2L43A

Structural basis for histone code recognition by brpf2-phd1 finger
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
80
structure length
80
Chain Sequence
ARTKQTARKSTGGSSGSSQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of unmodified histone H3 by the first PHD finger of Bromodomain-PHD finger protein 2 provides insights into the regulation of histone acetyltransferases MOZ and MORF
rcsb
molecule keywords N-teminal domain from Histone H3.3, LINKER, PHD1 domain from
molecule tags Transcription
source organism Homo sapiens, synthetic, homo sapiens
total genus 9
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13831 PHD_2 PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l43A00
4IC2A 4MSXA 1WEOA 2YUCA 2XEUA 1FBVA 1WENA 4R7EA 4N3WA 4UI9B 3U5NA 5AITA 5B75A 2H0DA 2MNZA 4V3LC 2ZETC 4S3OB 1LDJB 3T7LA 1X4JA 2LDRA 5B79A 1JM7B 2AN6A 4FO9A 2YSMA 3U5MA 2KYUA 4N4FA 2KR4A 4YABA 1XWHA 4P5OB 4CCGX 2M85A 1T1HA 2LRIC 5H9MA 1JOCA 5EYAF 4LLBA 1G25A 2KGGA 4AUQB 5H1TA 1VYXA 2LXHC 4B7YC 2JMDA 4I7CA 1BORA 3M63A 4L7XA 5D1MB 4WZ0A 2Y43A 4WZ2A 4AYCB 1WFKA 2KGIA 5G05B 2CKLA 4GNEA 2DX8A 2ECWA 2RSDA 4V3KC 5B78A 3SOXA 1IYMA 5C11A 2C2LA 4BBQA 5D1KB 2YT5A 2M6MA 2YU4A 3O37A 3O70A 2MUMA 2PNXA 3DQVR 3N9NA 4I7DA 1RMDA 5H1VA 5B77A 5J3XA 1WILA 5D1LB 3C6WA 3N9PA 1CHCA 2K17A 2VP7A 2F6JA 4GNFA 3ZTGA 3SOWA 1VD4A 3ASLA 3NG2A 1U6GB 3O34A 3M99A 2Y1MA 2LXPC 3T6RA 2K1JA 5I3LA 3L1XA 2C2VS 4LK9A 1FP0A 1N87A 4WA6A 3ZYQA 2RI7A 1JM7A 3RTRB 2E6RA 4O64A 5TABA 4CA1A 5TBNA 4AP4A 4YBTA 4A49A 2VJFB 2LGLA 5FERA 2YYRA 3N9MA 4UP0A 3KNVA 3LQIA 2VPBA 4AYCA 3HCTA 4UP5A 2VPGA 2ECTA 2YQLA 3MHHA 2QIZA 3L1ZB 4C9ZA 2JRJA 2LGVA 4ZDTA 1F62A 3GV4A 2MA5A 4TKPB 2LN0A 3PHDA 4NN2A 2MD8C 3HCUA 5DINA 2ECVA 2VPDA 2CSYA 4FIPA 2G43A 2ECIA 4ZUXU 1Z6UA 5B76A 5C13A 4YC9A 5B8DA 3SHBA 2K4DA 5TDRA 5LKXA 1WEQA 1MM2A 3QZVA 1HYJA 3EB6A 3EB5A 2VNFA 2F42A 4YADA 4A4CA 2VJEA 2LGKA 4ZQLA 3PURA 3RPGC 3HTKC 5G0FA 2E6SA 2KREA 2YW8A 2KWNA 2L0BA 3O7AA 2L43A 2HDPA 2ECJA 4MVTA 2OXQC 5LKZA 1WIMA 3N9QA 5JG6A 5DKAA 2EGPA 5KH9A 2XB1A 2ECGA 2PUYA 2KE1A 3SOUA 2BAYA 2I50A 3U5OA 4PTBA 3ZVYA 4WZ3B 3M62A 4F52B 3RPGB 2MT5A 4LJNA 1ZBDB 4QF3A 5FEYA 5TRBA 1WESA 5KH3A 1X4IA 3L11A 2L80A 5FB0A 3ZPV1 2FSAA 3LRQA 5LCWB 1E4UA 2CSZA 4W4UA 2LGGA 3O36A 2F6NA 4S3OC 2ECNA 4B86C 2EODA 3KV6A 2QJ0A 3C5KA 5G04B 4AVXA 4R8PK 4GNDA 1WEWA 4PPEA 2QICA 2UZGA 3IHPA 5TDWA 3ZPVE 1MM3A 2JMJA 1VFYA 3PUQA 4LADB 3DPLR 