5H1TA

Complex structure of trim24 phd-bromodomain and inhibitor 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1tA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1tA01
4X2IA 5IIDA 1Z6UA 5CQ8A 5FFYA 3LQHA 3N9MA 5B79A 2JMIA 5I86A 5CU8A 1WE9A 5ETDA 4ALHA 4LRGA 1WESA 2OSSA 4O7AA 4O7FA 4QEUA 4Z1SA 3SVHA 3ONIA 4Q6FA 3T6RA 4QNSA 5TRBA 1E4UA 5DX4A 3DPLR 4Q0NA 5C13A 4N4GA 5EWWA 2KREA 1F68A 5JG6A 5FG5A 4YABA 3ZYQA 4HXOA 2YQLA 4YBTA 2YU4A 5G4RA 4TT2A 5CRMA 2H0DA 2M1RA 4MR3A 5EPSA 2M3HA 3UVWA 4ALGA 5J3XA 2NAAA 2RO1A 3RTRB 3HCSA 4LZSA 5FE1A 3L11A 4AVXA 4HXRA 4QSSA 5AMEA 5DKCA 2LN0A 2MUMA 4UIVA 3FKMX 5G05B 5LCWB 1Z2QA 5AITA 3O7AA 4GNGA 4O77A 5A82A 4UIXA 4YATA 2YSJA 4LLBA 4V3LC 5E7DA 4R2YA 1LDJB 4XY9A 5IGLA 4HBWA 4MVTA 5FE9A 3U5MA 5K29A 3RPGB 2DWWA 4YYMA 4L58A 4P5OB 5B76A 4FLPA 4QSWA 5FE2A 4CURA 1FP0A 3P1EA 4FK5A 5C89A 4UIUA 5B78A 4NUDA 5E9LA 5FE7A 4YYKA 2LV9A 5HQ7A 2YEMA 4WZ3B 2PNXA 4HXSA 4TYLA 5DY7A 3JVMA 2LGGA 2ECJA 3C6WA 5C11A 3K2JA 5JI8A 3PURA 5CQ3A 4BHWA 1FBVA 3KV5A 2I8NA 3MB3A 5COIA 2KGGA 3L1ZB 3UVXA 2G45A 4O76A 4QB3A 3ZVZB 4PKLA 5I89A 5D25A 5DKAA 4YYGA 2MD7B 3P5OA 4N4FA 4A4BA 4GNEA 4XYAA 4N3WA 4O74A 3UVYA 4UYGA 5TCMA 5G4SA 5FFWA 3AADA 4NXJA 4QY4A 2G4AA 5EVAA 5F36A 5FH8A 5HRXA 5BT4A 2FSAA 4AYCB 2LGKA 5ENFA 5CUBA 4ZC9A 2YQDA 3N9PA 3MB4A 5AD2A 4ZUXU 5AD3A 2WP2A 4QYLA 3UVDA 4IC2A 3ASLA 2L43A 5EM3A 5FE3A 5L96A 5FH7A 5FEYA 4LKAA 5D1KB 5ACYA 4UYFA 2KGIA 4O72A 5F2PA 5HENA 4A9HA 5LJ2A 4QF3A 3ZVYA 4PPEA 2C2LA 3O70A 4GNDA 5EK9A 2Y43A 4XUBA 5D7XA 4MENA 4HXNA 4BJXA 5B77A 2G43A 5D3HA 4CUPA 5I1QA 2MNZA 4J3IA 3SHBA 5CQAA 4BW1A 4O7EA 2MD8C 4QBMA 3RCWA 4QSUA 3MHHA 3U5KA 5TB6A 2VPBA 4Z1QA 3PUQA 4QSXA 4C66A 2VPEA 2K16A 2CSYA 5ENGA 3U5LA 1JOCA 2FUUA 5CUCA 2L5EA 4Y03A 4IR6A 4QUTA 5EI4A 4CFKA 4YAXA 2YYRA 5DW2A 5CRZA 5II1A 1WEPA 4DONA 2CSZA 3NG2A 4CUTA 5CTLA 5KH9A 2LSPB 2LRIC 2N9GA 2LGVA 5KH7A 3I3JA 4NQNA 4E96A 3Q2EA 5A83A 1Z60A 3T7LA 5E0RA 1WEOA 4PS5A 5I3LA 5H1VA 5FB1A 1T1HA 3N9QA 3KNVA 2ZETC 4LZRA 3NXBA 4FIPA 5DYUA 4NQMA 4C67A 4TT6A 4IR4A 2I50A 4A9EA 3DAIA 5HCLA 2H60A 2R0YA 3HTKC 4A0CD 5D0CA 5C87A 5KO4A 4NRCA 4UIYA 1JM7B 2R0VA 4A9KA 4UITA 4KCXA 3ZPV1 3UW9A 4QUUA 4Z6HA 2K17A 4TZ8A 4J0RA 2R0SA 3P1DA 5I88A 2YUCA 5L99A 1JSPB 2I7KA 5LKUA 4XY8A 2ECGA 1F62A 5KTUA 2DKWA 1JM4B 4HBXA 4NR4A 5CQ5A 2KE1A 1HYJA 5CFWA 2KYUA 4QSRA 5A5QA 5CS8A 3EB5A 4F3IA 5BT5A 5E9IA 2VPGA 1X0JA 5EWVA 4ZQLA 1MM3A 2CKLB 4AUQB 5I40A 2DVRA 2JRJA 3JVJA 4IR5A 5FDZA 3S91A 3GV4A 4NR7A 5DKDA 2MA6A 1G25A 4FO9A 2L84A 4HXPA 4YH4A 4CUSA 5LJ1A 2MJVB 1WEWA 2PUYA 4LK9A 2RS9B 3N9NA 4TQNA 5D3TA 3SOXA 3C5KA 5D3RA 5CQ6A 2C2VS 4V3KC 2YW5A 4ZDTA 5TDRA 5II2A 4LC2A 5A5NA 1WILA 4MR5A 4LJNA 5TBNA 1CHCA 2YQMA 2YURA 5L98A 5A5OA 4NR8A 3HMHA 5E9MA 5IBNA 2EA6A 2D8SA 5KH3A 5EPRA 5FE4A 4A9IA 5G0FA 5CZGA 3QZTA 2ECIA 2KFTA 2D82A 4O70A 2NXBA 3JVLA 4UI9B 4NRBA 2E6RA 3M99A 2QICA 4A9OA 4WHWA 4XI1A 4GPJA 2XEUA 4N4HA 3DWYA 4AYCA 5DKHA 4YH3A 4OUFA 5EQ1A 4NUCA 5FFVA 4KV4A 2MA5A 3U5PA 2VJFB 2F42A 4I7CA 5A5SA 2OXQC 3LQJA 3LQIA 5KTXA 5H9MA 1WIMA 4B86C 2QIZA 5E73A 5E9VA 4TTEA 2OUOA 4IOOA 4I7BA 1RMDA 3LRQA 1K2FA 3MHSA 5F1LA 4OGJA 4LYIA 4QEVA 1WUGA 5LJ0A 3IHPA 3LJWA 3O34A 5F25A 4CFLA 2JMDA 4UYEA 5BT3A 5FE5A 1WFKA 2KWOA 4MEQA 4LYSA 3O36A 5HFQA 4NYXA 4HXLA 5I83A 5ETBA 2E7NA 4YY4A 5D26A 3SVFA 2BAYA 3I2DA 3N9LA 4OGIA 4PTBA 2YELA 5ENEA 5F1HA 5AMFA 1X4JA 1EQFA 4BW2A 2DATA 3P1FA 5C8GA 4TT4A 3MULA 1DVPA 3KV6A 4QZSA 5FG4A 1X4IA 1ZS5A 2KWJA 4YYDA 5AIUA 4O7BA 4CA1A 2GRCA 4O78A 3TLPA 5LVRA 3UV5A 2LXHC 4L7XA 3MQMA 2YDWA 2L5UA 3S92A 5DBMA 5C4QA 4QF2A 4QR5A 1N87A 3SOUA 4UYFB 4NUEA 4WHUA 3SVGA 4BW4A 4R8PK 2YYNA 3U5OA 3PHDA 5D24A 5HM0A 2VP7A 1N72A 2RSDA 4J1PA 4MEPA 5EU1A 4NYWA 2E6SA 5CP5A 2JMJA 4BBQA 5DFBA 2AN6A 4IORA 2R10A 3IU6A 2WP1A 5J0DA 2VJEB 5DLXA 5HRVA 1WEQA 5E74A 