2CT2A

Solution structure of the ring domain of the tripartite motif protein 32
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
GSSGSSGNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQLTDNLTVLKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif protein 32
publication title Solution Structure of the RING domain of the Tripartite motif protein 32
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 7
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13445 zf-RING_UBOX RING-type zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ct2A00
1XWHA 3U5PA 2K17A 3N9MA 4ZQLA 1VYXA 2RI7A 5J3XA 4AYCA 2KWJA 3M99A 4UP5A 4NN2A 1Z60A 2L80A 1WEUA 4B7YC 2C2LA 3DQVR 2UZGA 2XB1A 2Y43A 1BORA 3C5KA 3HTKC 2LGGA 3ZPVE 2KGGA 5B78A 2Y1MA 3EB6A 4IC2A 2EODA 3HCTA 5FERA 2YT5A 2YQLA 3O33A 1JOCA 2KU3A 2H0DA 5TDRA 2E6RA 3SOWA 4AVXA 2CKLB 4XI1A 3N9PA 5G0FA 2KIZA 1VFYA 5DKAA 1IYMA 2K1JA 2VP7A 3GV4A 4I7CA 5H1VA 3T6RA 3DPLR 2KREA 3FL2A 2ECGA 4P5OB 4A4BA 2QIZA 1JM7A 5D1KB 4YBMA 4QF3A 2XEUA 3U5OA 5FEYA 5JG6A 2KWKA 1WILA 5B77A 3PURA 3ZVYA 2MA5A 2Y1NA 5B8DA 5LKXA 4GNDA 5D1LB 5B79A 2KFTA 4BHWA 3ZPV1 2VJFB 2D8SA 2MT5A 4LJNA 1WEPA 3ZNIA 4ZUXU 2MNYA 4YC9A 3RTRB 1LDKC 2VJFA 2CSZA 2JMIA 4LKAA 3M63A 3O34A 4S3OC 4ZDTA 2F6NA 2M3HA 2VPDA 3KV5A 2DX8A 4MVTA 2RSDA 5I3LA 4UP0A 1F62A 2H0DB 2NAAA 3LQJA 2ECNA 1WEOA 2QICA 3MHSA 2HYED 1ZBDB 2YREA 3NG2A 4MSXA 4CCGX 2YUCA 3RPGB 1WEQA 2MA6A 4R8PK 5G05B 2MD8C 1X4UA 5G04B 2ECTA 4YATA 3L1ZB 2FUIA 4YAXA 1G25A 3U5MA 2E6SA 2VPEA 5C11A 5H1UA 1JM7B 2G45A 2G43A 4YADA 2M85A 3HCSA 2F6JA 4R7EA 3KV6A 5KH9A 4Q6FA 3C6WA 5H9MA 4C9ZA 2MNZA 2LV9A 2ECWA 2M1RA 1T1HA 2YSJA 4V3LC 4I7BA 4WZ2A 4A0CD 2FSAA 4FK5A 2LRIC 1MM3A 3SOXA 4AUQB 2ECIA 4FO9A 4UI9B 1Z2QA 3ZTGA 5KH7A 2BAYA 4V3KC 2LGLA 3GL6A 1WGMA 2YHNA 3HCUA 2YURA 2YQMA 2KWOA 5FB0A 3ZYQA 2VPGA 3QZVA 3KQIA 1FBVA 5TABA 5AIUA 2F42A 2LXHC 4N4FA 3ZVZB 1K2FA 5TRBA 1U6GB 3LRQA 4BBQA 5B75A 3O35A 2LQ6A 2EA6A 3SOUA 1WFKA 1V87A 2LDRA 5D1MB 2VJEA 3L1XA 4X3GA 3KNVA 3U5NA 1Z6UA 2YSMA 3LQHA 2L43A 1HYJA 3O37A 1WEVA 2VPBA 2MIQA 3LQIA 2KYUA 4FJCA 4R2YA 5H1TA 2C2VS 2I50A 2MUMA 2JMJA 2VNFA 4LADB 5DINA 2HDPA 2ECJA 4W4UA 2LXPC 1DVPA 2QJ0A 4AP4A 2CSYA 3O36A 1X4JA 5EYAF 2L0BA 5AITA 1WEEA 1WENA 4GB0A 1X4IA 2L5UA 3EB5A 4YBSA 3RPGC 5FB1A 5TBNA 4PPEA 1E4UA 4FIPA 3L11A 4L7XA 3T7LA 1CHCA 4IC3A 4QF2A 2KR4A 2CT2A 4O64A 3N9NA 2JMDA 2KWNA 2OXQC 2KGIA 3SHBA 4WA6A 2ECVA 4WZ3B 