4BHWA 3ZVZB 2YQMA 3N9LA 1LDKC 4I7BA 3U5PA 4FJCA 3V43A 1HYIA 2L5UA 2YURA 2CT2A 4YATA 3VK6A 2MA6A 2MD7B 5FB1A 2NAAA 2LV9A 2KWKA 4LKAA 1X4UA 4Q6FA 5LKTA 2K16A 3N9OA 2JMIA 2G6QA 2KIZA 2IDAA 2KWOA 2LQ6A 2H0DB 2MIQA 4XI1A 2Y1NA 2KU3A 3ZNIA 2MNYA 4IC3A 3I2DA 1V87A 3O35A 3KQIA 4L58A 2M1RA 4YBSA 3GL6A 3LQJA 2VJFA 1WEPA 2G45A 2D8SA 2HYED 1DVPA 2KFTA 1WEUA 4R2YA 4YAXA 2FUIA 1WEMA 4GNGA 4YBMA 2CKLB 3KV5A 2M3HA 4GB0A 2YHOA 2VPEA 5H1UA 4A0CD 3FL2A 5LKUA 1WEEA 1WEVA 3LQHA 3O33A 2KWJA 2L75A 1Z60A 1Z2QA 3MHSA 1WE9A 4FK5A 2YREA 2YSJA 1WGMA 2VJEB 5KH7A 2EA6A 2YHNA 1K2FA 4X3GA 5AIUA 4A4BA 4QF2A 3HCSA 2FUUA
chains in the Genus database with same CATH superfamily
4IC2A 4MSXA 1WEOA 2YUCA 2XEUA 3FANA 1FBVA 1WENA 4R7EA 3Q1DA 4N3WA 4UI9B 3U5NA 5AITA 5B75A 2H0DA 2MNZA 4V3LC 2ZETC 4S3OB 3LVRE 1LDJB 3T7LA 1X4JA 2LDRA 5B79A 3M7KA 1JM7B 2AN6A 4FO9A 2YSMA 3U5MA 2KYUA 4N4FA 2KR4A 4YABA 1XWHA 2YVRA 5SVYA 4P5OB 4CCGX 3O47A 2M85A 1T1HA 2LRIC 5H9MA 1JOCA 5EYAF 4LLBA 1G25A 2KGGA 3LVQE 4AUQB 5H1TA 1VYXA 2L7PA 2LXHC 4B7YC 2JMDA 4I7CA 1BORA 3M63A 4L7XA 5D1MB 4WZ0A 2Y43A 4WZ2A 4AYCB 1WFKA 2KGIA 5G05B 2CKLA 4GNEA 3DWDA 2DX8A 2ECWA 2RSDA 4V3KC 5B78A 3SOXA 2XOYA 1IYMA 5C11A 2KKXA 2C2LA 4BBQA 5D1KB 2YT5A 2M6MA 2YU4A 3O37A 3O70A 2MUMA 3KDEC 2PNXA 3DQVR 3N9NA 4I7DA 1RMDA 5H1VA 5B77A 5J3XA 1WILA 5D1LB 3C6WA 3N9PA 1CHCA 2CRWA 2K17A 2VP7A 2F6JA 3FM8C 4GNFA 3ZTGA 3SOWA 1VD4A 5SVIA 3H7HA 3ASLA 3NG2A 2P57A 1U6GB 3O34A 3M99A 2Y1MA 2LXPC 3T6RA 2K1JA 5I3LA 3L1XA 2C2VS 4LK9A 1FP0A 1N87A 3FJUB 4WA6A 3ZYQA 2RI7A 1JM7A 3RTRB 2CRRA 2E6RA 4O64A 5SVXA 5TABA 4CA1A 5TBNA 4AP4A 4YBTA 4A49A 2CSVA 2XP0A 2VJFB 2LGLA 5FERA 2YYRA 3N9MA 4UP0A 3KNVA 2DSMA 3LQIA 2VPBA 4AYCA 3HCTA 4UP5A 2VPGA 2ECTA 2YQLA 2E61A 3MHHA 2LAUA 2QIZA 3L1ZB 4C9ZA 2JRJA 2LGVA 4ZDTA 1F62A 3GV4A 4OGCA 3FEHA 2MA5A 4H9DA 4TKPB 2LN0A 3PHDA 4NN2A 2MD8C 3HCUA 5DINA 3LDYA 2ECVA 2VPDA 2CSYA 4FIPA 2G43A 2ECIA 4ZUXU 1Z6UA 5B76A 5C13A 4YC9A 5B8DA 3SHBA 2DJAA 2K4DA 5TDRA 5LKXA 3MDBC 1WEQA 1MM2A 3QZVA 1HYJA 3EB6A 3EB5A 2VNFA 2F42A 4YADA 4A4CA 2VJEA 2LGKA 3PLWA 3PURA 4ZQLA 3RPGC 3HTKC 2EGMA 5G0FA 2E6SA 2KREA 2YW8A 2KWNA 2L0BA 3O7AA 2L43A 2HDPA 2ECJA 4MVTA 2OXQC 5LKZA 1WIMA 3N9QA 5JG6A 5DKAA 2KKYA 2JM3A 2EGPA 3E2DA 5KH9A 2XB1A 2ECGA 2PUYA 2KE1A 3SOUA 2BAYA 2I50A 3U5OA 4PTBA 3ZVYA 4WZ3B 3M62A 4F52B 3RPGB 3SUBA 2MT5A 4LJNA 1ZBDB 4QF3A 2D8UA 5FEYA 2FD4A 4F1PA 1MBMA 1WESA 2EXUA 1X4IA 5TRBA 5KH3A 3L11A 2L80A 5FB0A 3ZPV1 