2CT2A

Solution structure of the ring domain of the tripartite motif protein 32
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTVLKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif protein 32
publication title Solution Structure of the RING domain of the Tripartite motif protein 32
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 7
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ct2A00
1E4UA 4UP5A 3SOXA 2K4DA 2L43A 1X4UA 5FERA 2F6JA 4FJCA 2M6MA 2YHNA 4AVXA 2MNYA 3HCUA 4L58A 2YT5A 1BORA 1LDJB 1Z6UA 4XI1A 4R7EA 2LV9A 1WIMA 3U5MA 5DKAA 5H1TA 4WZ3B 1FBVA 2MA5A 4IC3A 1WILA 1MM2A 2YREA 3C5KA 1LDKC 3M99A 3EB5A 4I7BA 1K2FA 2YQLA 3L11A 3LQIA 4LLBA 2LGLA 5KH9A 3PURA 3O36A 1WENA 1HYJA 3I2DA 2EODA 2HYED 3LRQA 2MNZA 4P5OB 3ZNIA 5B79A 2KWNA 5TBNA 4WA6A 1U6GB 4ZQLA 4CCGX 5B78A 4TKPB 4YBTA 4S3OC 2KREA 5FB1A 2PUYA 2L0BA 2VNFA 2YSMA 2JMDA 3QZVA 3U5NA 4W4UA 4GNEA 5B76A 4YBMA 3VK6A 1WESA 2VJFA 1IYMA 2VP7A 4A4CA 5G04B 2CT2A 3O7AA 2LGKA 1VYXA 3HCSA 5LKZA 5D1MB 1VD4A 4FO9A 3HCTA 5LKTA 2XB1A 3C6WA 4A4BA 3IHPA 4AYCB 2M85A 4ZDTA 2VPDA 2YUCA 1WEOA 3U5OA 5TABA 2FUUA 2IDAA 5AITA 3ZYQA 2KGIA 3V43A 2I50A 4X3GA 3KV6A 2CSYA 3O34A 3M62A 5B77A 3ZPV1 2MD8C 4LKAA 4YC9A 3L1ZB 3RTRB 2L75A 4MVTA 4WZ2A 2XEUA 5DINA 3N9PA 4IC2A 2LGVA 2YURA 2LRIC 2EA6A 3PUQA 2E6SA 5H1UA 1Z60A 3M63A 3DQVR 3LQJA 2G6QA 4B86C 5G0FA 4GNGA 1V87A 5J3XA 1WEUA 2ECVA 4L7XA 4PTBA 3RPGC 4I7CA 2NAAA 2ECTA 5FEYA 4BBQA 2LDRA 2YQMA 3GL6A 2M1RA 3MHHA 2JMIA 1HYIA 4ZUXU 2KGGA 3O70A 5C11A 4N3WA 2VPGA 3PHDA 4AP4A 3U5PA 1WEPA 1X4IA 3ZPVE 2QIZA 3SOUA 5JG6A 3KQIA 3N9QA 3N9MA 1F62A 4N4FA 1WEWA 4UP0A 2LGGA 2EGPA 1WEEA 4I7DA 2UZGA 4R8PK 2C2VS 2YU4A 2FUIA 2VJFB 4YATA 2FSAA 5TRBA 2M3HA 5AIUA 2OXQC 1WEVA 4C9ZA 5LCWB 2QJ0A 2KIZA 5KH3A 2L80A 4QF2A 2ECJA 2JMJA 4YBSA 1XWHA 1ZBDB 5TDWA 5B8DA 3LQHA 4CA1A 2H0DB 3ASLA 2LXPC 4F52B 2JRJA 2CKLB 3NG2A 2VPEA 1JM7B 1WEMA 2RI7A 2LXHC 2ECNA 4LJNA 1RMDA 3L1XA 2KU3A 5H1VA 2KWOA 1FP0A 2HDPA 1X4JA 2MIQA 3SHBA 2QICA 2YSJA 4AYCA 1CHCA 2RSDA 2ECGA 3KV5A 4YADA 4S3OB 3MHSA 4B7YC 2BAYA 1N87A 1Z2QA 2VJEA 2YHOA 3N9LA 4WZ0A 4FIPA 4GNFA 4A0CD 1WEQA 2KR4A 4PPEA 3O37A 2MD7B 4BHWA 2G45A 5D1KB 3O35A 4GNDA 1WFKA 2VPBA 3T7LA 2Y1MA 2KYUA 4UI9B 2K1JA 2KE1A 2K17A 2ECIA 2F42A 5G05B 2C2LA 2ECWA 3N9OA 3EB6A 4MSXA 4LADB 3ZVZB 2KWKA 5H9MA 4R2YA 3O33A 4FK5A 3T6RA 1JOCA 3FL2A 2ZETC 2KWJA 4Q6FA 2AN6A 2MUMA 1DVPA 3GV4A 2YW8A 3SOWA 4LK9A 1VFYA 3ZVYA 4V3KC 4AUQB 2Y43A 5B75A 3DPLR 2MA6A 3HTKC 2CSZA 2YYRA 1MM3A 2G43A 2E6RA 2L5UA 4GB0A 2DX8A 2Y1NA 2D8SA 5KH7A 4NN2A 3ZTGA 3RPGB 2LN0A 2KFTA 5LKXA 5C13A 2PNXA 3N9NA 1WE9A 4O64A 5LKUA 3KNVA 4QF3A 5D1LB 4A49A 4V3LC 5EYAF 1G25A 1WGMA 2K16A 4YAXA 2LQ6A 2F6NA 5FB0A 1T1HA 5I3LA 2H0DA 2VJEB 5TDRA 2CKLA 2MT5A 1JM7A 4YABA