5C7NA 4YYJA 2F6JA 4TS8A 2Y1MA 4A4CA 5FG6A 1WENA 3U5JA 5CGPA 5D1LB 5DYCA 2ECVA 4YYIA 3MXFA 2UZGA 4QR3A 5F3AA 5TDWA 4CCGX 3UV2A 5KU3A 4O7CA 4UIWA 5FB0A 4PCIA 2ECTA 4QSVA 2EODA 3ZPVE 4MR4A 5HLSA 5TABA 4LR6A 4BW3A 5I29A 2CKLA 5CQ4A 2ECNA 4A9JA 5IGMA 5H1TA 5L8UA 2L75A 4A49A 4LYWA 1HYIA 5A5RA 4YY6A 5DLZA 5L97A 5KTWA 4NR9A 4HBVA 5B75A 2E7OA 4QSQA 4YK0A 5FE6A 3HCUA 4YADA 2DVVA 5LVQA 4J0SA 2MNYA 4AKNA 4TZ2A 3IU5A 1VD4A 5CPEA 4LADB 5EISA 1E6IA 2YREA 4UYDA 4CLBA 1LDKC 4GB0A 5HQ5A 2LGLA 4O75A 5D3JA 4UIZA 5A7CA 4UYHA 4QC1A 5CQTA 2KTBB 2IDAA 2DVSA 5CUDA 5L8TA 1X4UA 2EGPA 4QEWA 4S3OC 4NR5A 4MSXA 4LDFA 4N4IA 1IYMA 4NYVA 2H0DB 4X3GA 4TKPB 2OO1A 5B8DA 1U6GB 1BORA 5EV9A 3ZYUA 5A5PA 5HFRA 4NN2A 2RI7A 5ENJA 2DVQA 5DINA 5C85A 2YW8A 5FERA 5I7YA 2YHOA 4YYHA 3MUKA 4CL9A 2L85A 4YBMA 4IOQA 5D3PA 5FE8A 2FUIA 5LKZA 4O64A 2RFJA 3GG3A 2K1JA 1MM2A 2E3KA 4XUAA 1WEMA 2MIQA 2VJFA 4W4UA 5F5ZA 5ENCA 4F52B 5I80A 5EP7A 1VYXA 5CY9A 2K4DA 5HELA 4ZW1A 5LKTA 4UP0A 5EWDA 2RNWA 4RVRA 2KR4A 5EICA 5F61A 3ZNIA 2D9EA 5CUGA 4YC9A 4O71A 5I7XA 5IGNA 3QZVA 2LQ6A 5JWMA 5D1MB 3LXJA 4UP5A 4LZ2A 5LUUA 5E3GA 5H85A 4A9LA 2KWNA 2HDPA 4WIVA 5E3DA 4TU6A 4QC3A 4YYNA 2M6MA 5F60A 4WZ2A 1WUMA 4NS5A 4MEOA 4QR4A 3M63A 5CQ7A 3FL2A 3AQAA 4IR3A 4QYDA 3KQIA 5EGUA 5LKXA 3D7CA 3G0LA 5DFCA 4Z6IA 4GNFA 4R7EA 4A9NA 3DQVR 5F62A 3M62A 5D3SA 4A9MA 3QZSA 5DFDA 4MR6A 5EPBA 1VFYA 5E9YA 2LXPC 3SOWA 5HEMA 5CUAA 1V87A 2G6QA 4QSPA 5KHMA 3VK6A 4S3OB 4YBSA 3EB6A 4WZ0A 3HCTA 5EWCA 2XB1A 2HYED 2QJ0A 5FE0A 5E9KA 4AP4A 2KIZA 5EYAF 3O33A 1WGMA 4NR6A 2YHNA 2ECWA 3HMFA 2KU3A 3U5NA 4I7DA 5ENIA 2F6NA 5FH6A 4HBYA 2L80A 4HXKA 5DW1A 5HJCA 1WEVA 5D3LA 2MT5A 2Y1NA 5DYAA 5A81A 5HQ6A 4QSTA 2CT2A 3O37A 3ZTGA 2L0BA 3UV4A 1XWHA 4HXMA 3O35A 3GL6A 2RNYA 3HMEA 2KWKA 5D3NA 3N9OA 4CUUA 2RNXA 5EA1A 5IGKA 3P1CA 5HRWA 5A85A 1ZBDB 2VJEA 3G0JA 5ENHA 2VPDA 3V43A 4TU4A 1WEUA 5DYXA 2M85A 2YT5A 1JM7A 5IG6A 5ENBA 4CUQA 4IC3A 2LDRA 5F63A 2DX8A 4WA6A 3Q2FA 4PCEA 5H1UA 4B7YC 4PY6A 4C9ZA 3JVKA 4FJCA 4KV1A 1WEEA 4Z93A 4A9FA 3L1XA 5G04B 2YEKA 2YSMA 3RPGC 2VNFA 4Q0OA 4NRAA 5FBXA 5EWHA 5CUEA
chains in the Genus database with same CATH superfamily
4X2IA 5IIDA 1Z6UA 5CQ8A 5FFYA 3ERRA 3LQHA 3N9MA 5B79A 2JMIA 4AKGA 5I86A 5CU8A 1WE9A 5ETDA 4ALHA 4LRGA 1WESA 2OSSA 4O7AA 4O7FA 4QEUA 4Z1SA 3SVHA 3ONIA 4Q6FA 3T6RA 4QNSA 5TRBA 1E4UA 5DX4A 3DPLR 4Q0NA 5C13A 4N4GA 5EWWA 2KREA 1F68A 3H7HA 5JG6A 5FG5A 4YABA 5SVIB 3ZYQA 4HXOA 2YQLA 4YBTA 2YU4A 5G4RA 4TT2A 5CRMA 2H0DA 3FANA 2M1RA 4MR3A 5EPSA 2M3HA 3UVWA 4ALGA 5J3XA 2NAAA 2RO1A 3RTRB 3HCSA 4LZSA 5FE1A 2E61A 3L11A 4AVXA 4HXRA 4QSSA 5AMEA 5DKCA 2LN0A 2MUMA 2CRRA 4UIVA 3FKMX 5G05B 5LCWB 1Z2QA 5AITA 3O7AA 4GNGA 4O77A 5A82A 3O47A 4UIXA 4YATA 2YSJA 4LLBA 4V3LC 5E7DA 4R2YA 3E2DA 1LDJB 4XY9A 5IGLA 2DJAA 4HBWA 2JUNA 4MVTA 5FE9A 3U5MA 5K29A 3RPGB 2DWWA 4YYMA 4L58A 4P5OB 5B76A 2XOCA 4FLPA 2YVRA 4QSWA 5FE2A 4CURA 1FP0A 3P1EA 4FK5A 5C89A 4UIUA 5B78A 4NUDA 5E9LA 5FE7A 4YYKA 2LV9A 3FAOA 5HQ7A 2YEMA 4WZ3B 2PNXA 4HXSA 4TYLA 5DY7A 3JVMA 2LGGA 2CSVA 2ECJA 3C6WA 3VKGA 5C11A 3K2JA 5JI8A 3PURA 5CQ3A 4BHWA 1FBVA 3KV5A 2I8NA 3MB3A 5COIA 2KGGA 3L1ZB 2OWAA 3UVXA 2G45A 4O76A 4QB3A 3ZVZB 4PKLA 5I89A 2EJNA 5D25A 5DKAA 4YYGA 2MD7B 3P5OA 4N4FA 3JUEA 4GNEA 4A4BA 4XYAA 4N3WA 4O74A 3UVYA 4UYGA 5TCMA 5G4SA 5FFWA 3AADA 4NXJA 4QY4A 2G4AA 5EVAA 5F36A 5FH8A 5HRXA 5BT4A 2FSAA 4AYCB 2LGKA 5ENFA 5CUBA 4ZC9A 2YQDA 3LJUX 3N9PA 1PUOA 3MB4A 5AD2A 5AD3A 2WP2A 4QYLA 3UVDA 4IC2A 4ZUXU 3ASLA 2L43A 5EM3A 5FE3A 5L96A 5FH7A 2MKEA 5FEYA 4LKAA 5D1KB 5ACYA 4UYFA 2KGIA 4O72A 5F2PA 5HENA 4A9HA 5LJ2A 4QF3A 3ZVYA 4PPEA 2C2LA 3O70A 4GNDA 5EK9A 2Y43A 4XUBA 5D7XA 4MENA 4HXNA 4BJXA 5B77A 2G43A 5D3HA 4CUPA 5I1QA 2MNZA 4J3IA 3SHBA 5CQAA 4BW1A 4O7EA 2MD8C 4QBMA 3RCWA 4QSUA 3MHHA 3U5KA 5TB6A 2VPBA 4Z1QA 3PUQA 4QSXA 