOR A;  2C2L A;  3EB5 A;  1WEW A;  3O37 A;  4S3O C;  3N9Q A;  2YUR A;  2ZET C;  2LDR A;  1WE9 A;  1F62 A;  2L43 A;  2YHN A;  1JM7 B;  3L11 A;  2YSM A;  2CKL A;  1V87 A;  2KGI A;  1RMD A;  3MHS A;  3QZV A;  2M3H A;  2L5U A;  4X3G A;  4YAD A;  2VJE B;  1FBV A;  4QF2 A;  2C2V S;  4Q6F A;  5G0F A;  2LN0 A;  2LGG A;  3SOX A;  4IC2 A;  3ZNI A;  3O35 A;  5TBN A;  5C13 A;  5D1K B;  4YBT A;  4A4B A;  3L1Z B;  2F6J A;  4CA1 A;  1T1H A;  1X4I A;  4NN2 A;  1ZBD B;  2KYU A;  2MA6 A;  4V3L C;  3HCS A;  4WZ0 A;  2UZG A;  4GNE A;  3N9N A;  3N9O A;  4UP0 A;  4YBS A;  4R7E A;  5TRB A;  2D8S A;  2JMD A;  2G43 A;  2HDP A;  1WES A;  1WIL A;  2AN6 A;  3N9P A;  2JMJ A;  2VJF B;  3ZPV 1;  4AUQ B;  2LV9 A;  2JMI A;  3I2D A;  5H1V A;  5KH3 A;  2CSY A;  2EA6 A;  5B79 A;  1WEO A;  4WZ2 A;  4AYC A;  2L80 A;  1CHC A;  3MHH A;  1Z6U A;  2YU4 A;  1WEE A;  2VPD A;  1WEV A;  4GNG A;  4AVX A;  2LXH C;  3LRQ A;  4UI9 B;  2H0D B;  4B86 C;  2LXP C;  1WEN A;  3DQV R;  3U5O A;  5LKZ A;  2PNX A;  1G25 A;  2LQ6 A;  5AIT A;  2K16 A;  2VPG A;  4MSX A;  4O64 A;  2BAY A;  2LRI C;  1JM7 A;  1XWH A;  2KWJ A;  2E6R A; 
#chains in the Genus database with same CATH topology
 2OWA A;  4A4C A;  2KGG A;  4PTB A;  2E6S A;  2RI7 A;  5H9M A;  3M62 A;  2VJE A;  2L75 A;  1X4J A;  4A49 A;  2VPE A;  3GV4 A;  2G45 A;  1WFK A;  2YHO A;  1VFY A;  2M6M A;  4QF3 A;  4YC9 A;  2MNY A;  5B75 A;  3KDE C;  1LDK C;  5G05 B;  1IYM A;  1MM3 A;  5LKT A;  5H1T A;  2KE1 A;  2G6Q A;  3FL2 A;  5TDR A;  2QIZ A;  4P5O B;  3L1X A;  5B8D A;  4Z0O A;  3RPG B;  2M1R A;  2JRJ A;  3T6R A;  2CSV A;  2XOZ A;  4H9D A;  2YRE A;  3LDY A;  4LK9 A;  2KRE A;  1HYJ A;  4FO9 A;  3DWD A;  2YSJ A;  4L58 A;  4BBQ A;  2LAU A;  2QJ0 A;  4LAD B;  3LQI A;  2VNF A;  2LGV A;  2YQM A;  3DDT A;  5EYA F;  2Y1M A;  2MKE A;  2KIZ A;  1U6G B;  2CSZ A;  2YQL A;  5AIU A;  2NAA A;  2B0O E;  2VJF A;  3V43 A;  2CON A;  1WIM A;  3O47 A;  3C5K A;  2F42 A;  3N9M A;  1HYI A;  4AP4 A;  3GL6 A;  4C9Z A;  1E4U A;  3ZYQ A;  5SVY A;  2HYE D;  3KQI A;  2L7P A;  2XOC A;  4GB0 A;  2ECN A;  2CT2 A;  4N3W A;  1LDJ B;  3SOW A;  2H0D A;  2I50 A;  5TDW A;  2MUM A;  3PUQ A;  3O33 A;  5FB0 A;  5SVI A;  3LQJ A;  2FUU A;  4IC3 A;  