chains in the Genus database with same CATH superfamily
1E4UA 4UP5A 3SOXA 2K4DA 2CRWA 2L43A 1X4UA 5FERA 2F6JA 4FJCA 2M6MA 2YHNA 4AVXA 2MNYA 3HCUA 4L58A 2YT5A 1BORA 1LDJB 1Z6UA 4XI1A 2YVRA 4R7EA 2LV9A 1WIMA 2EXUA 3U5MA 5DKAA 5H1TA 4WZ3B 1FBVA 2MA5A 4IC3A 2DJAA 1WILA 1MM2A 5SVYA 3FEHA 2YREA 3C5KA 1LDKC 3M7KA 3M99A 3EB5A 3KDEC 4I7BA 1K2FA 2YQLA 3L11A 3LQIA 4LLBA 2LGLA 5KH9A 3PURA 3O36A 1WENA 2FFWA 1HYJA 3I2DA 2EODA 4O62A 2HYED 3LRQA 2MNZA 4P5OB 3ZNIA 5B79A 2KWNA 5TBNA 4WA6A 1U6GB 4ZQLA 4CCGX 5B78A 3LVRE 4TKPB 4YBTA 4S3OC 2KREA 5FB1A 2PUYA 2L0BA 2VNFA 2YSMA 2JMDA 3QZVA 3U5NA 4W4UA 3E2DA 4GNEA 5B76A 4YBMA 3VK6A 1WESA 2VJFA 1IYMA 1DCQA 2VP7A 4A4CA 2KKYA 5G04B 2CT2A 3O7AA 2LGKA 5SVXA 1VYXA 3HCSA 5LKZA 5D1MB 3FM8C 3FAOA 1VD4A 4FO9A 3HCTA 5LKTA 2XB1A 3FANA 2OWAA 3C6WA 4A4BA 3IHPA 4AYCB 2M85A 4ZDTA 2VPDA 2YUCA 1WEOA 3U5OA 5TABA 2FUUA 3Q1DA 2IDAA 5AITA 3ZYQA 4QQ4A 3O47A 2KGIA 3PLWA 3V43A 2I50A 4X3GA 3KV6A 2CSYA 3O34A 3M62A 5B77A 3ZPV1 2MD8C 4LKAA 4YC9A 3LDYA 3L1ZB 3RTRB 2L75A 4MVTA 4WZ2A 2XEUA 5DINA 3N9PA 4IC2A 2LGVA 2YURA 2LRIC 2EA6A 3PUQA 2E6SA 5H1UA 1Z60A 3M63A 3DDTA 3DQVR 3LQJA 2G6QA 4B86C 5G0FA 4GNGA 1V87A 5J3XA 1WEUA 2ECVA 4L7XA 4PTBA 3RPGC 4I7CA 2NAAA 2ECTA 5FEYA 4BBQA 2LDRA 2YQMA 3GL6A 2M1RA 2IQJA 3MHHA 2JMIA 1HYIA 4ZUXU 2KGGA 3LJUX 3O70A 2XOZA 5C11A 4N3WA 2VPGA 3PHDA 4AP4A 3U5PA 1WEPA 1X4IA 3ZPVE 2QIZA 3SOUA 5JG6A 3KQIA 3N9QA 3N9MA 1F62A 4N4FA 1WEWA 4UP0A 3FJUB 2L7PA 2LGGA 2EGPA 1WEEA 4I7DA 2M13A 2UZGA 4R8PK 2C2VS 2YU4A 1MBMA 2FUIA 2VJFB 4YATA 2FSAA 5TRBA 2M3HA 3DWDA 5AIUA 2XOYA 5SVIA 2OXQC 1WEVA 2DSMA 2CRRA 4C9ZA 2XOCA 5LCWB 2QJ0A 2KIZA 5KH3A 2L80A 4QF2A 2ECJA 2JMJA 4YBSA 1XWHA 1ZBDB 5TDWA 5B8DA 3LQHA 4CA1A 2H0DB 3ASLA 2LXPC 4F52B 2JRJA 2CKLB 3NG2A 2VPEA 1JM7B 2KKXA 5K3QA 1WEMA 2RI7A 2LXHC 3LVQE 4OGEA 2ECNA 2B0OE 4LJNA 1RMDA 4F1PA 3L1XA 2KU3A 5H1VA 2KWOA 2E61A 1FP0A 2HDPA 1X4JA 4OGCA 2MIQA 3SHBA 2D8UA 2QICA 3SUBA 2YSJA 2P57A 4AYCA 1CHCA 2RSDA 2ECGA 3KV5A 4YADA 4S3OB 2CSVA 3MHSA 4B7YC 2BAYA 1N87A 1Z2QA 2VJEA 2YHOA 3N9LA 4WZ0A 4FIPA 4GNFA 