4C66A 2D8UA 2VPEA 3FEHA 2K16A 2CSYA 1DCQA 5ENGA 3U5LA 1JOCA 2FUUA 5CUCA 2L5EA 4Y03A 4IR6A 4QUTA 5EI4A 4CFKA 4YAXA 2YYRA 5DW2A 5CRZA 5II1A 1WEPA 4DONA 2CSZA 3NG2A 4CUTA 5CTLA 5KH9A 2LSPB 2LRIC 2N9GA 2LGVA 5KH7A 3I3JA 4NQNA 4E96A 3VKHA 3Q2EA 5A83A 1Z60A 3T7LA 2KKYA 5E0RA 1WEOA 4PS5A 5I3LA 5H1VA 5FB1A 1T1HA 3N9QA 3KNVA 2ZETC 4LZRA 3NXBA 3SUBA 4FIPA 3LVQE 5DYUA 3DDTA 4NQMA 4C67A 4TT6A 4IR4A 2I50A 4A9EA 3DAIA 5HCLA 2H60A 2R0YA 3HTKC 4A0CD 5D0CA 5C87A 5KO4A 4NRCA 4UIYA 1JM7B 2R0VA 4A9KA 4UITA 4KCXA 3ZPV1 3UW9A 4QUUA 4Z6HA 2K17A 4TZ8A 4J0RA 2R0SA 3P1DA 5I88A 2YUCA 5L99A 2CONA 1JSPB 2I7KA 5LKUA 3MDBC 4XY8A 2ECGA 1F62A 5KTUA 2DKWA 1JM4B 4HBXA 4NR4A 5CQ5A 2KE1A 1HYJA 5CFWA 2KYUA 4QSRA 5A5QA 5CS8A 3EB5A 4F3IA 5BT5A 5E9IA 2VPGA 1X0JA 5EWVA 2B0OE 4ZQLA 1MM3A 2CKLB 4AUQB 5I40A 2DVRA 2JRJA 3JVJA 4IR5A 5FDZA 1ZKRA 3S91A 3GV4A 3M7KA 4NR7A 5DKDA 2MA6A 1G25A 4FO9A 2L84A 4Z0RA 4HXPA 4YH4A 4CUSA 5LJ1A 2MJVB 1WEWA 2PUYA 4LK9A 2RS9B 3N9NA 4TQNA 5D3TA 3DWDA 3SOXA 3C5KA 5D3RA 5CQ6A 2C2VS 4V3KC 2YW5A 4ZDTA 5TDRA 5II2A 4LC2A 5A5NA 1WILA 4MR5A 4LJNA 5TBNA 1CHCA 2YQMA 2YURA 5L98A 5A5OA 4NR8A 2XOYA 3HMHA 5E9MA 5IBNA 2EA6A 2D8SA 5KH3A 5EPRA 5FE4A 2XP0A 2RR4A 4A9IA 5G0FA 5CZGA 3QZTA 4H9DA 2ECIA 2KFTA 2D82A 4O70A 2NXBA 3JVLA 4UI9B 4NRBA 2E6RA 3M99A 2QICA 4A9OA 4WHWA 4XI1A 4GPJA 2XEUA 4N4HA 3DWYA 4AYCA 5DKHA 4YH3A 4OUFA 2JM3A 5EQ1A 4NUCA 3FM8C 5FFVA 4KV4A 2MA5A 3U5PA 2VJFB 2F42A 3FJUB 4I7CA 3KDEC 5A5SA 2OXQC 3LQJA 3LQIA 5KTXA 5H9MA 1WIMA 4B86C 2QIZA 5E73A 5E9VA 4TTEA 2OUOA 2M13A 4IOOA 4I7BA 1RMDA 3LRQA 1K2FA 3MHSA 5F1LA 4OGJA 4LYIA 4QEVA 1WUGA 5LJ0A 3IHPA 3LJWA 3O34A 5F25A 4CFLA 3T9KA 2JMDA 4UYEA 5BT3A 5FE5A 1WFKA 2KWOA 4MEQA 4LYSA 3O36A 5HFQA 4NYXA 4HXLA 5I83A 5ETBA 2E7NA 4YY4A 5D26A 3SVFA 2BAYA 3I2DA 3N9LA 4OGIA 4PTBA 2YELA 5ENEA 5F1HA 5AMFA 1X4JA 2KKXA 1EQFA 4BW2A 2DATA 3P1FA 5C8GA 4TT4A 4Z0OA 3MULA 1DVPA 3KV6A 4QZSA 5FG4A 1X4IA 1ZS5A 2KWJA 4YYDA 5AIUA 4O7BA 4AI6A 2GRCA 4CA1A 4O78A 3TLPA 5LVRA 3UV5A 2LXHC 4L7XA 3MQMA 2YDWA 2L5UA 3S92A 5DBMA 5C4QA 4QF2A 4QR5A 1N87A 3SOUA 5SVYA 4UYFB 4NUEA 4WHUA 3SVGA 4BW4A 4R8PK 2YYNA 3U5OA 3PHDA 5D24A 5HM0A 2VP7A 2EXUA 1N72A 2RSDA 4J1PA 4MEPA 5EU1A 4NYWA 2E6SA 5CP5A 2JMJA 4BBQA 5DFBA 2AN6A 4IORA 2R10A 3IU6A 2WP1A 5J0DA 2VJEB 5DLXA 5HRVA 1WEQA 5E74A 5C7NA 4YYJA 2F6JA 4TS8A 2Y1MA 4A4CA 5SVIA 5FG6A 1WENA 3U5JA 5CGPA 5D1LB 5DYCA 2ECVA 4YYIA 3MXFA 2UZGA 4QR3A 5F3AA 5TDWA 4CCGX 3UV2A 5KU3A 4O7CA 4UIWA 5FB0A 4PCIA 2ECTA 4QSVA 2EODA 2L7PA 3ZPVE 4MR4A 5HLSA 5TABA 4LR6A 3PLWA 4BW3A 5I29A 2CKLA 5CQ4A 2ECNA 4A9JA 5IGMA 5H1TA 5L8UA 2L75A 5SVXA 4A49A 4LYWA 1HYIA 5A5RA 4YY6A 5DLZA 5L97A 5KTWA 4NR9A 3D1BA 4HBVA 5B75A 2E7OA 4QSQA 4YK0A 5FE6A 3HCUA 4YADA 2DVVA 5LVQA 4J0SA 2MNYA 4AKNA 4TZ2A 3IU5A 1VD4A 5CPEA 4LADB 2LAUA 5EISA 1E6IA 2YREA 4UYDA 4CLBA 1LDKC 4GB0A 5HQ5A 2LGLA 4O75A 5D3JA 4UIZA 5A7CA 4UYHA 4QC1A 5CQTA 4OGEA 2KTBB 2IDAA 2DVSA 5CUDA 5L8TA 1X4UA 2EGPA 4QEWA 3LVRE 4S3OC 4NR5A 4MSXA 4OGCA 4LDFA 4N4IA 1IYMA 4NYVA 2H0DB 4X3GA 4TKPB 2OO1A 5B8DA 1U6GB 1BORA 2CRWA 5EV9A 3ZYUA 5A5PA 5HFRA 3D1DA 4NN2A 2RI7A 5ENJA 2DVQA 5DINA 5C85A 2YW8A 5FERA 4AKHA 5I7YA 2YHOA 4YYHA 3MUKA 2DSMA 4CL9A 2L85A 4YBMA 4IOQA 5D3PA 5FE8A 2FUIA 5LKZA 4O64A 2RFJA 3GG3A 2K1JA 1MM2A 2E3KA 4XUAA 1WEMA 2MIQA 2VJFA 4W4UA 5F5ZA 5ENCA 4F52B 5I80A 5EP7A 1VYXA 5CY9A 2K4DA 5HELA 4ZW1A 5LKTA 4UP0A 5EWDA 2RNWA 4RVRA 2KR4A 5EICA 5F61A 3ZNIA 2D9EA 5CUGA 4YC9A 4O71A 5I7XA 5IGNA 2FFWA 3QZVA 2IQJA 2LQ6A 5JWMA 5D1MB 3LXJA 4UP5A 4AKIA 4LZ2A 5LUUA 5E3GA 5H85A 4A9LA 2KWNA 2HDPA 4F1PA 4WIVA 5E3DA 4TU6A 4QC3A 1MBMA 4YYNA 2M6MA 5F60A 4WZ2A 1WUMA 4NS5A 4MEOA 4QR4A 3M63A 5CQ7A 3FL2A 3AQAA 4IR3A 4QYDA 3KQIA 5EGUA 5LKXA 3D7CA 3G0LA 5DFCA 4Z6IA 4GNFA 4R7EA 4A9NA 3DQVR 5F62A 3M62A 5D3SA 4QQ4A 4A9MA 3QZSA 5DFDA 4MR6A 5EPBA 