3O7AA 2LGKA 4YABA 3IHPA 4A4CA 5C13A 2G6QA 2LN0A 3N9LA 1WEMA 5LKZA 3M62A 5LCWB 1WEWA 2PUYA 4GNFA 3ASLA 3O70A 3PUQA 2CKLA 4I7DA 3I2DA 5TDWA 2YW8A 3V43A 3VK6A 4B86C 1MM2A 1N87A 4L58A 4PTBA 3PHDA 4LLBA 4WZ0A 2EGPA 2ZETC 1WE9A 4F52B 2VJEB 2YU4A 2K4DA 2M6MA 2IDAA 1LDJB 4TKPB 5LKUA 2L75A 2KE1A 4YBTA 2YYRA 2FUUA 4GNEA 2AN6A 1WIMA 2JRJA 1RMDA 5B76A 1WESA 5LKTA 4AYCB 2K16A 3N9OA 4S3OB 1VD4A 4N3WA 1HYIA 1FP0A 4A49A 2YHOA 4LK9A 5KH3A 2MD7B 3MHHA 3N9QA 4CA1A 2LGVA 4GNGA 2PNXA
chains in the Genus database with same CATH superfamily
1XWHA 5SVYA 3U5PA 2K17A 3N9MA 3O47A 4ZQLA 1VYXA 2RI7A 5J3XA 4AYCA 2KWJA 3M99A 3LDYA 4UP5A 4NN2A 1Z60A 2L80A 4O62A 1WEUA 4B7YC 2C2LA 3DQVR 2UZGA 2XB1A 2Y43A 1BORA 3C5KA 3HTKC 2JM3A 2LGGA 3ZPVE 2KGGA 5B78A 2Y1MA 3EB6A 4IC2A 2EODA 1DCQA 3HCTA 5FERA 2YT5A 2YQLA 3O33A 1JOCA 2KU3A 2H0DA 2FFWA 5TDRA 2E6RA 3SOWA 4AVXA 2CKLB 4XI1A 3N9PA 5G0FA 2KIZA 1VFYA 5DKAA 1IYMA 2K1JA 2VP7A 3GV4A 4I7CA 5H1VA 3T6RA 3KDEC 3DPLR 2XOYA 2KREA 3FL2A 2ECGA 4P5OB 4A4BA 2QIZA 1JM7A 5D1KB 4YBMA 5K3QA 4QF3A 2E61A 2XEUA 3U5OA 5FEYA 5JG6A 2KWKA 2P57A 1WILA 5B77A 3PURA 3ZVYA 2MA5A 3FAOA 2Y1NA 5B8DA 5LKXA 4GNDA 5D1LB 5B79A 2EGMA 2DSMA 2KFTA 4BHWA 3ZPV1 2VJFB 4Z0RA 2D8SA 2MT5A 2CONA 2YVRA 4LJNA 1WEPA 3ZNIA 3Q1DA 3FM8C 4ZUXU 2MNYA 4YC9A 3RTRB 1LDKC 2VJFA 2CSZA 2JMIA 4LKAA 5SVXA 3M63A 3O34A 4S3OC 4ZDTA 2F6NA 2XOZA 2M3HA 2VPDA 2D8UA 3KV5A 2DX8A 4MVTA 2RSDA 5I3LA 4UP0A 1F62A 2H0DB 2NAAA 3LQJA 2ECNA 1WEOA 2QICA 3MHSA 2HYED 1ZBDB 2XP0A 2YREA 3NG2A 4MSXA 4CCGX 2YUCA 3RPGB 1WEQA 2MA6A 4R8PK 3FJUB 5G05B 2MD8C 1X4UA 5G04B 2ECTA 5SVIB 4YATA 3L1ZB 2FUIA 4YAXA 1G25A 3U5MA 2E6SA 2VPEA 5C11A 5H1UA 1JM7B 2G45A 2G43A 4YADA 2M85A 3HCSA 2F6JA 4R7EA 3KV6A 5KH9A 4Q6FA 3C6WA 5H9MA 4C9ZA 5SVIA 2MNZA 2LV9A 4OGCA 2ECWA 2M1RA 1T1HA 2YSJA 4V3LC 4I7BA 4WZ2A 4A0CD 2FSAA 4FK5A 2LRIC 1MM3A 3SOXA 4AUQB 2ECIA 4FO9A 4UI9B 3LJUX 3JUEA 1Z2QA 3ZTGA 5KH7A 2BAYA 4V3KC 2LGLA 3GL6A 1WGMA 2YHNA 2JUNA 2KKYA 2XOCA 3HCUA 2CSVA 2YURA 2YQMA 2KWOA 2B0OE 5FB0A 3ZYQA 2VPGA 3QZVA 2LAUA 3KQIA 1FBVA 3FEHA 5TABA 5AIUA 2F42A 2LXHC 3E2DA 4N4FA 3ZVZB 1K2FA 2CRWA 5TRBA 1U6GB 3LRQA 4BBQA 5B75A 3O35A 2LQ6A 2EA6A 1WFKA 3SOUA 4H9DA 1V87A 2LDRA 5D1MB 2VJEA 3L1XA 4X3GA 2OWAA 3KNVA 3U5NA 1Z6UA 2MKEA 2YSMA 3LQHA 2L43A 1HYJA 2L7PA 3O37A 1WEVA 2VPBA 2MIQA 3LQIA 4Z0OA 2CRRA 3DWDA 2KYUA 4FJCA 3PLWA 4R2YA 5H1TA 2C2VS 2I50A 2MUMA 2JMJA 3SUBA 2VNFA 4LADB 5DINA 2HDPA 2ECJA 4W4UA 