2FSAA 3LRQA 5LCWB 1E4UA 2CSZA 4W4UA 4OGEA 2B0OE 2LGGA 3O36A 2F6NA 4S3OC 2ECNA 4B86C 2IQJA 2EODA 3KV6A 2QJ0A 3C5KA 5G04B 4AVXA 4R8PK 4GNDA 1WEWA 4PPEA 2QICA 2UZGA 3IHPA 5TDWA 3ZPVE 1MM3A 2FFWA 2JMJA 4QQ4A 2XOCA 5SVIB 1VFYA 3PUQA 4LADB 4Z0RA 3DPLR 4BHWA 3ZVZB 4Z0OA 2YQMA 3N9LA 1LDKC 5K3QA 4I7BA 2CONA 3U5PA 4FJCA 2RR4A 3V43A 2XOZA 1HYIA 2L5UA 2YURA 2CT2A 1DCQA 4YATA 2M13A 3VK6A 2MA6A 2MD7B 5FB1A 2NAAA 2LV9A 2KWKA 3JUEA 4LKAA 1X4UA 4Q6FA 5LKTA 2K16A 3N9OA 2JMIA 2G6QA 2KIZA 2JUNA 2IDAA 2KWOA 2LQ6A 2H0DB 2MIQA 4XI1A 2Y1NA 2KU3A 3ZNIA 2MNYA 4IC3A 3I2DA 1V87A 3O35A 3FAOA 3KQIA 4L58A 3LJUX 2M1RA 4YBSA 3GL6A 3LQJA 2VJFA 1WEPA 2G45A 2D8SA 2HYED 1DVPA 2KFTA 1WEUA 4R2YA 4YAXA 2FUIA 4O62A 1WEMA 4GNGA 4YBMA 2CKLB 3KV5A 2M3HA 4GB0A 2YHOA 2VPEA 5H1UA 4A0CD 3FL2A 5LKUA 1WEEA 1WEVA 3LQHA 3O33A 2KWJA 2L75A 1Z60A 1Z2QA 3MHSA 3T9KA 1WE9A 4FK5A 2YREA 2YSJA 1WGMA 2VJEB 5KH7A 2EA6A 2YHNA 1K2FA 3DDTA 4X3GA 5AIUA 2MKEA 4A4BA 4QF2A 2OWAA 3HCSA 2FUUA
chains in the Genus database with same CATH topology
4IC2A 4MSXA 1WEOA 2YUCA 2XEUA 1FBVA 1WENA 4R7EA 4N3WA 4UI9B 3U5NA 5AITA 5B75A 2H0DA 2MNZA 4V3LC 2ZETC 4S3OB 1LDJB 3T7LA 1X4JA 2LDRA 5B79A 1JM7B 2AN6A 4FO9A 2YSMA 3U5MA 2KYUA 4N4FA 2KR4A 4YABA 1XWHA 4P5OB 4CCGX 2M85A 1T1HA 2LRIC 5H9MA 1JOCA 5EYAF 4LLBA 1G25A 2KGGA 4AUQB 5H1TA 1VYXA 2LXHC 4B7YC 2JMDA 4I7CA 1BORA 3M63A 4L7XA 5D1MB 4WZ0A 2Y43A 4WZ2A 4AYCB 1WFKA 2KGIA 5G05B 2CKLA 4GNEA 2DX8A 2ECWA 2RSDA 4V3KC 5B78A 3SOXA 1IYMA 5C11A 2C2LA 4BBQA 5D1KB 2YT5A 2M6MA 2YU4A 3O37A 3O70A 2MUMA 2PNXA 3DQVR 3N9NA 4I7DA 1RMDA 5H1VA 5B77A 5J3XA 1WILA 5D1LB 3C6WA 3N9PA 1CHCA 2K17A 2VP7A 2F6JA 4GNFA 3ZTGA 3SOWA 1VD4A 3ASLA 3NG2A 1U6GB 3O34A 3M99A 2Y1MA 2LXPC 3T6RA 2K1JA 5I3LA 3L1XA 2C2VS 4LK9A 1FP0A 1N87A 4WA6A 3ZYQA 2RI7A 1JM7A 3RTRB 2E6RA 4O64A 5TABA 4CA1A 5TBNA 4AP4A 4YBTA 4A49A 2VJFB 2LGLA 5FERA 2YYRA 3N9MA 4UP0A 3KNVA 3LQIA 2VPBA 4AYCA 3HCTA 4UP5A 2VPGA 2ECTA 2YQLA 3MHHA 2QIZA 3L1ZB 4C9ZA 2JRJA 2LGVA 4ZDTA 1F62A 3GV4A 2MA5A 4TKPB 2LN0A 3PHDA 4NN2A 2MD8C 3HCUA 5DINA 2ECVA 2VPDA 2CSYA 4FIPA 2G43A 2ECIA 4ZUXU 1Z6UA 5B76A 5C13A 4YC9A 5B8DA 3SHBA 2K4DA 5TDRA 5LKXA 1WEQA 1MM2A 3QZVA 1HYJA 3EB6A 3EB5A 2VNFA 2F42A 4YADA 4A4CA 2VJEA 2LGKA 4ZQLA 3PURA 3RPGC 3HTKC 5G0FA 2E6SA 2KREA 2YW8A 2KWNA 2L0BA 3O7AA 2L43A 2HDPA 2ECJA 4MVTA 2OXQC 5LKZA 1WIMA 3N9QA 5JG6A 5DKAA 2EGPA 5KH9A 2XB1A 2ECGA 2PUYA 2KE1A 3SOUA 2BAYA 2I50A 3U5OA 4PTBA 3ZVYA 4WZ3B 3M62A 4F52B 