1VFYA 5E9YA 2LXPC 2P57A 3SOWA 5HEMA 5CUAA 1V87A 2G6QA 4QSPA 5KHMA 3VK6A 4S3OB 4YBSA 3EB6A 4WZ0A 3HCTA 5EWCA 2XB1A 2HYED 2QJ0A 5FE0A 5E9KA 4AP4A 2KIZA 5EYAF 2XOZA 3O33A 1WGMA 2FD4A 4NR6A 4O62A 2YHNA 2ECWA 3HMFA 2KU3A 3U5NA 4I7DA 5ENIA 2F6NA 5FH6A 4HBYA 2L80A 4HXKA 5DW1A 5HJCA 1WEVA 5D3LA 2MT5A 2Y1NA 5DYAA 5A81A 5HQ6A 4QSTA 2CT2A 3O37A 3ZTGA 2L0BA 3UV4A 1XWHA 4HXMA 3O35A 3GL6A 2RNYA 3HMEA 2KWKA 5D3NA 3N9OA 4CUUA 3Q1DA 2RNXA 5EA1A 5IGKA 3P1CA 5HRWA 5A85A 1ZBDB 2VJEA 3G0JA 5ENHA 2VPDA 3V43A 4TU4A 1WEUA 5DYXA 3LDYA 2M85A 2YT5A 1JM7A 5IG6A 5ENBA 2EGMA 4CUQA 4IC3A 2LDRA 5F63A 2DX8A 4WA6A 3Q2FA 4PCEA 5H1UA 5K3QA 4B7YC 4PY6A 4C9ZA 3JVKA 4FJCA 4KV1A 1WEEA 4Z93A 4A9FA 3L1XA 5G04B 2YEKA 2YSMA 3RPGC 2VNFA 4Q0OA 4NRAA 5FBXA 5EWHA 5CUEA
chains in the Genus database with same CATH topology
4X2IA 5IIDA 1Z6UA 5CQ8A 5FFYA 3LQHA 3N9MA 5B79A 2JMIA 5I86A 5CU8A 1WE9A 5ETDA 4ALHA 4LRGA 1WESA 2OSSA 4O7AA 4O7FA 4QEUA 4Z1SA 3SVHA 3ONIA 4Q6FA 3T6RA 4QNSA 5TRBA 1E4UA 5DX4A 3DPLR 4Q0NA 5C13A 4N4GA 5EWWA 2KREA 1F68A 5JG6A 5FG5A 4YABA 3ZYQA 4HXOA 2YQLA 4YBTA 2YU4A 5G4RA 4TT2A 5CRMA 2H0DA 2M1RA 4MR3A 5EPSA 2M3HA 3UVWA 4ALGA 5J3XA 2NAAA 2RO1A 3RTRB 3HCSA 4LZSA 5FE1A 3L11A 4AVXA 4HXRA 4QSSA 5AMEA 5DKCA 2LN0A 2MUMA 4UIVA 3FKMX 5G05B 5LCWB 1Z2QA 5AITA 3O7AA 4GNGA 4O77A 5A82A 4UIXA 4YATA 2YSJA 4LLBA 4V3LC 5E7DA 4R2YA 1LDJB 4XY9A 5IGLA 4HBWA 4MVTA 5FE9A 3U5MA 5K29A 3RPGB 2DWWA 4YYMA 4L58A 4P5OB 5B76A 4FLPA 4QSWA 5FE2A 4CURA 1FP0A 3P1EA 4FK5A 5C89A 4UIUA 5B78A 4NUDA 5E9LA 5FE7A 4YYKA 2LV9A 5HQ7A 2YEMA 4WZ3B 2PNXA 4HXSA 4TYLA 5DY7A 3JVMA 2LGGA 2ECJA 3C6WA 5C11A 3K2JA 5JI8A 3PURA 5CQ3A 4BHWA 1FBVA 3KV5A 2I8NA 3MB3A 5COIA 2KGGA 3L1ZB 3UVXA 2G45A 4O76A 4QB3A 3ZVZB 4PKLA 5I89A 5D25A 5DKAA 4YYGA 2MD7B 3P5OA 4N4FA 4A4BA 4GNEA 4XYAA 4N3WA 4O74A 3UVYA 4UYGA 5TCMA 5G4SA 5FFWA 3AADA 4NXJA 4QY4A 2G4AA 5EVAA 5F36A 5FH8A 5HRXA 5BT4A 2FSAA 4AYCB 2LGKA 5ENFA 5CUBA 4ZC9A 2YQDA 3N9PA 3MB4A 5AD2A 4ZUXU 5AD3A 2WP2A 4QYLA 3UVDA 4IC2A 3ASLA 2L43A 5EM3A 5FE3A 5L96A 5FH7A 5FEYA 4LKAA 5D1KB 5ACYA 4UYFA 2KGIA 4O72A 5F2PA 5HENA 4A9HA 5LJ2A 4QF3A 3ZVYA 4PPEA 2C2LA 3O70A 4GNDA 5EK9A 2Y43A 4XUBA 5D7XA 4MENA 4HXNA 4BJXA 5B77A 2G43A 5D3HA 4CUPA 5I1QA 2MNZA 4J3IA 3SHBA 5CQAA 4BW1A 4O7EA 2MD8C 4QBMA 3RCWA 4QSUA 3MHHA 3U5KA 5TB6A 2VPBA 4Z1QA 3PUQA 4QSXA 4C66A 2VPEA 2K16A 2CSYA 5ENGA 3U5LA 1JOCA 2FUUA 5CUCA 2L5EA 4Y03A 4IR6A 4QUTA 5EI4A 4CFKA 4YAXA 2YYRA 5DW2A 5CRZA 5II1A 1WEPA 4DONA 2CSZA 3NG2A 4CUTA 5CTLA 5KH9A 2LSPB 2LRIC 2N9GA 2LGVA 5KH7A 3I3JA 4NQNA 4E96A 3Q2EA 5A83A 1Z60A 3T7LA 5E0RA 1WEOA 4PS5A 5I3LA 5H1VA 5FB1A 1T1HA 3N9QA 3KNVA 2ZETC 4LZRA 3NXBA 4FIPA 5DYUA 4NQMA 4C67A 4TT6A 4IR4A 2I50A 4A9EA 3DAIA 5HCLA 2H60A 2R0YA 3HTKC 4A0CD 5D0CA 5C87A 5KO4A 4NRCA 4UIYA 1JM7B 2R0VA 4A9KA 4UITA 4KCXA 3ZPV1 3UW9A 4QUUA 4Z6HA 2K17A 4TZ8A 4J0RA 2R0SA 3P1DA 5I88A 2YUCA 5L99A 1JSPB 2I7KA 5LKUA 4XY8A 2ECGA 1F62A 5KTUA 2DKWA 1JM4B 4HBXA 4NR4A 5CQ5A 2KE1A 1HYJA 5CFWA 2KYUA 4QSRA 5A5QA 5CS8A 3EB5A 4F3IA 5BT5A 5E9IA 2VPGA 1X0JA 5EWVA 4ZQLA 1MM3A 2CKLB 4AUQB 5I40A 2DVRA 2JRJA 3JVJA 4IR5A 5FDZA 3S91A 3GV4A 4NR7A 5DKDA 2MA6A 1G25A 4FO9A 2L84A 4HXPA 4YH4A 4CUSA 5LJ1A 2MJVB 1WEWA 2PUYA 4LK9A 2RS9B 3N9NA 4TQNA 5D3TA 3SOXA 3C5KA 5D3RA 5CQ6A 2C2VS 4V3KC 2YW5A 4ZDTA 5TDRA 5II2A 4LC2A 5A5NA 1WILA 4MR5A 4LJNA 5TBNA 1CHCA 2YQMA 2YURA 5L98A 5A5OA 4NR8A 3HMHA 5E9MA 5IBNA 2EA6A 2D8SA 5KH3A 5EPRA 5FE4A 4A9IA 5G0FA 5CZGA 3QZTA 2ECIA 2KFTA 2D82A 4O70A 2NXBA 3JVLA 4UI9B 4NRBA 2E6RA 3M99A 2QICA 4A9OA 4WHWA 4XI1A 4GPJA 2XEUA 4N4HA 3DWYA 4AYCA 5DKHA 4YH3A 4OUFA 5EQ1A 4NUCA 5FFVA 4KV4A 2MA5A 3U5PA 2VJFB 2F42A 4I7CA 5A5SA 2OXQC 3LQJA 3LQIA 5KTXA 5H9MA 1WIMA 4B86C 2QIZA 5E73A 5E9VA 4TTEA 2OUOA 4IOOA 4I7BA 1RMDA 3LRQA 1K2FA 3MHSA 5F1LA 4OGJA 4LYIA 4QEVA 1WUGA 5LJ0A 3IHPA 