2FD4A 3DDTA 2LXPC 1DVPA 2QJ0A 4OGEA 4AP4A 2CSYA 3O36A 1X4JA 5EYAF 2L0BA 3LVQE 5AITA 1WEEA 1WENA 4GB0A 1X4IA 2L5UA 3EB5A 4YBSA 3RPGC 3H7HA 5FB1A 1MBMA 5TBNA 4PPEA 1E4UA 2EXUA 4FIPA 3L11A 4L7XA 3T7LA 1CHCA 4IC3A 4QF2A 2KR4A 3FANA 2CT2A 4O64A 3N9NA 2JMDA 4QQ4A 2KKXA 2IQJA 2KWNA 2OXQC 2KGIA 4F1PA 3SHBA 4WA6A 2ECVA 4WZ3B 3O7AA 2LGKA 4YABA 3IHPA 4A4CA 5C13A 2G6QA 3M7KA 2LN0A 3N9LA 1WEMA 2DJAA 5LKZA 3M62A 5LCWB 1WEWA 2PUYA 4GNFA 3ASLA 3O70A 3LVRE 3PUQA 2CKLA 4I7DA 3I2DA 5TDWA 2YW8A 3V43A 3VK6A 4B86C 3T9KA 1MM2A 1N87A 4L58A 4PTBA 3PHDA 4LLBA 4WZ0A 2EGPA 2M13A 2ZETC 1WE9A 4F52B 2VJEB 2YU4A 2K4DA 2M6MA 2IDAA 1LDJB 4TKPB 5LKUA 2L75A 2KE1A 4YBTA 2YYRA 2FUUA 4GNEA 2AN6A 1WIMA 2JRJA 1RMDA 5B76A 1WESA 5LKTA 4AYCB 3MDBC 2K16A 3N9OA 4S3OB 1VD4A 4N3WA 1HYIA 1FP0A 4A49A 2YHOA 2RR4A 4LK9A 5KH3A 2MD7B 3MHHA 3N9QA 4CA1A 2LGVA 4GNGA 2PNXA
chains in the Genus database with same CATH topology
1XWHA 3U5PA 2K17A 3N9MA 4ZQLA 1VYXA 2RI7A 5J3XA 4AYCA 2KWJA 3M99A 4UP5A 4NN2A 1Z60A 2L80A 1WEUA 4B7YC 2C2LA 3DQVR 2UZGA 2XB1A 2Y43A 1BORA 3C5KA 3HTKC 2LGGA 3ZPVE 2KGGA 5B78A 2Y1MA 3EB6A 4IC2A 2EODA 3HCTA 5FERA 2YT5A 2YQLA 3O33A 1JOCA 2KU3A 2H0DA 5TDRA 2E6RA 3SOWA 4AVXA 2CKLB 4XI1A 3N9PA 5G0FA 2KIZA 1VFYA 5DKAA 1IYMA 2K1JA 2VP7A 3GV4A 4I7CA 5H1VA 3T6RA 3DPLR 2KREA 3FL2A 2ECGA 4P5OB 4A4BA 2QIZA 1JM7A 5D1KB 4YBMA 4QF3A 2XEUA 3U5OA 5FEYA 5JG6A 2KWKA 1WILA 5B77A 3PURA 3ZVYA 2MA5A 2Y1NA 5B8DA 5LKXA 4GNDA 5D1LB 5B79A 2KFTA 4BHWA 3ZPV1 2VJFB 2D8SA 2MT5A 4LJNA 1WEPA 3ZNIA 4ZUXU 2MNYA 4YC9A 3RTRB 1LDKC 2VJFA 2CSZA 2JMIA 4LKAA 3M63A 3O34A 4S3OC 4ZDTA 2F6NA 2M3HA 2VPDA 3KV5A 2DX8A 4MVTA 2RSDA 5I3LA 4UP0A 1F62A 2H0DB 2NAAA 3LQJA 2ECNA 1WEOA 2QICA 3MHSA 2HYED 1ZBDB 2YREA 3NG2A 4MSXA 4CCGX 2YUCA 3RPGB 1WEQA 2MA6A 4R8PK 5G05B 2MD8C 1X4UA 5G04B 2ECTA 4YATA 3L1ZB 2FUIA 4YAXA 1G25A 3U5MA 2E6SA 2VPEA 5C11A 5H1UA 1JM7B 2G45A 2G43A 4YADA 2M85A 3HCSA 2F6JA 4R7EA 3KV6A 5KH9A 4Q6FA 3C6WA 5H9MA 4C9ZA 2MNZA 2LV9A 2ECWA 2M1RA 1T1HA 2YSJA 4V3LC 4I7BA 4WZ2A 4A0CD 2FSAA 4FK5A 2LRIC 1MM3A 3SOXA 4AUQB 2ECIA 4FO9A 4UI9B 1Z2QA 3ZTGA 5KH7A 2BAYA 4V3KC 2LGLA 3GL6A 1WGMA 2YHNA 3HCUA 2YURA 2YQMA 2KWOA 5FB0A 3ZYQA 2VPGA 3QZVA 3KQIA 1FBVA 5TABA 5AIUA 2F42A 2LXHC 4N4FA 3ZVZB 1K2FA 5TRBA 1U6GB 3LRQA 4BBQA 5B75A 3O35A 2LQ6A 2EA6A 3SOUA 1WFKA 1V87A 2LDRA 5D1MB 2VJEA 3L1XA 4X3GA 3KNVA 3U5NA 1Z6UA 2YSMA 3LQHA 2L43A 1HYJA 3O37A 1WEVA 2VPBA 2MIQA 3LQIA 2KYUA 4FJCA 