4UP5 A;  3EB6 A;  4FIP A;  4LKA A;  4OGC A;  1VD4 A;  2E61 A;  2KKX A;  3C6W A;  4W4U A;  5FEY A;  4ZUX U;  5H1U A;  3LJU X;  2KWN A;  2CRW A;  2ECV A;  2ECJ A;  5SVX A;  3ZPV E;  3SOU A;  2FUI A;  2IDA A;  3VK6 A;  4F52 B;  4S3O B;  2KU3 A;  4ZDT A;  2MD7 B;  3KV6 A;  2ECT A;  3ASL A;  3NG2 A;  3O34 A;  1WEQ A;  1X4U A;  4WZ3 B;  2KR4 A;  3MDB C;  1FP0 A;  4ZQL A;  4A0C D;  4TKP B;  5JG6 A;  2VPB A;  1K2F A;  4B7Y C;  2L0B A;  3KNV A;  3U5M A;  2RSD A;  3HTK C;  1DVP A;  3FEH A;  5J3X A;  5KH9 A;  2LGL A;  5TAB A;  4YBM A;  4FK5 A;  1VYX A;  2F6N A;  5KH7 A;  1WEP A;  4FJC A;  2EGP A;  2ECI A;  3FAN A;  4L7X A;  2YT5 A;  3M99 A;  4BHW A;  2FSA A;  5LCW B;  1WGM A;  2YUC A;  4MVT A;  5I3L A;  2M85 A;  4I7C A;  1WEU A;  2KWK A;  3RTR B;  4CCG X;  4I7B A;  4QQ4 A;  2YYR A;  3U5P A;  2K4D A;  2CKL B;  5LKX A;  2YW8 A;  5B78 A;  4I7D A;  2MNZ A;  1Z60 A;  2VP7 A;  5FB1 A;  2Y43 A;  2KWO A;  2MT5 A;  2Y1N A;  3IHP A;  3PHD A;  3ZVZ B;  2QIC A;  4GNF A;  1JOC A;  3RPG C;  5D1M B;  4LLB A;  3DPL R;  2MIQ A;  3PLW A;  2CRR A;  4N4F A;  1WEM A;  4R8P K;  3H7H A;  3JUE A;  2KFT A;  2ECG A;  4YAT A;  4YAX A;  2DSM A;  3SHB A;  4GND A;  2EGM A;  3O70 A;  4WA6 A;  3HCU A;  2OXQ C;  4YAB A;  5DIN A;  2EOD A;  2PUY A;  2LGK A;  2DX8 A;  4V3K C;  2XP0 A;  5D1L B;  5B77 A;  4LJN A;  4XI1 A;  5LKU A;  2XOY A;  3U5N A;  4R2Y A;  3LVR E;  1MM2 A;  1N87 A;  2XEU A;  3PUR A;  3M63 A;  5B76 A;  2MD8 C;  2K1J A;  3O36 A;  3ZVY A;  3KV5 A;  2K17 A;  5FER A;  3T7L A;  2FD4 A;  3E2D A;  2MA5 A;  3N9L A;  5G04 B;  2KKY A;  3ZTG A;  1DCQ A;  5DKA A;  4AYC B;  3LQH A;  3M7K A;  3HCT A;  4PPE A;  1Z2Q A;  3O7A A;  2ECW A;  5C11 A;  2EXU A;  2XB1 A;  1BOR A;  2C2L A;  3EB5 A;  1WEW A;  3O37 A;  4S3O C;  3N9Q A;  2YUR A;  2ZET C;  2LDR A;  3Q1D A;  1WE9 A;  1F62 A;  2L43 A;  2YHN A;  1JM7 B;  3L11 A;  2YSM A;  2CKL A;  1V87 A;  2KGI A;  1RMD A;  3MHS A;  3QZV A;  2M3H A;  2L5U A;  4X3G A;  3T9K A;  4YAD A;  2VJE B;  1FBV A;  3FM8 C;  2D8U A;  4QF2 A;  2C2V S;  4Q6F A;  5G0F A;  2LN0 A;  2M13 A;  2LGG A;  3SOX A;  4IC2 A;  3ZNI A;  3O35 A;  5TBN A;  5C13 A;  5D1K B;  3FJU B;  4YBT A;  2RR4 A;  4A4B A;  3L1Z B;  2F6J A;  4CA1 A;  2FFW A;  2YVR A;  1T1H A;  1X4I A;  3SUB A;  4NN2 A;  1ZBD B;  5K3Q A;  3LVQ E;  2KYU A;  2MA6 A;  4OGE A;  4V3L C;  3HCS A;  4WZ0 A;  2UZG A;  4GNE A;  3N9N A;  3N9O A;  4UP0 A;  4YBS A;  2IQJ A;  2DJA A;  4R7E A;  5TRB A;  2D8S A;  2JMD A;  2G43 A;  2HDP A;  1WES A;  1WIL A;  2AN6 A;  3N9P A;  2JMJ A;  2VJF B;  3ZPV 1;  4AUQ B;  2LV9 A;  2JMI A;  3I2D A;  5H1V A;  4F1P A;  5KH3 A;  2CSY A;  2EA6 A;  2JUN A;  5B79 A;  1WEO A;  4WZ2 A;  4AYC A;  2L80 A;  1CHC A;  3MHH A;  1Z6U A;  2YU4 A;  1WEE A;  3FAO A;  2VPD A;  1WEV A;  4GNG A;  4AVX A;  2LXH C;  3LRQ A;  4UI9 B;  2P57 A;  2H0D B;  4B86 C;  2LXP C;  1WEN A;  5SVI B;  3DQV R;  3U5O A;  5LKZ A;  1MBM A;  2PNX A;  1G25 A;  2LQ6 A;  5AIT A;  2K16 A;  2VPG A;  4MSX A;  4O64 A;  2BAY A;  2LRI C;  1JM7 A;  1XWH A;  4O62 A;  2KWJ A;  4Z0R A;  2JM3 A;  2E6R A; 
#chains in the Genus database with same CATH homology
 4A4C A;  2KGG A;  4PTB A;  2E6S A;  2RI7 A;  5H9M A;  3M62 A;  2VJE A;  2L75 A;  1X4J A;  4A49 A;  2VPE A;  3GV4 A;  2G45 A;  1WFK A;  2YHO A;  1VFY A;  2M6M A;  4QF3 A;  4YC9 A;  2MNY A;  5B75 A;  1LDK C;  5G05 B;  1IYM A;  1MM3 A;  5LKT A;  5H1T A;  2KE1 A;  2G6Q A;  3FL2 A;  5TDR A;  2QIZ A;  4P5O B;  3L1X A;  5B8D A;  3RPG B;  2M1R A;  2JRJ A;  3T6R A;  2YRE A;  4LK9 A;  2KRE A;  1HYJ A;  4FO9 A;  2YSJ A;  4L58 A;  4BBQ A;  2QJ0 A;  4LAD B;  3LQI A;  2VNF A;  2LGV A;  2YQM A;  5EYA F;  2Y1M A;  2KIZ A;  1U6G B;  2CSZ A;  2YQL A;  5AIU A;  2NAA A;  2VJF A;  3V43 A;  1WIM A;  3C5K A;  2F42 A;  3N9M A;  1HYI A;  4AP4 A;  3GL6 A;  4C9Z A;  1E4U A;  3ZYQ A;  2HYE D;  3KQI A;  4GB0 A;  2ECN A;  2CT2 A;  4N3W A;  1LDJ B;  3SOW A;  2H0D A;  2I50 A;  5TDW A;  2MUM A;  3PUQ A;  5FB0 A;  3O33 A;  3LQJ A;  2FUU A;  4IC3 A;  4UP5 A;  3EB6 A;  4FIP A;  4LKA A;  1VD4 A;  3C6W A;  4W4U A;  5FEY A;  4ZUX U;  5H1U A;  2KWN A;  2ECV A;  2ECJ A;  3ZPV E;  3SOU A;  2FUI A;  2IDA A;  3VK6 A;  4F52 B;  4S3O B;  2KU3 A;  4ZDT A;  2MD7 B;  3KV6 A;  2ECT A;  3ASL A;  3NG2 A;  3O34 A;  1WEQ A;  1X4U A;  4WZ3 B;  2KR4 A;  1FP0 A;  4ZQL A;  4A0C D;  4TKP B;  5JG6 A;  2VPB A;  1K2F A;  4B7Y C;  2L0B A;  3KNV A;  3U5M A;  2RSD A;  3HTK C;  1DVP A;  5J3X A;  5KH9 