3LJWA 3O34A 5F25A 4CFLA 2JMDA 4UYEA 5BT3A 5FE5A 1WFKA 2KWOA 4MEQA 4LYSA 3O36A 5HFQA 4NYXA 4HXLA 5I83A 5ETBA 2E7NA 4YY4A 5D26A 3SVFA 2BAYA 3I2DA 3N9LA 4OGIA 4PTBA 2YELA 5ENEA 5F1HA 5AMFA 1X4JA 1EQFA 4BW2A 2DATA 3P1FA 5C8GA 4TT4A 3MULA 1DVPA 3KV6A 4QZSA 5FG4A 1X4IA 1ZS5A 2KWJA 4YYDA 5AIUA 4O7BA 4CA1A 2GRCA 4O78A 3TLPA 5LVRA 3UV5A 2LXHC 4L7XA 3MQMA 2YDWA 2L5UA 3S92A 5DBMA 5C4QA 4QF2A 4QR5A 1N87A 3SOUA 4UYFB 4NUEA 4WHUA 3SVGA 4BW4A 4R8PK 2YYNA 3U5OA 3PHDA 5D24A 5HM0A 2VP7A 1N72A 2RSDA 4J1PA 4MEPA 5EU1A 4NYWA 2E6SA 5CP5A 2JMJA 4BBQA 5DFBA 2AN6A 4IORA 2R10A 3IU6A 2WP1A 5J0DA 2VJEB 5DLXA 5HRVA 1WEQA 5E74A 5C7NA 4YYJA 2F6JA 4TS8A 2Y1MA 4A4CA 5FG6A 1WENA 3U5JA 5CGPA 5D1LB 5DYCA 2ECVA 4YYIA 3MXFA 2UZGA 4QR3A 5F3AA 5TDWA 4CCGX 3UV2A 5KU3A 4O7CA 4UIWA 5FB0A 4PCIA 2ECTA 4QSVA 2EODA 3ZPVE 4MR4A 5HLSA 5TABA 4LR6A 4BW3A 5I29A 2CKLA 5CQ4A 2ECNA 4A9JA 5IGMA 5H1TA 5L8UA 2L75A 4A49A 4LYWA 1HYIA 5A5RA 4YY6A 5DLZA 5L97A 5KTWA 4NR9A 4HBVA 5B75A 2E7OA 4QSQA 4YK0A 5FE6A 3HCUA 4YADA 2DVVA 5LVQA 4J0SA 2MNYA 4AKNA 4TZ2A 3IU5A 1VD4A 5CPEA 4LADB 5EISA 1E6IA 2YREA 4UYDA 4CLBA 1LDKC 4GB0A 5HQ5A 2LGLA 4O75A 5D3JA 4UIZA 5A7CA 4UYHA 4QC1A 5CQTA 2KTBB 2IDAA 2DVSA 5CUDA 5L8TA 1X4UA 2EGPA 4QEWA 4S3OC 4NR5A 4MSXA 4LDFA 4N4IA 1IYMA 4NYVA 2H0DB 4X3GA 4TKPB 2OO1A 5B8DA 1U6GB 1BORA 5EV9A 3ZYUA 5A5PA 5HFRA 4NN2A 2RI7A 5ENJA 2DVQA 5DINA 5C85A 2YW8A 5FERA 5I7YA 2YHOA 4YYHA 3MUKA 4CL9A 2L85A 4YBMA 4IOQA 5D3PA 5FE8A 2FUIA 5LKZA 4O64A 2RFJA 3GG3A 2K1JA 1MM2A 2E3KA 4XUAA 1WEMA 2MIQA 2VJFA 4W4UA 5F5ZA 5ENCA 4F52B 5I80A 5EP7A 1VYXA 5CY9A 2K4DA 5HELA 4ZW1A 5LKTA 4UP0A 5EWDA 2RNWA 4RVRA 2KR4A 5EICA 5F61A 3ZNIA 2D9EA 5CUGA 4YC9A 4O71A 5I7XA 5IGNA 3QZVA 2LQ6A 5JWMA 5D1MB 3LXJA 4UP5A 4LZ2A 5LUUA 5E3GA 5H85A 4A9LA 2KWNA 2HDPA 4WIVA 5E3DA 4TU6A 4QC3A 4YYNA 2M6MA 5F60A 4WZ2A 1WUMA 4NS5A 4MEOA 4QR4A 3M63A 5CQ7A 3FL2A 3AQAA 4IR3A 4QYDA 3KQIA 5EGUA 5LKXA 3D7CA 3G0LA 5DFCA 4Z6IA 4GNFA 4R7EA 4A9NA 3DQVR 5F62A 3M62A 5D3SA 4A9MA 3QZSA 5DFDA 4MR6A 5EPBA 1VFYA 5E9YA 2LXPC 3SOWA 5HEMA 5CUAA 1V87A 2G6QA 4QSPA 5KHMA 3VK6A 4S3OB 4YBSA 3EB6A 4WZ0A 3HCTA 5EWCA 2XB1A 2HYED 2QJ0A 5FE0A 5E9KA 4AP4A 2KIZA 5EYAF 3O33A 1WGMA 4NR6A 2YHNA 2ECWA 3HMFA 2KU3A 3U5NA 4I7DA 5ENIA 2F6NA 5FH6A 4HBYA 2L80A 4HXKA 5DW1A 5HJCA 1WEVA 5D3LA 2MT5A 2Y1NA 5DYAA 5A81A 5HQ6A 4QSTA 2CT2A 3O37A 3ZTGA 2L0BA 3UV4A 1XWHA 4HXMA 3O35A 3GL6A 2RNYA 3HMEA 2KWKA 5D3NA 3N9OA 4CUUA 2RNXA 5EA1A 5IGKA 3P1CA 5HRWA 5A85A 1ZBDB 2VJEA 3G0JA 5ENHA 2VPDA 3V43A 4TU4A 1WEUA 5DYXA 2M85A 2YT5A 1JM7A 5IG6A 5ENBA 4CUQA 4IC3A 2LDRA 5F63A 2DX8A 4WA6A 3Q2FA 4PCEA 5H1UA 4B7YC 4PY6A 4C9ZA 3JVKA 4FJCA 4KV1A 1WEEA 4Z93A 4A9FA 3L1XA 5G04B 2YEKA 2YSMA 3RPGC 2VNFA 4Q0OA 4NRAA 5FBXA 5EWHA 5CUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X2I A;  5IID A;  1Z6U A;  5CQ8 A;  5FFY A;  3LQH A;  3N9M A;  5B79 A;  2JMI A;  5I86 A;  5CU8 A;  1WE9 A;  5ETD A;  4ALH A;  4LRG A;  1WES A;  2OSS A;  4O7A A;  4O7F A;  4QEU A;  4Z1S A;  3SVH A;  3ONI A;  4Q6F A;  3T6R A;  4QNS A;  5TRB A;  1E4U A;  5DX4 A;  3DPL R;  4Q0N A;  5C13 A;  4N4G A;  5EWW A;  2KRE A;  1F68 A;  5JG6 A;  5FG5 A;  4YAB A;  3ZYQ A;  4HXO A;  2YQL A;  4YBT A;  2YU4 A;  5G4R A;  4TT2 A;  5CRM A;  2H0D A;  2M1R A;  4MR3 A;  5EPS A;  2M3H A;  3UVW A;  4ALG A;  5J3X A;  2NAA A;  2RO1 A;  3RTR B;  3HCS A;  4LZS A;  5FE1 A;  3L11 A;  4AVX A;  4HXR A;  4QSS A;  5AME A;  5DKC A;  2LN0 A;  2MUM A;  4UIV A;  3FKM X;  5G05 B;  5LCW B;  1Z2Q A;  5AIT A;  3O7A A;  4GNG A;  4O77 A;  5A82 A;  4UIX A;  4YAT A;  2YSJ A;  4LLB A;  4V3L C;  5E7D A;  4R2Y A;  1LDJ B;  4XY9 A;  5IGL A;  4HBW A;  4MVT A;  5FE9 A;  3U5M A;  5K29 A;  3RPG B;  2DWW A;  4YYM A;  4L58 A;  4P5O B;  5B76 A;  4FLP A;  4QSW A;  5FE2 A;  4CUR A;  1FP0 A;  3P1E A;  4FK5 A;  5C89 