4R2YA 5H1TA 2C2VS 2I50A 2MUMA 2JMJA 2VNFA 4LADB 5DINA 2HDPA 2ECJA 4W4UA 2LXPC 1DVPA 2QJ0A 4AP4A 2CSYA 3O36A 1X4JA 5EYAF 2L0BA 5AITA 1WEEA 1WENA 4GB0A 1X4IA 2L5UA 3EB5A 4YBSA 3RPGC 5FB1A 5TBNA 4PPEA 1E4UA 4FIPA 3L11A 4L7XA 3T7LA 1CHCA 4IC3A 4QF2A 2KR4A 2CT2A 4O64A 3N9NA 2JMDA 2KWNA 2OXQC 2KGIA 3SHBA 4WA6A 2ECVA 4WZ3B 3O7AA 2LGKA 4YABA 3IHPA 4A4CA 5C13A 2G6QA 2LN0A 3N9LA 1WEMA 5LKZA 3M62A 5LCWB 1WEWA 2PUYA 4GNFA 3ASLA 3O70A 3PUQA 2CKLA 4I7DA 3I2DA 5TDWA 2YW8A 3V43A 3VK6A 4B86C 1MM2A 1N87A 4L58A 4PTBA 3PHDA 4LLBA 4WZ0A 2EGPA 2ZETC 1WE9A 4F52B 2VJEB 2YU4A 2K4DA 2M6MA 2IDAA 1LDJB 4TKPB 5LKUA 2L75A 2KE1A 4YBTA 2YYRA 2FUUA 4GNEA 2AN6A 1WIMA 2JRJA 1RMDA 5B76A 1WESA 5LKTA 4AYCB 2K16A 3N9OA 4S3OB 1VD4A 4N3WA 1HYIA 1FP0A 4A49A 2YHOA 4LK9A 5KH3A 2MD7B 3MHHA 3N9QA 4CA1A 2LGVA 4GNGA 2PNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWH A;  3U5P A;  2K17 A;  3N9M A;  4ZQL A;  1VYX A;  2RI7 A;  5J3X A;  4AYC A;  2KWJ A;  3M99 A;  4UP5 A;  4NN2 A;  1Z60 A;  2L80 A;  1WEU A;  4B7Y C;  2C2L A;  3DQV R;  2UZG A;  2XB1 A;  2Y43 A;  1BOR A;  3C5K A;  3HTK C;  2LGG A;  3ZPV E;  2KGG A;  5B78 A;  2Y1M A;  3EB6 A;  4IC2 A;  2EOD A;  3HCT A;  5FER A;  2YT5 A;  2YQL A;  3O33 A;  1JOC A;  2KU3 A;  2H0D A;  5TDR A;  2E6R A;  3SOW A;  4AVX A;  2CKL B;  4XI1 A;  3N9P A;  5G0F A;  2KIZ A;  1VFY A;  5DKA A;  1IYM A;  2K1J A;  2VP7 A;  3GV4 A;  4I7C A;  5H1V A;  3T6R A;  3DPL R;  2KRE A;  3FL2 A;  2ECG A;  4P5O B;  4A4B A;  2QIZ A;  1JM7 A;  5D1K B;  4YBM A;  4QF3 A;  2XEU A;  3U5O A;  5FEY A;  5JG6 A;  2KWK A;  1WIL A;  5B77 A;  3PUR A;  3ZVY A;  2MA5 A;  2Y1N A;  5B8D A;  5LKX A;  4GND A;  5D1L B;  5B79 A;  2KFT A;  4BHW A;  3ZPV 1;  2VJF B;  2D8S A;  2MT5 A;  4LJN A;  1WEP A;  3ZNI A;  4ZUX U;  2MNY A;  4YC9 A;  3RTR B;  1LDK C;  2VJF A;  2CSZ A;  2JMI A;  4LKA A;  3M63 A;  3O34 A;  4S3O C;  4ZDT A;  2F6N A;  2M3H A;  2VPD A;  3KV5 A;  2DX8 A;  4MVT A;  2RSD A;  5I3L A;  4UP0 A;  1F62 A;  2H0D B;  2NAA A;  3LQJ A;  2ECN A;  1WEO A;  2QIC A;  3MHS A;  2HYE D;  1ZBD B;  2YRE A;  3NG2 A;  4MSX A;  4CCG X;  2YUC A;  3RPG B;  1WEQ A;  2MA6 A;  4R8P K;  5G05 B;  2MD8 C;  1X4U A;  5G04 B;  2ECT A;  4YAT A;  3L1Z B;  2FUI A;  4YAX A;  1G25 A;  3U5M A;  2E6S A;  2VPE A;  5C11 A;  5H1U A;  1JM7 B;  2G45 A;  2G43 A;  4YAD A;  2M85 A;  3HCS A;  2F6J A;  4R7E A;  3KV6 A;  5KH9 A;  4Q6F A;  3C6W A;  5H9M A;  4C9Z A;  2MNZ A;  2LV9 A;  2ECW A;  2M1R A;  1T1H A;  2YSJ A;  4V3L C;  4I7B A;  4WZ2 A;  4A0C D;  2FSA A;  4FK5 A;  2LRI C;  1MM3 A;  3SOX A;  4AUQ B;  2ECI A;  4FO9 A;  4UI9 B;  1Z2Q A;  3ZTG A;  5KH7 A;  2BAY A;  4V3K C;  2LGL A;  3GL6 A;  1WGM A;  2YHN A;  3HCU A;  2YUR A;  2YQM A;  2KWO A;  5FB0 A;  3ZYQ A;  2VPG A;  3QZV A;  3KQI A;  1FBV A;  5TAB A;  5AIU A;  2F42 A;  2LXH C;  4N4F A;  3ZVZ B;  1K2F A;  5TRB A;  1U6G B;  3LRQ A;  4BBQ A;  5B75 A;  3O35 A;  2LQ6 A;  2EA6 A;  3SOU A;  1WFK A;  1V87 A;  2LDR A;  5D1M B;  2VJE A;  3L1X A;  4X3G A;  3KNV A;  3U5N A;  1Z6U A;  2YSM A;  3LQH A;  2L43 A;  1HYJ A;  3O37 A;  1WEV A;  2VPB A;  2MIQ A;  3LQI A;  2KYU A;  4FJC A;  4R2Y A;  5H1T A;  2C2V S;  2I50 A;  2MUM A;  2JMJ A;  2VNF A;  4LAD B;  5DIN A;  2HDP A;  2ECJ A;  4W4U A;  2LXP C;  1DVP A;  2QJ0 A;  4AP4 A;  2CSY A;  3O36 A;  1X4J A;  5EYA F;  2L0B A;  5AIT A;  1WEE A;  1WEN A;  4GB0 A;  1X4I A;  2L5U A;  3EB5 A;  4YBS A;  3RPG C;  5FB1 A;  5TBN A;  4PPE A;  1E4U A;  4FIP A;  3L11 A;  4L7X A;  3T7L A;  1CHC A;  4IC3 A;  4QF2 A;  2KR4 A;  2CT2 A;  4O64 A;  3N9N A;  2JMD A;  2KWN A;  2OXQ C;  2KGI A;  3SHB A;  4WA6 A;  2ECV A;  4WZ3 B;  3O7A A;  2LGK A;  4YAB A;  3IHP A;  4A4C A;  5C13 A;  2G6Q A;  2LN0 A;  3N9L A;  1WEM A;  5LKZ A;  3M62 A;  5LCW B;  1WEW A;  2PUY A;  4GNF A;  3ASL A;  3O70 A;  3PUQ A;  2CKL A;  4I7D A;  3I2D A;  5TDW A;  2YW8 A;  3V43 A;  3VK6 A;  4B86 C;  1MM2 A;  1N87 A;  4L58 A;  4PTB A;  3PHD A;  4LLB A;  4WZ0 A;  2EGP A;  2ZET C;  1WE9 A;  4F52 B;  2VJE B;  2YU4 A;  2K4D A;  2M6M A;  2IDA A;  1LDJ B;  4TKP B;  5LKU A;  2L75 A;  2KE1 A;  4YBT A;  2YYR A;  2FUU A;  4GNE A;  2AN6 A;  1WIM A;  2JRJ A;  1RMD A;  5B76 A;  1WES A;  5LKT A;  4AYC B;  2K16 A;  3N9O A;  4S3O B;  1VD4 A;  4N3W A;  1HYI A;  1FP0 A;  4A49 A;  2YHO A;  4LK9 A;  5KH3 A;  2MD7 B;  3MHH A;  3N9Q A;  4CA1 A;  2LGV A;  4GNG A;  2PNX A; 
#chains in the Genus database with same CATH topology
 1XWH A;  5SVY A;  3U5P A;  2K17 A;  3N9M A;  3O47 A;  4ZQL A;  1VYX A;  2RI7 A;  5J3X A;  4AYC A;  2KWJ A;  3M99 A;  3LDY A;  4UP5 A;  4NN2 A;  1Z60 A;  2L80 A;  4O62 A;  1WEU A;  4B7Y C;  2C2L A;  3DQV R;  2UZG A;  2XB1 A;  2Y43 A;  1BOR A;  3C5K A;  3HTK C;  2JM3 A;  2LGG A;  3ZPV E;  2KGG A;  5B78 A;  2Y1M A;  3EB6 A;  4IC2 A;  2EOD A;  1DCQ A;  3HCT A;  5FER A;  2YT5 A;  2YQL A;  3O33 A;  1JOC A;  2KU3 A;  2H0D