3RPGB 2MT5A 4LJNA 1ZBDB 4QF3A 5FEYA 5TRBA 1WESA 5KH3A 1X4IA 3L11A 2L80A 5FB0A 3ZPV1 2FSAA 3LRQA 5LCWB 1E4UA 2CSZA 4W4UA 2LGGA 3O36A 2F6NA 4S3OC 2ECNA 4B86C 2EODA 3KV6A 2QJ0A 3C5KA 5G04B 4AVXA 4R8PK 4GNDA 1WEWA 4PPEA 2QICA 2UZGA 3IHPA 5TDWA 3ZPVE 1MM3A 2JMJA 1VFYA 3PUQA 4LADB 3DPLR 4BHWA 3ZVZB 2YQMA 3N9LA 1LDKC 4I7BA 3U5PA 4FJCA 3V43A 1HYIA 2L5UA 2YURA 2CT2A 4YATA 3VK6A 2MA6A 2MD7B 5FB1A 2NAAA 2LV9A 2KWKA 4LKAA 1X4UA 4Q6FA 5LKTA 2K16A 3N9OA 2JMIA 2G6QA 2KIZA 2IDAA 2KWOA 2LQ6A 2H0DB 2MIQA 4XI1A 2Y1NA 2KU3A 3ZNIA 2MNYA 4IC3A 3I2DA 1V87A 3O35A 3KQIA 4L58A 2M1RA 4YBSA 3GL6A 3LQJA 2VJFA 1WEPA 2G45A 2D8SA 2HYED 1DVPA 2KFTA 1WEUA 4R2YA 4YAXA 2FUIA 1WEMA 4GNGA 4YBMA 2CKLB 3KV5A 2M3HA 4GB0A 2YHOA 2VPEA 5H1UA 4A0CD 3FL2A 5LKUA 1WEEA 1WEVA 3LQHA 3O33A 2KWJA 2L75A 1Z60A 1Z2QA 3MHSA 1WE9A 4FK5A 2YREA 2YSJA 1WGMA 2VJEB 5KH7A 2EA6A 2YHNA 1K2FA 4X3GA 5AIUA 4A4BA 4QF2A 3HCSA 2FUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC2 A;  4MSX A;  1WEO A;  2YUC A;  2XEU A;  1FBV A;  1WEN A;  4R7E A;  4N3W A;  4UI9 B;  3U5N A;  5AIT A;  5B75 A;  2H0D A;  2MNZ A;  4V3L C;  2ZET C;  4S3O B;  1LDJ B;  3T7L A;  1X4J A;  2LDR A;  5B79 A;  1JM7 B;  2AN6 A;  4FO9 A;  2YSM A;  3U5M A;  2KYU A;  4N4F A;  2KR4 A;  4YAB A;  1XWH A;  4P5O B;  4CCG X;  2M85 A;  1T1H A;  2LRI C;  5H9M A;  1JOC A;  5EYA F;  4LLB A;  1G25 A;  2KGG A;  4AUQ B;  5H1T A;  1VYX A;  2LXH C;  4B7Y C;  2JMD A;  4I7C A;  1BOR A;  3M63 A;  4L7X A;  5D1M B;  4WZ0 A;  2Y43 A;  4WZ2 A;  4AYC B;  1WFK A;  2KGI A;  5G05 B;  2CKL A;  4GNE A;  2DX8 A;  2ECW A;  2RSD A;  4V3K C;  5B78 A;  3SOX A;  1IYM A;  5C11 A;  2C2L A;  4BBQ A;  5D1K B;  2YT5 A;  2M6M A;  2YU4 A;  3O37 A;  3O70 A;  2MUM A;  2PNX A;  3DQV R;  3N9N A;  4I7D A;  1RMD A;  5H1V A;  5B77 A;  5J3X A;  1WIL A;  5D1L B;  3C6W A;  3N9P A;  1CHC A;  2K17 A;  2VP7 A;  2F6J A;  4GNF A;  3ZTG A;  3SOW A;  1VD4 A;  3ASL A;  3NG2 A;  1U6G B;  3O34 A;  3M99 A;  2Y1M A;  2LXP C;  3T6R A;  2K1J A;  5I3L A;  3L1X A;  2C2V S;  4LK9 A;  1FP0 A;  1N87 A;  4WA6 A;  3ZYQ A;  2RI7 A;  1JM7 A;  3RTR B;  2E6R A;  4O64 A;  5TAB A;  4CA1 A;  5TBN A;  4AP4 A;  4YBT A;  4A49 A;  2VJF B;  2LGL A;  5FER A;  2YYR A;  3N9M A;  4UP0 A;  3KNV A;  3LQI A;  2VPB A;  4AYC A;  3HCT A;  4UP5 A;  2VPG A;  2ECT A;  2YQL A;  3MHH A;  2QIZ A;  3L1Z B;  4C9Z A;  2JRJ A;  2LGV A;  4ZDT A;  1F62 A;  3GV4 A;  2MA5 A;  4TKP B;  2LN0 A;  3PHD A;  4NN2 