4A0CD 1WEQA 2KR4A 4PPEA 3O37A 2MD7B 4BHWA 2FD4A 2G45A 5D1KB 3O35A 4GNDA 1WFKA 2EGMA 2VPBA 3MDBC 3T7LA 2Y1MA 2KYUA 4UI9B 2K1JA 2KE1A 2K17A 2ECIA 2F42A 5G05B 2C2LA 2ECWA 3N9OA 3EB6A 4MSXA 4LADB 3ZVZB 2KWKA 5H9MA 4R2YA 3JUEA 3O33A 4FK5A 3T6RA 1JOCA 3FL2A 5SVIB 2ZETC 2KWJA 4Q6FA 2AN6A 2JM3A 4H9DA 2MUMA 3T9KA 1DVPA 3GV4A 2YW8A 4Z0RA 2RR4A 3SOWA 4LK9A 1VFYA 3ZVYA 4V3KC 4AUQB 2Y43A 5B75A 3DPLR 2MA6A 3HTKC 2CSZA 2YYRA 1MM3A 2G43A 2E6RA 2L5UA 4GB0A 2DX8A 2Y1NA 2D8SA 5KH7A 2CONA 4NN2A 3ZTGA 3RPGB 2LN0A 2JUNA 2KFTA 2LAUA 5LKXA 5C13A 2XP0A 2PNXA 3N9NA 1WE9A 4O64A 5LKUA 3KNVA 4QF3A 5D1LB 4Z0OA 4A49A 4V3LC 5EYAF 1G25A 2MKEA 1WGMA 2K16A 4YAXA 2LQ6A 2F6NA 5FB0A 1T1HA 3H7HA 5I3LA 2H0DA 2VJEB 5TDRA 2CKLA 2MT5A 1JM7A 4YABA
chains in the Genus database with same CATH topology
1E4UA 4UP5A 3SOXA 2K4DA 2L43A 1X4UA 5FERA 2F6JA 4FJCA 2M6MA 2YHNA 4AVXA 2MNYA 3HCUA 4L58A 2YT5A 1BORA 1LDJB 1Z6UA 4XI1A 4R7EA 2LV9A 1WIMA 3U5MA 5DKAA 5H1TA 4WZ3B 1FBVA 2MA5A 4IC3A 1WILA 1MM2A 2YREA 3C5KA 1LDKC 3M99A 3EB5A 4I7BA 1K2FA 2YQLA 3L11A 3LQIA 4LLBA 2LGLA 5KH9A 3PURA 3O36A 1WENA 1HYJA 3I2DA 2EODA 2HYED 3LRQA 2MNZA 4P5OB 3ZNIA 5B79A 2KWNA 5TBNA 4WA6A 1U6GB 4ZQLA 4CCGX 5B78A 4TKPB 4YBTA 4S3OC 2KREA 5FB1A 2PUYA 2L0BA 2VNFA 2YSMA 2JMDA 3QZVA 3U5NA 4W4UA 4GNEA 5B76A 4YBMA 3VK6A 1WESA 2VJFA 1IYMA 2VP7A 4A4CA 5G04B 2CT2A 3O7AA 2LGKA 1VYXA 3HCSA 5LKZA 5D1MB 1VD4A 4FO9A 3HCTA 5LKTA 2XB1A 3C6WA 4A4BA 3IHPA 4AYCB 2M85A 4ZDTA 2VPDA 2YUCA 1WEOA 3U5OA 5TABA 2FUUA 2IDAA 5AITA 3ZYQA 2KGIA 3V43A 2I50A 4X3GA 3KV6A 2CSYA 3O34A 3M62A 5B77A 3ZPV1 2MD8C 4LKAA 4YC9A 3L1ZB 3RTRB 2L75A 4MVTA 4WZ2A 2XEUA 5DINA 3N9PA 4IC2A 2LGVA 2YURA 2LRIC 2EA6A 3PUQA 2E6SA 5H1UA 1Z60A 3M63A 3DQVR 3LQJA 2G6QA 4B86C 5G0FA 4GNGA 1V87A 5J3XA 1WEUA 2ECVA 4L7XA 4PTBA 3RPGC 4I7CA 2NAAA 2ECTA 5FEYA 4BBQA 2LDRA 2YQMA 3GL6A 2M1RA 3MHHA 2JMIA 1HYIA 4ZUXU 2KGGA 3O70A 5C11A 4N3WA 2VPGA 3PHDA 4AP4A 3U5PA 1WEPA 1X4IA 3ZPVE 2QIZA 3SOUA 5JG6A 3KQIA 3N9QA 3N9MA 1F62A 4N4FA 1WEWA 4UP0A 2LGGA 2EGPA 1WEEA 4I7DA 2UZGA 4R8PK 2C2VS 2YU4A 2FUIA 2VJFB 4YATA 2FSAA 5TRBA 2M3HA 5AIUA 2OXQC 1WEVA 4C9ZA 5LCWB 2QJ0A 2KIZA 5KH3A 2L80A 4QF2A 2ECJA 2JMJA 4YBSA 1XWHA 1ZBDB 5TDWA 5B8DA 3LQHA 4CA1A 2H0DB 3ASLA 2LXPC 4F52B 2JRJA 2CKLB 3NG2A 2VPEA 1JM7B 1WEMA 2RI7A 2LXHC 2ECNA 4LJNA 1RMDA 3L1XA 2KU3A 5H1VA 2KWOA 1FP0A 2HDPA 1X4JA 2MIQA 3SHBA 2QICA 2YSJA 4AYCA 1CHCA 2RSDA 2ECGA 3KV5A 