A;  2FFW A;  5TDR A;  2E6R A;  3SOW A;  4AVX A;  2CKL B;  4XI1 A;  3N9P A;  5G0F A;  2KIZ A;  1VFY A;  5DKA A;  1IYM A;  2K1J A;  2VP7 A;  3GV4 A;  4I7C A;  5H1V A;  3T6R A;  3KDE C;  3DPL R;  2XOY A;  2KRE A;  3FL2 A;  2ECG A;  4P5O B;  4A4B A;  2QIZ A;  1JM7 A;  5D1K B;  4YBM A;  5K3Q A;  4QF3 A;  2E61 A;  2XEU A;  3U5O A;  5FEY A;  5JG6 A;  2KWK A;  2P57 A;  1WIL A;  5B77 A;  3PUR A;  3ZVY A;  2MA5 A;  3FAO A;  2Y1N A;  5B8D A;  5LKX A;  4GND A;  5D1L B;  5B79 A;  2EGM A;  2DSM A;  2KFT A;  4BHW A;  3ZPV 1;  2VJF B;  4Z0R A;  2D8S A;  2MT5 A;  2CON A;  2YVR A;  4LJN A;  1WEP A;  3ZNI A;  3Q1D A;  3FM8 C;  4ZUX U;  2MNY A;  4YC9 A;  3RTR B;  1LDK C;  2VJF A;  2CSZ A;  2JMI A;  4LKA A;  5SVX A;  3M63 A;  3O34 A;  4S3O C;  4ZDT A;  2F6N A;  2XOZ A;  2M3H A;  2VPD A;  2D8U A;  3KV5 A;  2DX8 A;  4MVT A;  2RSD A;  5I3L A;  4UP0 A;  1F62 A;  2H0D B;  2NAA A;  3LQJ A;  2ECN A;  1WEO A;  2QIC A;  3MHS A;  2HYE D;  1ZBD B;  2XP0 A;  2YRE A;  3NG2 A;  4MSX A;  4CCG X;  2YUC A;  3RPG B;  1WEQ A;  2MA6 A;  4R8P K;  3FJU B;  5G05 B;  2MD8 C;  1X4U A;  5G04 B;  2ECT A;  5SVI B;  4YAT A;  3L1Z B;  2FUI A;  4YAX A;  1G25 A;  3U5M A;  2E6S A;  2VPE A;  5C11 A;  5H1U A;  1JM7 B;  2G45 A;  2G43 A;  4YAD A;  2M85 A;  3HCS A;  2F6J A;  4R7E A;  3KV6 A;  5KH9 A;  4Q6F A;  3C6W A;  5H9M A;  4C9Z A;  5SVI A;  2MNZ A;  2LV9 A;  4OGC A;  2ECW A;  2M1R A;  1T1H A;  2YSJ A;  4V3L C;  4I7B A;  4WZ2 A;  4A0C D;  2FSA A;  4FK5 A;  2LRI C;  1MM3 A;  3SOX A;  4AUQ B;  2ECI A;  4FO9 A;  4UI9 B;  3LJU X;  3JUE A;  1Z2Q A;  3ZTG A;  5KH7 A;  2BAY A;  4V3K C;  2LGL A;  3GL6 A;  1WGM A;  2YHN A;  2JUN A;  2KKY A;  2XOC A;  3HCU A;  2CSV A;  2YUR A;  2YQM A;  2KWO A;  2B0O E;  5FB0 A;  3ZYQ A;  2VPG A;  3QZV A;  2LAU A;  3KQI A;  1FBV A;  3FEH A;  5TAB A;  5AIU A;  2F42 A;  2LXH C;  3E2D A;  4N4F A;  3ZVZ B;  1K2F A;  2CRW A;  5TRB A;  1U6G B;  3LRQ A;  4BBQ A;  5B75 A;  3O35 A;  2LQ6 A;  2EA6 A;  1WFK A;  3SOU A;  4H9D A;  1V87 A;  2LDR A;  5D1M B;  2VJE A;  3L1X A;  4X3G A;  2OWA A;  3KNV A;  3U5N A;  1Z6U A;  2MKE A;  2YSM A;  3LQH A;  2L43 A;  1HYJ A;  2L7P A;  3O37 A;  1WEV A;  2VPB A;  2MIQ A;  3LQI A;  4Z0O A;  2CRR A;  3DWD A;  2KYU A;  4FJC A;  3PLW A;  4R2Y A;  5H1T A;  2C2V S;  2I50 A;  2MUM A;  2JMJ A;  3SUB A;  2VNF A;  4LAD B;  5DIN A;  2HDP A;  2ECJ A;  4W4U A;  2FD4 A;  3DDT A;  2LXP C;  1DVP A;  2QJ0 