A;  2MD8 C;  3HCU A;  5DIN A;  2ECV A;  2VPD A;  2CSY A;  4FIP A;  2G43 A;  2ECI A;  4ZUX U;  1Z6U A;  5B76 A;  5C13 A;  4YC9 A;  5B8D A;  3SHB A;  2K4D A;  5TDR A;  5LKX A;  1WEQ A;  1MM2 A;  3QZV A;  1HYJ A;  3EB6 A;  3EB5 A;  2VNF A;  2F42 A;  4YAD A;  4A4C A;  2VJE A;  2LGK A;  4ZQL A;  3PUR A;  3RPG C;  3HTK C;  5G0F A;  2E6S A;  2KRE A;  2YW8 A;  2KWN A;  2L0B A;  3O7A A;  2L43 A;  2HDP A;  2ECJ A;  4MVT A;  2OXQ C;  5LKZ A;  1WIM A;  3N9Q A;  5JG6 A;  5DKA A;  2EGP A;  5KH9 A;  2XB1 A;  2ECG A;  2PUY A;  2KE1 A;  3SOU A;  2BAY A;  2I50 A;  3U5O A;  4PTB A;  3ZVY A;  4WZ3 B;  3M62 A;  4F52 B;  3RPG B;  2MT5 A;  4LJN A;  1ZBD B;  4QF3 A;  5FEY A;  5TRB A;  1WES A;  5KH3 A;  1X4I A;  3L11 A;  2L80 A;  5FB0 A;  3ZPV 1;  2FSA A;  3LRQ A;  5LCW B;  1E4U A;  2CSZ A;  4W4U A;  2LGG A;  3O36 A;  2F6N A;  4S3O C;  2ECN A;  4B86 C;  2EOD A;  3KV6 A;  2QJ0 A;  3C5K A;  5G04 B;  4AVX A;  4R8P K;  4GND A;  1WEW A;  4PPE A;  2QIC A;  2UZG A;  3IHP A;  5TDW A;  3ZPV E;  1MM3 A;  2JMJ A;  1VFY A;  3PUQ A;  4LAD B;  3DPL R;  4BHW A;  3ZVZ B;  2YQM A;  3N9L A;  1LDK C;  4I7B A;  3U5P A;  4FJC A;  3V43 A;  1HYI A;  2L5U A;  2YUR A;  2CT2 A;  4YAT A;  3VK6 A;  2MA6 A;  2MD7 B;  5FB1 A;  2NAA A;  2LV9 A;  2KWK A;  4LKA A;  1X4U A;  4Q6F A;  5LKT A;  2K16 A;  3N9O A;  2JMI A;  2G6Q A;  2KIZ A;  2IDA A;  2KWO A;  2LQ6 A;  2H0D B;  2MIQ A;  4XI1 A;  2Y1N A;  2KU3 A;  3ZNI A;  2MNY A;  4IC3 A;  3I2D A;  1V87 A;  3O35 A;  3KQI A;  4L58 A;  2M1R A;  4YBS A;  3GL6 A;  3LQJ A;  2VJF A;  1WEP A;  2G45 A;  2D8S A;  2HYE D;  1DVP A;  2KFT A;  1WEU A;  4R2Y A;  4YAX A;  2FUI A;  1WEM A;  4GNG A;  4YBM A;  2CKL B;  3KV5 A;  2M3H A;  4GB0 A;  2YHO A;  2VPE A;  5H1U A;  4A0C D;  3FL2 A;  5LKU A;  1WEE A;  1WEV A;  3LQH A;  3O33 A;  2KWJ A;  2L75 A;  1Z60 A;  1Z2Q A;  3MHS A;  1WE9 A;  4FK5 A;  2YRE A;  2YSJ A;  1WGM A;  2VJE B;  5KH7 A;  2EA6 A;  2YHN A;  1K2F A;  4X3G A;  5AIU A;  4A4B A;  4QF2 A;  3HCS A;  2FUU A; 
#chains in the Genus database with same CATH topology
 4IC2 A;  4MSX A;  1WEO A;  2YUC A;  2XEU A;  3FAN A;  1FBV A;  1WEN A;  4R7E A;  3Q1D A;  4N3W A;  4UI9 B;  3U5N A;  5AIT A;  5B75 A;  2H0D A;  2MNZ A;  4V3L C;  2ZET C;  4S3O B;  3LVR E;  1LDJ B;  3T7L A;  1X4J A;  2LDR A;  5B79 A;  3M7K A;  1JM7 B;  2AN6 A;  4FO9 A;  2YSM A;  3U5M A;  2KYU A;  4N4F A;  2KR4 A;  4YAB A;  1XWH A;  2YVR A;  5SVY A;  4P5O B;  4CCG