A;  4UIU A;  5B78 A;  4NUD A;  5E9L A;  5FE7 A;  4YYK A;  2LV9 A;  5HQ7 A;  2YEM A;  4WZ3 B;  2PNX A;  4HXS A;  4TYL A;  5DY7 A;  3JVM A;  2LGG A;  2ECJ A;  3C6W A;  5C11 A;  3K2J A;  5JI8 A;  3PUR A;  5CQ3 A;  4BHW A;  1FBV A;  3KV5 A;  2I8N A;  3MB3 A;  5COI A;  2KGG A;  3L1Z B;  3UVX A;  2G45 A;  4O76 A;  4QB3 A;  3ZVZ B;  4PKL A;  5I89 A;  5D25 A;  5DKA A;  4YYG A;  2MD7 B;  3P5O A;  4N4F A;  4A4B A;  4GNE A;  4XYA A;  4N3W A;  4O74 A;  3UVY A;  4UYG A;  5TCM A;  5G4S A;  5FFW A;  3AAD A;  4NXJ A;  4QY4 A;  2G4A A;  5EVA A;  5F36 A;  5FH8 A;  5HRX A;  5BT4 A;  2FSA A;  4AYC B;  2LGK A;  5ENF A;  5CUB A;  4ZC9 A;  2YQD A;  3N9P A;  3MB4 A;  5AD2 A;  4ZUX U;  5AD3 A;  2WP2 A;  4QYL A;  3UVD A;  4IC2 A;  3ASL A;  2L43 A;  5EM3 A;  5FE3 A;  5L96 A;  5FH7 A;  5FEY A;  4LKA A;  5D1K B;  5ACY A;  4UYF A;  2KGI A;  4O72 A;  5F2P A;  5HEN A;  4A9H A;  5LJ2 A;  4QF3 A;  3ZVY A;  4PPE A;  2C2L A;  3O70 A;  4GND A;  5EK9 A;  2Y43 A;  4XUB A;  5D7X A;  4MEN A;  4HXN A;  4BJX A;  5B77 A;  2G43 A;  5D3H A;  4CUP A;  5I1Q A;  2MNZ A;  4J3I A;  3SHB A;  5CQA A;  4BW1 A;  4O7E A;  2MD8 C;  4QBM A;  3RCW A;  4QSU A;  3MHH A;  3U5K A;  5TB6 A;  2VPB A;  4Z1Q A;  3PUQ A;  4QSX A;  4C66 A;  2VPE A;  2K16 A;  2CSY A;  5ENG A;  3U5L A;  1JOC A;  2FUU A;  5CUC A;  2L5E A;  4Y03 A;  4IR6 A;  4QUT A;  5EI4 A;  4CFK A;  4YAX A;  2YYR A;  5DW2 A;  5CRZ A;  5II1 A;  1WEP A;  4DON A;  2CSZ A;  3NG2 A;  4CUT A;  5CTL A;  5KH9 A;  2LSP B;  2LRI C;  2N9G A;  2LGV A;  5KH7 A;  3I3J A;  4NQN A;  4E96 A;  3Q2E A;  5A83 A;  1Z60 A;  3T7L A;  5E0R A;  1WEO A;  4PS5 A;  5I3L A;  5H1V A;  5FB1 A;  1T1H A;  3N9Q A;  3KNV A;  2ZET C;  4LZR A;  3NXB A;  4FIP A;  5DYU A;  4NQM A;  4C67 A;  4TT6 A;  4IR4 A;  2I50 A;  4A9E A;  3DAI A;  5HCL A;  2H60 A;  2R0Y A;  3HTK C;  4A0C D;  5D0C A;  5C87 A;  5KO4 A;  4NRC A;  4UIY A;  1JM7 B;  2R0V A;  4A9K A;  4UIT A;  4KCX A;  3ZPV 1;  3UW9 A;  4QUU A;  4Z6H A;  2K17 A;  4TZ8 A;  4J0R A;  2R0S A;  3P1D A;  5I88 A;  2YUC A;  5L99 A;  1JSP B;  2I7K A;  5LKU A;  4XY8 A;  2ECG A;  1F62 A;  5KTU A;  2DKW A;  1JM4 B;  4HBX A;  4NR4 A;  5CQ5 A;  2KE1 A;  1HYJ A;  5CFW A;  2KYU A;  4QSR A;  5A5Q A;  5CS8 A;  3EB5 A;  4F3I A;  5BT5 A;  5E9I A;  2VPG A;  1X0J A;  5EWV A;  4ZQL A;  1MM3 A;  2CKL B;  4AUQ B;  5I40 A;  2DVR A;  2JRJ A;  3JVJ A;  4IR5 A;  5FDZ A;  3S91 A;  3GV4 A;  4NR7 A;  5DKD A;  2MA6 A;  1G25 A;  4FO9 A;  2L84 A;  4HXP A;  4YH4 A;  4CUS A;  5LJ1 A;  2MJV B;  1WEW A;  2PUY A;  4LK9 A;  2RS9 B;  3N9N A;  4TQN A;  5D3T A;  3SOX A;  3C5K A;  5D3R A;  5CQ6 A;  2C2V S;  4V3K C;  2YW5 A;  4ZDT A;  5TDR A;  5II2 A;  4LC2 A;  5A5N A;  1WIL A;  4MR5 A;  4LJN A;  5TBN A;  1CHC A;  2YQM A;  2YUR A;  5L98 A;  5A5O A;  4NR8 A;  3HMH A;  5E9M A;  5IBN A;  2EA6 A;  2D8S A;  5KH3 A;  5EPR A;  5FE4 A;  4A9I A;  5G0F A;  5CZG A;  3QZT A;  2ECI A;  2KFT A;  2D82 A;  4O70 A;  2NXB A;  3JVL A;  4UI9 B;  4NRB A;  2E6R A;  3M99 A;  2QIC A;  4A9O A;  4WHW A;  4XI1 A;  4GPJ A;  2XEU A;  4N4H A;  3DWY A;  4AYC A;  5DKH A;  4YH3 A;  4OUF A;  5EQ1 A;  4NUC A;  5FFV A;  4KV4 A;  2MA5 A;  3U5P A;  2VJF B;  2F42 A;  4I7C A;  5A5S A;  2OXQ C;  3LQJ A;  3LQI A;  5KTX A;  5H9M A;  1WIM A;  4B86 C;  2QIZ A;  5E73 A;  5E9V A;  4TTE A;  2OUO A;  4IOO A;  4I7B A;  1RMD A;  3LRQ A;  1K2F A;  3MHS A;  5F1L A;  4OGJ A;  4LYI A;  4QEV A;  1WUG A;  5LJ0 A;  3IHP A;  3LJW A;  3O34 A;  5F25 A;  4CFL A;  2JMD A;  4UYE A;  5BT3 A;  5FE5 A;  1WFK A;  2KWO A;  4MEQ A;  4LYS A;  3O36 A;  5HFQ A;  4NYX A;  4HXL A;  5I83 A;  5ETB A;  2E7N A;  4YY4 A;  5D26 A;  3SVF A;  2BAY A;  3I2D A;  3N9L A;  4OGI A;  4PTB A;  2YEL A;  5ENE A;  5F1H A;  5AMF A;  1X4J A;  1EQF A;  4BW2 A;  2DAT A;  3P1F A;  5C8G A;  