4YADA 4S3OB 3MHSA 4B7YC 2BAYA 1N87A 1Z2QA 2VJEA 2YHOA 3N9LA 4WZ0A 4FIPA 4GNFA 4A0CD 1WEQA 2KR4A 4PPEA 3O37A 2MD7B 4BHWA 2G45A 5D1KB 3O35A 4GNDA 1WFKA 2VPBA 3T7LA 2Y1MA 2KYUA 4UI9B 2K1JA 2KE1A 2K17A 2ECIA 2F42A 5G05B 2C2LA 2ECWA 3N9OA 3EB6A 4MSXA 4LADB 3ZVZB 2KWKA 5H9MA 4R2YA 3O33A 4FK5A 3T6RA 1JOCA 3FL2A 2ZETC 2KWJA 4Q6FA 2AN6A 2MUMA 1DVPA 3GV4A 2YW8A 3SOWA 4LK9A 1VFYA 3ZVYA 4V3KC 4AUQB 2Y43A 5B75A 3DPLR 2MA6A 3HTKC 2CSZA 2YYRA 1MM3A 2G43A 2E6RA 2L5UA 4GB0A 2DX8A 2Y1NA 2D8SA 5KH7A 4NN2A 3ZTGA 3RPGB 2LN0A 2KFTA 5LKXA 5C13A 2PNXA 3N9NA 1WE9A 4O64A 5LKUA 3KNVA 4QF3A 5D1LB 4A49A 4V3LC 5EYAF 1G25A 1WGMA 2K16A 4YAXA 2LQ6A 2F6NA 5FB0A 1T1HA 5I3LA 2H0DA 2VJEB 5TDRA 2CKLA 2MT5A 1JM7A 4YABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E4U A;  4UP5 A;  3SOX A;  2K4D A;  2L43 A;  1X4U A;  5FER A;  2F6J A;  4FJC A;  2M6M A;  2YHN A;  4AVX A;  2MNY A;  3HCU A;  4L58 A;  2YT5 A;  1BOR A;  1LDJ B;  1Z6U A;  4XI1 A;  4R7E A;  2LV9 A;  1WIM A;  3U5M A;  5DKA A;  5H1T A;  4WZ3 B;  1FBV A;  2MA5 A;  4IC3 A;  1WIL A;  1MM2 A;  2YRE A;  3C5K A;  1LDK C;  3M99 A;  3EB5 A;  4I7B A;  1K2F A;  2YQL A;  3L11 A;  3LQI A;  4LLB A;  2LGL A;  5KH9 A;  3PUR A;  3O36 A;  1WEN A;  1HYJ A;  3I2D A;  2EOD A;  2HYE D;  3LRQ A;  2MNZ A;  4P5O B;  3ZNI A;  5B79 A;  2KWN A;  5TBN A;  4WA6 A;  1U6G B;  4ZQL A;  4CCG X;  5B78 A;  4TKP B;  4YBT A;  4S3O C;  2KRE A;  5FB1 A;  2PUY A;  2L0B A;  2VNF A;  2YSM A;  2JMD A;  3QZV A;  3U5N A;  4W4U A;  4GNE A;  5B76 A;  4YBM A;  3VK6 A;  1WES A;  2VJF A;  1IYM A;  2VP7 A;  4A4C A;  5G04 B;  2CT2 A;  3O7A A;  2LGK A;  1VYX A;  3HCS A;  5LKZ A;  5D1M B;  1VD4 A;  4FO9 A;  3HCT A;  5LKT A;  2XB1 A;  3C6W A;  4A4B A;  3IHP A;  4AYC B;  2M85 A;  4ZDT A;  2VPD A;  2YUC A;  1WEO A;  3U5O A;  5TAB A;  2FUU A;  2IDA A;  5AIT A;  3ZYQ A;  2KGI A;  3V43 A;  2I50 A;  4X3G A;  3KV6 A;  2CSY A;  3O34 A;  3M62 A;  5B77 A;  3ZPV 1;  2MD8 C;  4LKA A;  4YC9 A;  3L1Z B;  3RTR B;  2L75 A;  4MVT A;  4WZ2 A;  2XEU A;  5DIN A;  3N9P A;  4IC2 A;  2LGV A;  2YUR A;  2LRI C;  2EA6 A;  3PUQ A;  2E6S A;  5H1U A;  1Z60 A;  3M63 A;  3DQV R;  3LQJ A;  2G6Q A;  4B86 C;  5G0F A;  4GNG A;  1V87 A;  5J3X A;  1WEU A;  2ECV A;  4L7X A;  4PTB A;  3RPG C;  4I7C A;  2NAA A;  2ECT A;  5FEY A;  4BBQ A;  2LDR A;  2YQM A;  3GL6 A;  2M1R A;  3MHH A;  2JMI A;  1HYI A;  4ZUX U;  2KGG A;  3O70 A;  5C11 A;  