X;  3O47 A;  2M85 A;  1T1H A;  2LRI C;  5H9M A;  1JOC A;  5EYA F;  4LLB A;  1G25 A;  2KGG A;  3LVQ E;  4AUQ B;  5H1T A;  1VYX A;  2L7P A;  2LXH C;  4B7Y C;  2JMD A;  4I7C A;  1BOR A;  3M63 A;  4L7X A;  5D1M B;  4WZ0 A;  2Y43 A;  4WZ2 A;  4AYC B;  1WFK A;  2KGI A;  5G05 B;  2CKL A;  4GNE A;  3DWD A;  2DX8 A;  2ECW A;  2RSD A;  4V3K C;  5B78 A;  3SOX A;  2XOY A;  1IYM A;  5C11 A;  2KKX A;  2C2L A;  4BBQ A;  5D1K B;  2YT5 A;  2M6M A;  2YU4 A;  3O37 A;  3O70 A;  2MUM A;  3KDE C;  2PNX A;  3DQV R;  3N9N A;  4I7D A;  1RMD A;  5H1V A;  5B77 A;  5J3X A;  1WIL A;  5D1L B;  3C6W A;  3N9P A;  1CHC A;  2CRW A;  2K17 A;  2VP7 A;  2F6J A;  3FM8 C;  4GNF A;  3ZTG A;  3SOW A;  1VD4 A;  5SVI A;  3H7H A;  3ASL A;  3NG2 A;  2P57 A;  1U6G B;  3O34 A;  3M99 A;  2Y1M A;  2LXP C;  3T6R A;  2K1J A;  5I3L A;  3L1X A;  2C2V S;  4LK9 A;  1FP0 A;  1N87 A;  3FJU B;  4WA6 A;  3ZYQ A;  2RI7 A;  1JM7 A;  3RTR B;  2CRR A;  2E6R A;  4O64 A;  5SVX A;  5TAB A;  4CA1 A;  5TBN A;  4AP4 A;  4YBT A;  4A49 A;  2CSV A;  2XP0 A;  2VJF B;  2LGL A;  5FER A;  2YYR A;  3N9M A;  4UP0 A;  3KNV A;  2DSM A;  3LQI A;  2VPB A;  4AYC A;  3HCT A;  4UP5 A;  2VPG A;  2ECT A;  2YQL A;  2E61 A;  3MHH A;  2LAU A;  2QIZ A;  3L1Z B;  4C9Z A;  2JRJ A;  2LGV A;  4ZDT A;  1F62 A;  3GV4 A;  4OGC A;  3FEH A;  2MA5 A;  4H9D A;  4TKP B;  2LN0 A;  3PHD A;  4NN2 A;  2MD8 C;  3HCU A;  5DIN A;  3LDY A;  2ECV A;  2VPD A;  2CSY A;  4FIP A;  2G43 A;  2ECI A;  4ZUX U;  1Z6U A;  5B76 A;  5C13 A;  4YC9 A;  5B8D A;  3SHB A;  2DJA A;  2K4D A;  5TDR A;  5LKX A;  3MDB C;  1WEQ A;  1MM2 A;  3QZV A;  1HYJ A;  3EB6 A;  3EB5 A;  2VNF A;  2F42 A;  4YAD A;  4A4C A;  2VJE A;  2LGK A;  3PLW A;  3PUR A;  4ZQL A;  3RPG C;  3HTK C;  2EGM A;  5G0F A;  2E6S A;  2KRE A;  2YW8 A;  2KWN A;  2L0B A;  3O7A A;  2L43 A;  2HDP A;  2ECJ A;  4MVT A;  2OXQ C;  5LKZ A;  1WIM A;  3N9Q A;  5JG6 A;  5DKA A;  2KKY A;  2JM3 A;  2EGP A;  3E2D A;  5KH9 A;  2XB1 A;  2ECG A;  2PUY A;  2KE1 A;  3SOU A;  2BAY A;  2I50 A;  3U5O A;  4PTB A;  3ZVY A;  4WZ3 B;  3M62 A;  4F52 B;  3RPG B;  3SUB A;  2MT5 A;  4LJN A;  1ZBD B;  4QF3 A;  2D8U A;  5FEY A;  2FD4 A;  4F1P A;  1MBM A;  1WES A;  2EXU A;  1X4I A;  5TRB A;  5KH3 A;  3L11 A;  2L80 A;  5FB0 A;  3ZPV 1;  2FSA A;  3LRQ A;  5LCW B;  1E4U A;  2CSZ A;  4W4U A;  4OGE A;  2B0O E;  2LGG A;  3O36 A;  2F6N A;  4S3O C;  2ECN A;  4B86 C;  2IQJ A;  2EOD A;  3KV6 A;  2QJ0 A;  3C5K