A;  2LGL A;  5TAB A;  4YBM A;  4FK5 A;  1VYX A;  2F6N A;  5KH7 A;  1WEP A;  4FJC A;  2EGP A;  2ECI A;  4L7X A;  2YT5 A;  3M99 A;  4BHW A;  2FSA A;  5LCW B;  1WGM A;  2YUC A;  4MVT A;  5I3L A;  2M85 A;  4I7C A;  1WEU A;  2KWK A;  3RTR B;  4CCG X;  4I7B A;  2YYR A;  3U5P A;  2K4D A;  2CKL B;  5LKX A;  2YW8 A;  5B78 A;  4I7D A;  2MNZ A;  1Z60 A;  2VP7 A;  5FB1 A;  2Y43 A;  2KWO A;  2MT5 A;  2Y1N A;  3IHP A;  3PHD A;  3ZVZ B;  2QIC A;  4GNF A;  1JOC A;  3RPG C;  5D1M B;  4LLB A;  3DPL R;  2MIQ A;  4N4F A;  1WEM A;  4R8P K;  2KFT A;  2ECG A;  4YAT A;  4YAX A;  3SHB A;  4GND A;  3O70 A;  4WA6 A;  3HCU A;  2OXQ C;  4YAB A;  5DIN A;  2EOD A;  2PUY A;  2LGK A;  2DX8 A;  4V3K C;  5D1L B;  5B77 A;  4LJN A;  4XI1 A;  5LKU A;  3U5N A;  4R2Y A;  1MM2 A;  1N87 A;  2XEU A;  3PUR A;  3M63 A;  5B76 A;  2MD8 C;  2K1J A;  3O36 A;  3ZVY A;  3KV5 A;  2K17 A;  5FER A;  3T7L A;  2MA5 A;  3N9L A;  5G04 B;  3ZTG A;  5DKA A;  4AYC B;  3LQH A;  3HCT A;  4PPE A;  1Z2Q A;  3O7A A;  2ECW A;  5C11 A;  2XB1 A;  1BOR A;  2C2L A;  3EB5 A;  1WEW A;  3O37 A;  4S3O C;  3N9Q A;  2YUR A;  2ZET C;  2LDR A;  1WE9 A;  1F62 A;  2L43 A;  2YHN A;  1JM7 B;  3L11 A;  2YSM A;  2CKL A;  1V87 A;  2KGI A;  1RMD A;  3MHS A;  3QZV A;  2M3H A;  2L5U A;  4X3G A;  4YAD A;  2VJE B;  1FBV A;  4QF2 A;  2C2V S;  4Q6F A;  5G0F A;  2LN0 A;  2LGG A;  3SOX A;  4IC2 A;  3ZNI A;  3O35 A;  5TBN A;  5C13 A;  5D1K B;  4YBT A;  4A4B A;  3L1Z B;  2F6J A;  4CA1 A;  1T1H A;  1X4I A;  4NN2 A;  1ZBD B;  2KYU A;  2MA6 A;  4V3L C;  3HCS A;  4WZ0 A;  2UZG A;  4GNE A;  3N9N A;  3N9O A;  4UP0 A;  4YBS A;  4R7E A;  5TRB A;  2D8S A;  2JMD A;  2G43 A;  2HDP A;  1WES A;  1WIL A;  2AN6 A;  3N9P A;  2JMJ A;  2VJF B;  3ZPV 1;  4AUQ B;  2LV9 A;  2JMI A;  3I2D A;  5H1V A;  5KH3 A;  2CSY A;  2EA6 A;  5B79 A;  1WEO A;  4WZ2 A;  4AYC A;  2L80 A;  1CHC A;  3MHH A;  1Z6U A;  2YU4 A;  1WEE A;  2VPD A;  1WEV A;  4GNG A;  4AVX A;  2LXH C;  3LRQ A;  4UI9 B;  2H0D B;  4B86 C;  2LXP C;  1WEN A;  3DQV R;  3U5O A;  5LKZ A;  2PNX A;  1G25 A;  2LQ6 A;  5AIT A;  2K16 A;  2VPG A;  4MSX A;  4O64 A;  2BAY A;  2LRI C;  1JM7 A;  1XWH A;  2KWJ A;  2E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...