4N3W A;  2VPG A;  3PHD A;  4AP4 A;  3U5P A;  1WEP A;  1X4I A;  3ZPV E;  2QIZ A;  3SOU A;  5JG6 A;  3KQI A;  3N9Q A;  3N9M A;  1F62 A;  4N4F A;  1WEW A;  4UP0 A;  2LGG A;  2EGP A;  1WEE A;  4I7D A;  2UZG A;  4R8P K;  2C2V S;  2YU4 A;  2FUI A;  2VJF B;  4YAT A;  2FSA A;  5TRB A;  2M3H A;  5AIU A;  2OXQ C;  1WEV A;  4C9Z A;  5LCW B;  2QJ0 A;  2KIZ A;  5KH3 A;  2L80 A;  4QF2 A;  2ECJ A;  2JMJ A;  4YBS A;  1XWH A;  1ZBD B;  5TDW A;  5B8D A;  3LQH A;  4CA1 A;  2H0D B;  3ASL A;  2LXP C;  4F52 B;  2JRJ A;  2CKL B;  3NG2 A;  2VPE A;  1JM7 B;  1WEM A;  2RI7 A;  2LXH C;  2ECN A;  4LJN A;  1RMD A;  3L1X A;  2KU3 A;  5H1V A;  2KWO A;  1FP0 A;  2HDP A;  1X4J A;  2MIQ A;  3SHB A;  2QIC A;  2YSJ A;  4AYC A;  1CHC A;  2RSD A;  2ECG A;  3KV5 A;  4YAD A;  4S3O B;  3MHS A;  4B7Y C;  2BAY A;  1N87 A;  1Z2Q A;  2VJE A;  2YHO A;  3N9L A;  4WZ0 A;  4FIP A;  4GNF A;  4A0C D;  1WEQ A;  2KR4 A;  4PPE A;  3O37 A;  2MD7 B;  4BHW A;  2G45 A;  5D1K B;  3O35 A;  4GND A;  1WFK A;  2VPB A;  3T7L A;  2Y1M A;  2KYU A;  4UI9 B;  2K1J A;  2KE1 A;  2K17 A;  2ECI A;  2F42 A;  5G05 B;  2C2L A;  2ECW A;  3N9O A;  3EB6 A;  4MSX A;  4LAD B;  3ZVZ B;  2KWK A;  5H9M A;  4R2Y A;  3O33 A;  4FK5 A;  3T6R A;  1JOC A;  3FL2 A;  2ZET C;  2KWJ A;  4Q6F A;  2AN6 A;  2MUM A;  1DVP A;  3GV4 A;  2YW8 A;  3SOW A;  4LK9 A;  1VFY A;  3ZVY A;  4V3K C;  4AUQ B;  2Y43 A;  5B75 A;  3DPL R;  2MA6 A;  3HTK C;  2CSZ A;  2YYR A;  1MM3 A;  2G43 A;  2E6R A;  2L5U A;  4GB0 A;  2DX8 A;  2Y1N A;  2D8S A;  5KH7 A;  4NN2 A;  3ZTG A;  3RPG B;  2LN0 A;  2KFT A;  5LKX A;  5C13 A;  2PNX A;  3N9N A;  1WE9 A;  4O64 A;  5LKU A;  3KNV A;  4QF3 A;  5D1L B;  4A49 A;  4V3L C;  5EYA F;  1G25 A;  1WGM A;  2K16 A;  4YAX A;  2LQ6 A;  2F6N A;  5FB0 A;  1T1H A;  5I3L A;  2H0D A;  2VJE B;  5TDR A;  2CKL A;  2MT5 A;  1JM7 A;  4YAB A; 
#chains in the Genus database with same CATH topology
 1E4U A;  4UP5 A;  3SOX A;  2K4D A;  2CRW A;  2L43 A;  1X4U A;  5FER A;  2F6J A;  4FJC A;  2M6M A;  2YHN A;  4AVX A;  2MNY A;  3HCU A;  4L58 A;  2YT5 A;  1BOR A;  1LDJ B;  1Z6U A;  4XI1 A;  2YVR A;  4R7E A;  2LV9 A;  1WIM A;  2EXU A;  3U5M A;  5DKA A;  5H1T A;  4WZ3 B;  1FBV A;  2MA5 A;  4IC3 A;  2DJA A;  1WIL A;  1MM2 A;  5SVY A;  3FEH A;  2YRE A;  3C5K A;  1LDK C;  3M7K A;  3M99 A;  3EB5 A;  3KDE C;  4I7B A;  1K2F A;  2YQL A;  3L11 A;  3LQI A;  4LLB A;  2LGL A;  5KH9 