A;  5G04 B;  4AVX A;  4R8P K;  4GND A;  1WEW A;  4PPE A;  2QIC A;  2UZG A;  3IHP A;  5TDW A;  3ZPV E;  1MM3 A;  2FFW A;  2JMJ A;  4QQ4 A;  2XOC A;  5SVI B;  1VFY A;  3PUQ A;  4LAD B;  4Z0R A;  3DPL R;  4BHW A;  3ZVZ B;  4Z0O A;  2YQM A;  3N9L A;  1LDK C;  5K3Q A;  4I7B A;  2CON A;  3U5P A;  4FJC A;  2RR4 A;  3V43 A;  2XOZ A;  1HYI A;  2L5U A;  2YUR A;  2CT2 A;  1DCQ A;  4YAT A;  2M13 A;  3VK6 A;  2MA6 A;  2MD7 B;  5FB1 A;  2NAA A;  2LV9 A;  2KWK A;  3JUE A;  4LKA A;  1X4U A;  4Q6F A;  5LKT A;  2K16 A;  3N9O A;  2JMI A;  2G6Q A;  2KIZ A;  2JUN A;  2IDA A;  2KWO A;  2LQ6 A;  2H0D B;  2MIQ A;  4XI1 A;  2Y1N A;  2KU3 A;  3ZNI A;  2MNY A;  4IC3 A;  3I2D A;  1V87 A;  3O35 A;  3FAO A;  3KQI A;  4L58 A;  3LJU X;  2M1R A;  4YBS A;  3GL6 A;  3LQJ A;  2VJF A;  1WEP A;  2G45 A;  2D8S A;  2HYE D;  1DVP A;  2KFT A;  1WEU A;  4R2Y A;  4YAX A;  2FUI A;  4O62 A;  1WEM A;  4GNG A;  4YBM A;  2CKL B;  3KV5 A;  2M3H A;  4GB0 A;  2YHO A;  2VPE A;  5H1U A;  4A0C D;  3FL2 A;  5LKU A;  1WEE A;  1WEV A;  3LQH A;  3O33 A;  2KWJ A;  2L75 A;  1Z60 A;  1Z2Q A;  3MHS A;  3T9K A;  1WE9 A;  4FK5 A;  2YRE A;  2YSJ A;  1WGM A;  2VJE B;  5KH7 A;  2EA6 A;  2YHN A;  1K2F A;  3DDT A;  4X3G A;  5AIU A;  2MKE A;  4A4B A;  4QF2 A;  2OWA A;  3HCS A;  2FUU A; 
#chains in the Genus database with same CATH homology
 4IC2 A;  4MSX A;  1WEO A;  2YUC A;  2XEU A;  1FBV A;  1WEN A;  4R7E A;  4N3W A;  4UI9 B;  3U5N A;  5AIT A;  5B75 A;  2H0D A;  2MNZ A;  4V3L C;  2ZET C;  4S3O B;  1LDJ B;  3T7L A;  1X4J A;  2LDR A;  5B79 A;  1JM7 B;  2AN6 A;  4FO9 A;  2YSM A;  3U5M A;  2KYU A;  4N4F A;  2KR4 A;  4YAB A;  1XWH A;  4P5O B;  4CCG X;  2M85 A;  1T1H A;  2LRI C;  5H9M A;  1JOC A;  5EYA F;  4LLB A;  1G25 A;  2KGG A;  4AUQ B;  5H1T A;  1VYX A;  2LXH C;  4B7Y C;  2JMD A;  4I7C A;  1BOR A;  3M63 A;  4L7X A;  5D1M B;  4WZ0 A;  2Y43 A;  4WZ2 A;  4AYC B;  1WFK A;  2KGI A;  5G05 B;  2CKL A;  4GNE A;  2DX8 A;  2ECW A;  2RSD A;  4V3K C;  5B78 A;  3SOX A;  1IYM A;  5C11 A;  2C2L A;  4BBQ A;  5D1K B;  2YT5 A;  2M6M A;  2YU4 A;  3O37 A;  3O70 A;  2MUM A;  2PNX A;  3DQV R;  3N9N A;  4I7D A;  1RMD A;  5H1V A;  5B77 A;  5J3X A;  1WIL A;  5D1L B;  3C6W A;  3N9P A;  1CHC A;  2K17 A;  2VP7 A;  2F6J A;  4GNF A;  3ZTG A;  3SOW A;  1VD4 A;  3ASL A;  3NG2 A;  1U6G B;  3O34 A;  3M99 A;  2Y1M A;  2LXP C;  3T6R A;  2K1J A;  5I3L A;  3L1X A;  2C2V S;  4LK9 A;  1FP0 A;  1N87 A;  4WA6 