4TT4 A;  3MUL A;  1DVP A;  3KV6 A;  4QZS A;  5FG4 A;  1X4I A;  1ZS5 A;  2KWJ A;  4YYD A;  5AIU A;  4O7B A;  4CA1 A;  2GRC A;  4O78 A;  3TLP A;  5LVR A;  3UV5 A;  2LXH C;  4L7X A;  3MQM A;  2YDW A;  2L5U A;  3S92 A;  5DBM A;  5C4Q A;  4QF2 A;  4QR5 A;  1N87 A;  3SOU A;  4UYF B;  4NUE A;  4WHU A;  3SVG A;  4BW4 A;  4R8P K;  2YYN A;  3U5O A;  3PHD A;  5D24 A;  5HM0 A;  2VP7 A;  1N72 A;  2RSD A;  4J1P A;  4MEP A;  5EU1 A;  4NYW A;  2E6S A;  5CP5 A;  2JMJ A;  4BBQ A;  5DFB A;  2AN6 A;  4IOR A;  2R10 A;  3IU6 A;  2WP1 A;  5J0D A;  2VJE B;  5DLX A;  5HRV A;  1WEQ A;  5E74 A;  5C7N A;  4YYJ A;  2F6J A;  4TS8 A;  2Y1M A;  4A4C A;  5FG6 A;  1WEN A;  3U5J A;  5CGP A;  5D1L B;  5DYC A;  2ECV A;  4YYI A;  3MXF A;  2UZG A;  4QR3 A;  5F3A A;  5TDW A;  4CCG X;  3UV2 A;  5KU3 A;  4O7C A;  4UIW A;  5FB0 A;  4PCI A;  2ECT A;  4QSV A;  2EOD A;  3ZPV E;  4MR4 A;  5HLS A;  5TAB A;  4LR6 A;  4BW3 A;  5I29 A;  2CKL A;  5CQ4 A;  2ECN A;  4A9J A;  5IGM A;  5H1T A;  5L8U A;  2L75 A;  4A49 A;  4LYW A;  1HYI A;  5A5R A;  4YY6 A;  5DLZ A;  5L97 A;  5KTW A;  4NR9 A;  4HBV A;  5B75 A;  2E7O A;  4QSQ A;  4YK0 A;  5FE6 A;  3HCU A;  4YAD A;  2DVV A;  5LVQ A;  4J0S A;  2MNY A;  4AKN A;  4TZ2 A;  3IU5 A;  1VD4 A;  5CPE A;  4LAD B;  5EIS A;  1E6I A;  2YRE A;  4UYD A;  4CLB A;  1LDK C;  4GB0 A;  5HQ5 A;  2LGL A;  4O75 A;  5D3J A;  4UIZ A;  5A7C A;  4UYH A;  4QC1 A;  5CQT A;  2KTB B;  2IDA A;  2DVS A;  5CUD A;  5L8T A;  1X4U A;  2EGP A;  4QEW A;  4S3O C;  4NR5 A;  4MSX A;  4LDF A;  4N4I A;  1IYM A;  4NYV A;  2H0D B;  4X3G A;  4TKP B;  2OO1 A;  5B8D A;  1U6G B;  1BOR A;  5EV9 A;  3ZYU A;  5A5P A;  5HFR A;  4NN2 A;  2RI7 A;  5ENJ A;  2DVQ A;  5DIN A;  5C85 A;  2YW8 A;  5FER A;  5I7Y A;  2YHO A;  4YYH A;  3MUK A;  4CL9 A;  2L85 A;  4YBM A;  4IOQ A;  5D3P A;  5FE8 A;  2FUI A;  5LKZ A;  4O64 A;  2RFJ A;  3GG3 A;  2K1J A;  1MM2 A;  2E3K A;  4XUA A;  1WEM A;  2MIQ A;  2VJF A;  4W4U A;  5F5Z A;  5ENC A;  4F52 B;  5I80 A;  5EP7 A;  1VYX A;  5CY9 A;  2K4D A;  5HEL A;  4ZW1 A;  5LKT A;  4UP0 A;  5EWD A;  2RNW A;  4RVR A;  2KR4 A;  5EIC A;  5F61 A;  3ZNI A;  2D9E A;  5CUG A;  4YC9 A;  4O71 A;  5I7X A;  5IGN A;  3QZV A;  2LQ6 A;  5JWM A;  5D1M B;  3LXJ A;  4UP5 A;  4LZ2 A;  5LUU A;  5E3G A;  5H85 A;  4A9L A;  2KWN A;  2HDP A;  4WIV A;  5E3D A;  4TU6 A;  4QC3 A;  4YYN A;  2M6M A;  5F60 A;  4WZ2 A;  1WUM A;  4NS5 A;  4MEO A;  4QR4 A;  3M63 A;  5CQ7 A;  3FL2 A;  3AQA A;  4IR3 A;  4QYD A;  3KQI A;  5EGU A;  5LKX A;  3D7C A;  3G0L A;  5DFC A;  4Z6I A;  4GNF A;  4R7E A;  4A9N A;  3DQV R;  5F62 A;  3M62 A;  5D3S A;  4A9M A;  3QZS A;  5DFD A;  4MR6 A;  5EPB A;  1VFY A;  5E9Y A;  2LXP C;  3SOW A;  5HEM A;  5CUA A;  1V87 A;  2G6Q A;  4QSP A;  5KHM A;  3VK6 A;  4S3O B;  4YBS A;  3EB6 A;  4WZ0 A;  3HCT A;  5EWC A;  2XB1 A;  2HYE D;  2QJ0 A;  5FE0 A;  5E9K A;  4AP4 A;  2KIZ A;  5EYA F;  3O33 A;  1WGM A;  4NR6 A;  2YHN A;  2ECW A;  3HMF A;  2KU3 A;  3U5N A;  4I7D A;  5ENI A;  2F6N A;  5FH6 A;  4HBY A;  2L80 A;  4HXK A;  5DW1 A;  5HJC A;  1WEV A;  5D3L A;  2MT5 A;  2Y1N A;  5DYA A;  5A81 A;  5HQ6 A;  4QST A;  2CT2 A;  3O37 A;  3ZTG A;  2L0B A;  3UV4 A;  1XWH A;  4HXM A;  3O35 A;  3GL6 A;  2RNY A;  3HME A;  2KWK A;  5D3N A;  3N9O A;  4CUU A;  2RNX A;  5EA1 A;  5IGK A;  3P1C A;  5HRW A;  5A85 A;  1ZBD B;  2VJE A;  3G0J A;  5ENH A;  2VPD A;  3V43 A;  4TU4 A;  1WEU A;  5DYX A;  2M85 A;  2YT5 A;  1JM7 A;  5IG6 A;  5ENB A;  4CUQ A;  4IC3 A;  2LDR A;  5F63 A;  2DX8 A;  4WA6 A;  3Q2F A;  4PCE A;  5H1U A;  4B7Y C;  4PY6 A;  4C9Z A;  3JVK A;  4FJC A;  4KV1 A;  1WEE A;  4Z93 A;  4A9F A;  3L1X A;  5G04 B;  2YEK A;  2YSM A;  3RPG C;  2VNF A;  4Q0O A;  4NRA A;  5FBX A;  5EWH A;  5CUE A; 
#chains in the Genus database with same CATH topology