A;  3PUR A;  3O36 A;  1WEN A;  2FFW A;  1HYJ A;  3I2D A;  2EOD A;  4O62 A;  2HYE D;  3LRQ A;  2MNZ A;  4P5O B;  3ZNI A;  5B79 A;  2KWN A;  5TBN A;  4WA6 A;  1U6G B;  4ZQL A;  4CCG X;  5B78 A;  3LVR E;  4TKP B;  4YBT A;  4S3O C;  2KRE A;  5FB1 A;  2PUY A;  2L0B A;  2VNF A;  2YSM A;  2JMD A;  3QZV A;  3U5N A;  4W4U A;  3E2D A;  4GNE A;  5B76 A;  4YBM A;  3VK6 A;  1WES A;  2VJF A;  1IYM A;  1DCQ A;  2VP7 A;  4A4C A;  2KKY A;  5G04 B;  2CT2 A;  3O7A A;  2LGK A;  5SVX A;  1VYX A;  3HCS A;  5LKZ A;  5D1M B;  3FM8 C;  3FAO A;  1VD4 A;  4FO9 A;  3HCT A;  5LKT A;  2XB1 A;  3FAN A;  2OWA A;  3C6W A;  4A4B A;  3IHP A;  4AYC B;  2M85 A;  4ZDT A;  2VPD A;  2YUC A;  1WEO A;  3U5O A;  5TAB A;  2FUU A;  3Q1D A;  2IDA A;  5AIT A;  3ZYQ A;  4QQ4 A;  3O47 A;  2KGI A;  3PLW A;  3V43 A;  2I50 A;  4X3G A;  3KV6 A;  2CSY A;  3O34 A;  3M62 A;  5B77 A;  3ZPV 1;  2MD8 C;  4LKA A;  4YC9 A;  3LDY A;  3L1Z B;  3RTR B;  2L75 A;  4MVT A;  4WZ2 A;  2XEU A;  5DIN A;  3N9P A;  4IC2 A;  2LGV A;  2YUR A;  2LRI C;  2EA6 A;  3PUQ A;  2E6S A;  5H1U A;  1Z60 A;  3M63 A;  3DDT A;  3DQV R;  3LQJ A;  2G6Q A;  4B86 C;  5G0F A;  4GNG A;  1V87 A;  5J3X A;  1WEU A;  2ECV A;  4L7X A;  4PTB A;  3RPG C;  4I7C A;  2NAA A;  2ECT A;  5FEY A;  4BBQ A;  2LDR A;  2YQM A;  3GL6 A;  2M1R A;  2IQJ A;  3MHH A;  2JMI A;  1HYI A;  4ZUX U;  2KGG A;  3LJU X;  3O70 A;  2XOZ A;  5C11 A;  4N3W A;  2VPG A;  3PHD A;  4AP4 A;  3U5P A;  1WEP A;  1X4I A;  3ZPV E;  2QIZ A;  3SOU A;  5JG6 A;  3KQI A;  3N9Q A;  3N9M A;  1F62 A;  4N4F A;  1WEW A;  4UP0 A;  3FJU B;  2L7P A;  2LGG A;  2EGP A;  1WEE A;  4I7D A;  2M13 A;  2UZG A;  4R8P K;  2C2V S;  2YU4 A;  1MBM A;  2FUI A;  2VJF B;  4YAT A;  2FSA A;  5TRB A;  2M3H A;  3DWD A;  5AIU A;  2XOY A;  5SVI A;  2OXQ C;  1WEV A;  2DSM A;  2CRR A;  4C9Z A;  2XOC A;  5LCW B;  2QJ0 A;  2KIZ A;  5KH3 A;  2L80 A;  4QF2 A;  2ECJ A;  2JMJ A;  4YBS A;  1XWH A;  1ZBD B;  5TDW A;  5B8D A;  3LQH A;  4CA1 A;  2H0D B;  3ASL A;  2LXP C;  4F52 B;  2JRJ A;  2CKL B;  3NG2 A;  2VPE A;  1JM7 B;  2KKX A;  5K3Q A;  1WEM A;  2RI7 A;  2LXH C;  3LVQ E;  4OGE A;  2ECN A;  2B0O E;  4LJN A;  1RMD A;  4F1P A;  3L1X A;  2KU3 A;  5H1V A;  2KWO A;  2E61 A;  1FP0 A;  2HDP A;  1X4J A;  4OGC A;  2MIQ A;  3SHB A;  2D8U A;  2QIC A;  3SUB A;  2YSJ A;  2P57 A;  4AYC A;  1CHC A;  2RSD A;  2ECG A;  3KV5 A;  4YAD A;  4S3O B;  2CSV A;  3MHS