A;  3ZYQ A;  2RI7 A;  1JM7 A;  3RTR B;  2E6R A;  4O64 A;  5TAB A;  4CA1 A;  5TBN A;  4AP4 A;  4YBT A;  4A49 A;  2VJF B;  2LGL A;  5FER A;  2YYR A;  3N9M A;  4UP0 A;  3KNV A;  3LQI A;  2VPB A;  4AYC A;  3HCT A;  4UP5 A;  2VPG A;  2ECT A;  2YQL A;  3MHH A;  2QIZ A;  3L1Z B;  4C9Z A;  2JRJ A;  2LGV A;  4ZDT A;  1F62 A;  3GV4 A;  2MA5 A;  4TKP B;  2LN0 A;  3PHD A;  4NN2 A;  2MD8 C;  3HCU A;  5DIN A;  2ECV A;  2VPD A;  2CSY A;  4FIP A;  2G43 A;  2ECI A;  4ZUX U;  1Z6U A;  5B76 A;  5C13 A;  4YC9 A;  5B8D A;  3SHB A;  2K4D A;  5TDR A;  5LKX A;  1WEQ A;  1MM2 A;  3QZV A;  1HYJ A;  3EB6 A;  3EB5 A;  2VNF A;  2F42 A;  4YAD A;  4A4C A;  2VJE A;  2LGK A;  4ZQL A;  3PUR A;  3RPG C;  3HTK C;  5G0F A;  2E6S A;  2KRE A;  2YW8 A;  2KWN A;  2L0B A;  3O7A A;  2L43 A;  2HDP A;  2ECJ A;  4MVT A;  2OXQ C;  5LKZ A;  1WIM A;  3N9Q A;  5JG6 A;  5DKA A;  2EGP A;  5KH9 A;  2XB1 A;  2ECG A;  2PUY A;  2KE1 A;  3SOU A;  2BAY A;  2I50 A;  3U5O A;  4PTB A;  3ZVY A;  4WZ3 B;  3M62 A;  4F52 B;  3RPG B;  2MT5 A;  4LJN A;  1ZBD B;  4QF3 A;  5FEY A;  5TRB A;  1WES A;  5KH3 A;  1X4I A;  3L11 A;  2L80 A;  5FB0 A;  3ZPV 1;  2FSA A;  3LRQ A;  5LCW B;  1E4U A;  2CSZ A;  4W4U A;  2LGG A;  3O36 A;  2F6N A;  4S3O C;  2ECN A;  4B86 C;  2EOD A;  3KV6 A;  2QJ0 A;  3C5K A;  5G04 B;  4AVX A;  4R8P K;  4GND A;  1WEW A;  4PPE A;  2QIC A;  2UZG A;  3IHP A;  5TDW A;  3ZPV E;  1MM3 A;  2JMJ A;  1VFY A;  3PUQ A;  4LAD B;  3DPL R;  4BHW A;  3ZVZ B;  2YQM A;  3N9L A;  1LDK C;  4I7B A;  3U5P A;  4FJC A;  3V43 A;  1HYI A;  2L5U A;  2YUR A;  2CT2 A;  4YAT A;  3VK6 A;  2MA6 A;  2MD7 B;  5FB1 A;  2NAA A;  2LV9 A;  2KWK A;  4LKA A;  1X4U A;  4Q6F A;  5LKT A;  2K16 A;  3N9O A;  2JMI A;  2G6Q A;  2KIZ A;  2IDA A;  2KWO A;  2LQ6 A;  2H0D B;  2MIQ A;  4XI1 A;  2Y1N A;  2KU3 A;  3ZNI A;  2MNY A;  4IC3 A;  3I2D A;  1V87 A;  3O35 A;  3KQI A;  4L58 A;  2M1R A;  4YBS A;  3GL6 A;  3LQJ A;  2VJF A;  1WEP A;  2G45 A;  2D8S A;  2HYE D;  1DVP A;  2KFT A;  1WEU A;  4R2Y A;  4YAX A;  2FUI A;  1WEM A;  4GNG A;  4YBM A;  2CKL B;  3KV5 A;  2M3H A;  4GB0 A;  2YHO A;  2VPE A;  5H1U A;  4A0C D;  3FL2 A;  5LKU A;  1WEE A;  1WEV A;  3LQH A;  3O33 A;  2KWJ A;  2L75 A;  1Z60 A;  1Z2Q A;  3MHS A;  1WE9 A;  4FK5 A;  2YRE A;  2YSJ A;  1WGM A;  2VJE B;  5KH7 A;  2EA6 A;  2YHN A;  1K2F A;  4X3G A;  5AIU A;  4A4B A;  4QF2 A;  3HCS A;  2FUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...