A;  4OGE A;  4AP4 A;  2CSY A;  3O36 A;  1X4J A;  5EYA F;  2L0B A;  3LVQ E;  5AIT A;  1WEE A;  1WEN A;  4GB0 A;  1X4I A;  2L5U A;  3EB5 A;  4YBS A;  3RPG C;  3H7H A;  5FB1 A;  1MBM A;  5TBN A;  4PPE A;  1E4U A;  2EXU A;  4FIP A;  3L11 A;  4L7X A;  3T7L A;  1CHC A;  4IC3 A;  4QF2 A;  2KR4 A;  3FAN A;  2CT2 A;  4O64 A;  3N9N A;  2JMD A;  4QQ4 A;  2KKX A;  2IQJ A;  2KWN A;  2OXQ C;  2KGI A;  4F1P A;  3SHB A;  4WA6 A;  2ECV A;  4WZ3 B;  3O7A A;  2LGK A;  4YAB A;  3IHP A;  4A4C A;  5C13 A;  2G6Q A;  3M7K A;  2LN0 A;  3N9L A;  1WEM A;  2DJA A;  5LKZ A;  3M62 A;  5LCW B;  1WEW A;  2PUY A;  4GNF A;  3ASL A;  3O70 A;  3LVR E;  3PUQ A;  2CKL A;  4I7D A;  3I2D A;  5TDW A;  2YW8 A;  3V43 A;  3VK6 A;  4B86 C;  3T9K A;  1MM2 A;  1N87 A;  4L58 A;  4PTB A;  3PHD A;  4LLB A;  4WZ0 A;  2EGP A;  2M13 A;  2ZET C;  1WE9 A;  4F52 B;  2VJE B;  2YU4 A;  2K4D A;  2M6M A;  2IDA A;  1LDJ B;  4TKP B;  5LKU A;  2L75 A;  2KE1 A;  4YBT A;  2YYR A;  2FUU A;  4GNE A;  2AN6 A;  1WIM A;  2JRJ A;  1RMD A;  5B76 A;  1WES A;  5LKT A;  4AYC B;  3MDB C;  2K16 A;  3N9O A;  4S3O B;  1VD4 A;  4N3W A;  1HYI A;  1FP0 A;  4A49 A;  2YHO A;  2RR4 A;  4LK9 A;  5KH3 A;  2MD7 B;  3MHH A;  3N9Q A;  4CA1 A;  2LGV A;  4GNG A;  2PNX A; 
#chains in the Genus database with same CATH homology
 1XWH A;  3U5P A;  2K17 A;  3N9M A;  4ZQL A;  1VYX A;  2RI7 A;  5J3X A;  4AYC A;  2KWJ A;  3M99 A;  4UP5 A;  4NN2 A;  1Z60 A;  2L80 A;  1WEU A;  4B7Y C;  2C2L A;  3DQV R;  2UZG A;  2XB1 A;  2Y43 A;  1BOR A;  3C5K A;  3HTK C;  2LGG A;  3ZPV E;  2KGG A;  5B78 A;  2Y1M A;  3EB6 A;  4IC2 A;  2EOD A;  3HCT A;  5FER A;  2YT5 A;  2YQL A;  3O33 A;  1JOC A;  2KU3 A;  2H0D A;  5TDR A;  2E6R A;  3SOW A;  4AVX A;  2CKL B;  4XI1 A;  3N9P A;  5G0F A;  2KIZ A;  1VFY A;  5DKA A;  1IYM A;  2K1J A;  2VP7 A;  3GV4 A;  4I7C A;  5H1V A;  3T6R A;  3DPL R;  2KRE A;  3FL2 A;  2ECG A;  4P5O B;  4A4B A;  2QIZ A;  1JM7 A;  5D1K B;  4YBM A;  4QF3 A;  2XEU A;  3U5O A;  5FEY A;  5JG6 A;  2KWK A;  1WIL A;  5B77 A;  3PUR A;  3ZVY A;  2MA5 A;  2Y1N A;  5B8D A;  5LKX A;  4GND A;  5D1L B;  5B79 A;  2KFT A;  4BHW A;  3ZPV 1;  2VJF B;  2D8S A;  2MT5 A;  4LJN A;  1WEP A;  3ZNI A;  4ZUX U;  2MNY A;  4YC9 A;  3RTR B;  1LDK C;  2VJF A;  2CSZ A;  2JMI A;  4LKA A;  3M63 A;  3O34 A;  4S3O C;  4ZDT A;  2F6N A;  2M3H A;  2VPD A;  3KV5 A;  2DX8 A;  4MVT A;  2RSD A;  5I3L A;  4UP0 A;  1F62 A;  2H0D