A;  4B7Y C;  2BAY A;  1N87 A;  1Z2Q A;  2VJE A;  2YHO A;  3N9L A;  4WZ0 A;  4FIP A;  4GNF A;  4A0C D;  1WEQ A;  2KR4 A;  4PPE A;  3O37 A;  2MD7 B;  4BHW A;  2FD4 A;  2G45 A;  5D1K B;  3O35 A;  4GND A;  1WFK A;  2EGM A;  2VPB A;  3MDB C;  3T7L A;  2Y1M A;  2KYU A;  4UI9 B;  2K1J A;  2KE1 A;  2K17 A;  2ECI A;  2F42 A;  5G05 B;  2C2L A;  2ECW A;  3N9O A;  3EB6 A;  4MSX A;  4LAD B;  3ZVZ B;  2KWK A;  5H9M A;  4R2Y A;  3JUE A;  3O33 A;  4FK5 A;  3T6R A;  1JOC A;  3FL2 A;  5SVI B;  2ZET C;  2KWJ A;  4Q6F A;  2AN6 A;  2JM3 A;  4H9D A;  2MUM A;  3T9K A;  1DVP A;  3GV4 A;  2YW8 A;  4Z0R A;  2RR4 A;  3SOW A;  4LK9 A;  1VFY A;  3ZVY A;  4V3K C;  4AUQ B;  2Y43 A;  5B75 A;  3DPL R;  2MA6 A;  3HTK C;  2CSZ A;  2YYR A;  1MM3 A;  2G43 A;  2E6R A;  2L5U A;  4GB0 A;  2DX8 A;  2Y1N A;  2D8S A;  5KH7 A;  2CON A;  4NN2 A;  3ZTG A;  3RPG B;  2LN0 A;  2JUN A;  2KFT A;  2LAU A;  5LKX A;  5C13 A;  2XP0 A;  2PNX A;  3N9N A;  1WE9 A;  4O64 A;  5LKU A;  3KNV A;  4QF3 A;  5D1L B;  4Z0O A;  4A49 A;  4V3L C;  5EYA F;  1G25 A;  2MKE A;  1WGM A;  2K16 A;  4YAX A;  2LQ6 A;  2F6N A;  5FB0 A;  1T1H A;  3H7H A;  5I3L A;  2H0D A;  2VJE B;  5TDR A;  2CKL A;  2MT5 A;  1JM7 A;  4YAB A; 
#chains in the Genus database with same CATH homology
 1E4U A;  4UP5 A;  3SOX A;  2K4D A;  2L43 A;  1X4U A;  5FER A;  2F6J A;  4FJC A;  2M6M A;  2YHN A;  4AVX A;  2MNY A;  3HCU A;  4L58 A;  2YT5 A;  1BOR A;  1LDJ B;  1Z6U A;  4XI1 A;  4R7E A;  2LV9 A;  1WIM A;  3U5M A;  5DKA A;  5H1T A;  4WZ3 B;  1FBV A;  2MA5 A;  4IC3 A;  1WIL A;  1MM2 A;  2YRE A;  3C5K A;  1LDK C;  3M99 A;  3EB5 A;  4I7B A;  1K2F A;  2YQL A;  3L11 A;  3LQI A;  4LLB A;  2LGL A;  5KH9 A;  3PUR A;  3O36 A;  1WEN A;  1HYJ A;  3I2D A;  2EOD A;  2HYE D;  3LRQ A;  2MNZ A;  4P5O B;  3ZNI A;  5B79 A;  2KWN A;  5TBN A;  4WA6 A;  1U6G B;  4ZQL A;  4CCG X;  5B78 A;  4TKP B;  4YBT A;  4S3O C;  2KRE A;  5FB1 A;  2PUY A;  2L0B A;  2VNF A;  2YSM A;  2JMD A;  3QZV A;  3U5N A;  4W4U A;  4GNE A;  5B76 A;  4YBM A;  3VK6 A;  1WES A;  2VJF A;  1IYM A;  2VP7 A;  4A4C A;  5G04 B;  2CT2 A;  3O7A A;  2LGK A;  1VYX A;  3HCS A;  5LKZ A;  5D1M B;  1VD4 A;  4FO9 A;  3HCT A;  5LKT A;  2XB1 A;  3C6W A;  4A4B A;  3IHP A;  4AYC B;  2M85 A;  4ZDT A;  2VPD A;  2YUC A;  1WEO A;  3U5O A;  5TAB A;  2FUU A;  2IDA A;  5AIT A;  3ZYQ A;  2KGI A;  3V43 A;  2I50 A;  4X3G A;  3KV6 A;  2CSY A;  3O34 A;  3M62 A;  5B77 A;  3ZPV 1;  2MD8 C;  4LKA A;  4YC9 A;  3L1Z B;  3RTR B;  2L75 A;  4MVT A;  4WZ2 A;  2XEU A;  5DIN A;  3N9P A;  4IC2 A;  2LGV A;  2YUR A;  2LRI C;  2EA6 A;  3PUQ A;  2E6S A;  5H1U A;  1Z60 A;  3M63 A;  3DQV R;  3LQJ A;  2G6Q A;  4B86 C;  5G0F A;  4GNG A;  1V87 A;  5J3X A;  1WEU A;  2ECV A;  4L7X A;  4PTB A;  3RPG C;  4I7C A;  2NAA A;  2ECT A;  5FEY A;  4BBQ A;  2LDR A;  2YQM A;  3GL6 A;  2M1R A;  3MHH A;  2JMI A;  1HYI A;  4ZUX U;  2KGG A;  3O70 A;  5C11 A;  4N3W A;  2VPG A;  3PHD A;  4AP4 A;  3U5P A;  1WEP A;  1X4I A;  3ZPV E;  2QIZ A;  3SOU A;  5JG6 A;  3KQI A;  3N9Q A;  3N9M A;  1F62 A;  4N4F A;  1WEW A;  4UP0 A;  2LGG A;  2EGP A;  1WEE A;  4I7D A;  2UZG A;  4R8P K;  2C2V S;  2YU4 A;  2FUI A;  2VJF B;  4YAT A;  2FSA A;  5TRB A;  2M3H A;  5AIU A;  2OXQ C;  1WEV A;  4C9Z A;  5LCW B;  2QJ0 A;  2KIZ A;  5KH3 A;  2L80 A;  4QF2 A;  2ECJ A;  2JMJ A;  4YBS A;  1XWH A;  1ZBD B;  5TDW A;  5B8D A;  3LQH A;  4CA1 A;  2H0D B;  3ASL A;  2LXP C;  4F52 B;  2JRJ A;  2CKL B;  3NG2 A;  2VPE A;  1JM7 B;  1WEM A;  2RI7 A;  2LXH C;  2ECN A;  4LJN A;  1RMD A;  3L1X A;  2KU3 A;  5H1V A;  2KWO A;  1FP0 A;  2HDP A;  1X4J A;  2MIQ A;  3SHB A;  2QIC A;  2YSJ A;  4AYC A;  1CHC A;  2RSD A;  2ECG A;  3KV5 A;  4YAD A;  4S3O B;  3MHS A;  4B7Y C;  2BAY A;  1N87 A;  1Z2Q A;  2VJE A;  2YHO A;  3N9L A;  4WZ0 A;  4FIP A;  4GNF A;  4A0C D;  1WEQ A;  2KR4 A;  4PPE A;  3O37 A;  2MD7 B;  4BHW A;  2G45 A;  5D1K B;  3O35 A;  4GND A;  1WFK A;  2VPB A;  3T7L A;  2Y1M A;  2KYU A;  4UI9 B;  2K1J A;  2KE1 A;  2K17 A;  2ECI A;  2F42 A;  5G05 B;  2C2L A;  2ECW A;  3N9O A;  3EB6 A;  4MSX A;  4LAD B;  3ZVZ B;  2KWK A;  5H9M A;  4R2Y A;  3O33 A;  4FK5 A;  3T6R A;  1JOC A;  3FL2 A;  2ZET C;  2KWJ A;  4Q6F A;  2AN6 A;  2MUM A;  1DVP A;  3GV4 A;  2YW8 A;  3SOW A;  4LK9 A;  1VFY A;  3ZVY A;  4V3K C;  4AUQ B;  2Y43 A;  5B75 A;  3DPL R;  2MA6 A;  3HTK C;  2CSZ A;  2YYR A;  1MM3 A;  2G43 A;  2E6R A;  2L5U A;  4GB0 A;  2DX8 A;  2Y1N A;  2D8S A;  5KH7 A;  4NN2 A;  3ZTG A;  3RPG B;  2LN0 A;  2KFT A;  5LKX A;  5C13 A;  2PNX A;  3N9N A;  1WE9 A;  4O64 A;  5LKU A;  3KNV A;  4QF3 A;  5D1L B;  4A49 A;  4V3L C;  5EYA F;  1G25 A;  1WGM A;  2K16 A;  4YAX A;  2LQ6 A;  2F6N A;  5FB0 A;  1T1H A;  5I3L A;  2H0D A;  2VJE B;  5TDR A;  2CKL A;  2MT5 A;  1JM7 A;  4YAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...