B;  2NAA A;  3LQJ A;  2ECN A;  1WEO A;  2QIC A;  3MHS A;  2HYE D;  1ZBD B;  2YRE A;  3NG2 A;  4MSX A;  4CCG X;  2YUC A;  3RPG B;  1WEQ A;  2MA6 A;  4R8P K;  5G05 B;  2MD8 C;  1X4U A;  5G04 B;  2ECT A;  4YAT A;  3L1Z B;  2FUI A;  4YAX A;  1G25 A;  3U5M A;  2E6S A;  2VPE A;  5C11 A;  5H1U A;  1JM7 B;  2G45 A;  2G43 A;  4YAD A;  2M85 A;  3HCS A;  2F6J A;  4R7E A;  3KV6 A;  5KH9 A;  4Q6F A;  3C6W A;  5H9M A;  4C9Z A;  2MNZ A;  2LV9 A;  2ECW A;  2M1R A;  1T1H A;  2YSJ A;  4V3L C;  4I7B A;  4WZ2 A;  4A0C D;  2FSA A;  4FK5 A;  2LRI C;  1MM3 A;  3SOX A;  4AUQ B;  2ECI A;  4FO9 A;  4UI9 B;  1Z2Q A;  3ZTG A;  5KH7 A;  2BAY A;  4V3K C;  2LGL A;  3GL6 A;  1WGM A;  2YHN A;  3HCU A;  2YUR A;  2YQM A;  2KWO A;  5FB0 A;  3ZYQ A;  2VPG A;  3QZV A;  3KQI A;  1FBV A;  5TAB A;  5AIU A;  2F42 A;  2LXH C;  4N4F A;  3ZVZ B;  1K2F A;  5TRB A;  1U6G B;  3LRQ A;  4BBQ A;  5B75 A;  3O35 A;  2LQ6 A;  2EA6 A;  3SOU A;  1WFK A;  1V87 A;  2LDR A;  5D1M B;  2VJE A;  3L1X A;  4X3G A;  3KNV A;  3U5N A;  1Z6U A;  2YSM A;  3LQH A;  2L43 A;  1HYJ A;  3O37 A;  1WEV A;  2VPB A;  2MIQ A;  3LQI A;  2KYU A;  4FJC A;  4R2Y A;  5H1T A;  2C2V S;  2I50 A;  2MUM A;  2JMJ A;  2VNF A;  4LAD B;  5DIN A;  2HDP A;  2ECJ A;  4W4U A;  2LXP C;  1DVP A;  2QJ0 A;  4AP4 A;  2CSY A;  3O36 A;  1X4J A;  5EYA F;  2L0B A;  5AIT A;  1WEE A;  1WEN A;  4GB0 A;  1X4I A;  2L5U A;  3EB5 A;  4YBS A;  3RPG C;  5FB1 A;  5TBN A;  4PPE A;  1E4U A;  4FIP A;  3L11 A;  4L7X A;  3T7L A;  1CHC A;  4IC3 A;  4QF2 A;  2KR4 A;  2CT2 A;  4O64 A;  3N9N A;  2JMD A;  2KWN A;  2OXQ C;  2KGI A;  3SHB A;  4WA6 A;  2ECV A;  4WZ3 B;  3O7A A;  2LGK A;  4YAB A;  3IHP A;  4A4C A;  5C13 A;  2G6Q A;  2LN0 A;  3N9L A;  1WEM A;  5LKZ A;  3M62 A;  5LCW B;  1WEW A;  2PUY A;  4GNF A;  3ASL A;  3O70 A;  3PUQ A;  2CKL A;  4I7D A;  3I2D A;  5TDW A;  2YW8 A;  3V43 A;  3VK6 A;  4B86 C;  1MM2 A;  1N87 A;  4L58 A;  4PTB A;  3PHD A;  4LLB A;  4WZ0 A;  2EGP A;  2ZET C;  1WE9 A;  4F52 B;  2VJE B;  2YU4 A;  2K4D A;  2M6M A;  2IDA A;  1LDJ B;  4TKP B;  5LKU A;  2L75 A;  2KE1 A;  4YBT A;  2YYR A;  2FUU A;  4GNE A;  2AN6 A;  1WIM A;  2JRJ A;  1RMD A;  5B76 A;  1WES A;  5LKT A;  4AYC B;  2K16 A;  3N9O A;  4S3O B;  1VD4 A;  4N3W A;  1HYI A;  1FP0 A;  4A49 A;  2YHO A;  4LK9 A;  5KH3 A;  2MD7 B;  3MHH A;  3N9Q A;  4CA1 A;  2LGV A;  4GNG A;  2PNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...