 4X2I A;  5IID A;  1Z6U A;  5CQ8 A;  5FFY A;  3ERR A;  3LQH A;  3N9M A;  5B79 A;  2JMI A;  4AKG A;  5I86 A;  5CU8 A;  1WE9 A;  5ETD A;  4ALH A;  4LRG A;  1WES A;  2OSS A;  4O7A A;  4O7F A;  4QEU A;  4Z1S A;  3SVH A;  3ONI A;  4Q6F A;  3T6R A;  4QNS A;  5TRB A;  1E4U A;  5DX4 A;  3DPL R;  4Q0N A;  5C13 A;  4N4G A;  5EWW A;  2KRE A;  1F68 A;  3H7H A;  5JG6 A;  5FG5 A;  4YAB A;  5SVI B;  3ZYQ A;  4HXO A;  2YQL A;  4YBT A;  2YU4 A;  5G4R A;  4TT2 A;  5CRM A;  2H0D A;  3FAN A;  2M1R A;  4MR3 A;  5EPS A;  2M3H A;  3UVW A;  4ALG A;  5J3X A;  2NAA A;  2RO1 A;  3RTR B;  3HCS A;  4LZS A;  5FE1 A;  2E61 A;  3L11 A;  4AVX A;  4HXR A;  4QSS A;  5AME A;  5DKC A;  2LN0 A;  2MUM A;  2CRR A;  4UIV A;  3FKM X;  5G05 B;  5LCW B;  1Z2Q A;  5AIT A;  3O7A A;  4GNG A;  4O77 A;  5A82 A;  3O47 A;  4UIX A;  4YAT A;  2YSJ A;  4LLB A;  4V3L C;  5E7D A;  4R2Y A;  3E2D A;  1LDJ B;  4XY9 A;  5IGL A;  2DJA A;  4HBW A;  2JUN A;  4MVT A;  5FE9 A;  3U5M A;  5K29 A;  3RPG B;  2DWW A;  4YYM A;  4L58 A;  4P5O B;  5B76 A;  2XOC A;  4FLP A;  2YVR A;  4QSW A;  5FE2 A;  4CUR A;  1FP0 A;  3P1E A;  4FK5 A;  5C89 A;  4UIU A;  5B78 A;  4NUD A;  5E9L A;  5FE7 A;  4YYK A;  2LV9 A;  3FAO A;  5HQ7 A;  2YEM A;  4WZ3 B;  2PNX A;  4HXS A;  4TYL A;  5DY7 A;  3JVM A;  2LGG A;  2CSV A;  2ECJ A;  3C6W A;  3VKG A;  5C11 A;  3K2J A;  5JI8 A;  3PUR A;  5CQ3 A;  4BHW A;  1FBV A;  3KV5 A;  2I8N A;  3MB3 A;  5COI A;  2KGG A;  3L1Z B;  2OWA A;  3UVX A;  2G45 A;  4O76 A;  4QB3 A;  3ZVZ B;  4PKL A;  5I89 A;  2EJN A;  5D25 A;  5DKA A;  4YYG A;  2MD7 B;  3P5O A;  4N4F A;  3JUE A;  4GNE A;  4A4B A;  4XYA A;  4N3W A;  4O74 A;  3UVY A;  4UYG A;  5TCM A;  5G4S A;  5FFW A;  3AAD A;  4NXJ A;  4QY4 A;  2G4A A;  5EVA A;  5F36 A;  5FH8 A;  5HRX A;  5BT4 A;  2FSA A;  4AYC B;  2LGK A;  5ENF A;  5CUB A;  4ZC9 A;  2YQD A;  3LJU X;  3N9P A;  1PUO A;  3MB4 A;  5AD2 A;  5AD3 A;  2WP2 A;  4QYL A;  3UVD A;  4IC2 A;  4ZUX U;  3ASL A;  2L43 A;  5EM3 A;  5FE3 A;  5L96 A;  5FH7 A;  2MKE A;  5FEY A;  4LKA A;  5D1K B;  5ACY A;  4UYF A;  2KGI A;  4O72 A;  5F2P A;  5HEN A;  4A9H A;  5LJ2 A;  4QF3 A;  3ZVY A;  4PPE A;  2C2L A;  3O70 A;  4GND A;  5EK9 A;  2Y43 A;  4XUB A;  5D7X A;  4MEN A;  4HXN A;  4BJX A;  5B77 A;  2G43 A;  5D3H A;  4CUP A;  5I1Q A;  2MNZ A;  4J3I A;  3SHB A;  5CQA A;  4BW1 A;  4O7E A;  2MD8 C;  4QBM A;  3RCW A;  4QSU A;  3MHH A;  3U5K A;  5TB6 A;  2VPB A;  4Z1Q A;  3PUQ A;  4QSX A;  4C66 A;  2D8U A;  2VPE A;  3FEH A;  2K16 A;  2CSY A;  1DCQ A;  5ENG A;  3U5L A;  1JOC A;  2FUU A;  5CUC A;  2L5E A;  4Y03 A;  4IR6 A;  4QUT A;  5EI4 A;  4CFK A;  4YAX A;  2YYR A;  5DW2 A;  5CRZ A;  5II1 A;  1WEP A;  4DON A;  2CSZ A;  3NG2 A;  4CUT A;  5CTL A;  5KH9 A;  2LSP B;  2LRI C;  2N9G A;  2LGV A;  5KH7 A;  3I3J A;  4NQN A;  4E96 A;  3VKH A;  3Q2E A;  5A83 A;  1Z60 A;  3T7L A;  2KKY A;  5E0R A;  1WEO A;  4PS5 A;  5I3L A;  5H1V A;  5FB1 A;  1T1H A;  3N9Q A;  3KNV A;  2ZET C;  4LZR A;  3NXB A;  3SUB A;  4FIP A;  3LVQ E;  5DYU A;  3DDT A;  4NQM A;  4C67 A;  4TT6 A;  4IR4 A;  2I50 A;  4A9E A;  3DAI A;  5HCL A;  2H60 A;  2R0Y A;  3HTK C;  4A0C D;  5D0C A;  5C87 A;  5KO4 A;  4NRC A;  4UIY A;  1JM7 B;  2R0V A;  4A9K A;  4UIT A;  4KCX A;  3ZPV 1;  3UW9 A;  4QUU A;  4Z6H A;  2K17 A;  4TZ8 A;  4J0R A;  2R0S A;  3P1D A;  5I88 A;  2YUC A;  5L99 A;  2CON A;  1JSP B;  2I7K A;  5LKU A;  3MDB C;  4XY8 A;  2ECG A;  1F62 A;  5KTU A;  2DKW A;  1JM4 B;  4HBX A;  4NR4 A;  5CQ5 A;  2KE1 A;  1HYJ A;  5CFW A;  2KYU A;  4QSR A;  5A5Q A;  5CS8 A;  3EB5 A;  4F3I A;  5BT5 A;  5E9I A;  2VPG A;  1X0J A;  5EWV A;  2B0O E;  4ZQL A;  1MM3 A;  2CKL B;  4AUQ B;  5I40 A;  2DVR A;  2JRJ A;  3JVJ A;  4IR5 A;  5FDZ A;  1ZKR A;  3S91 A;  3GV4 A;  3M7K A;  4NR7 A;  5DKD A;  2MA6 A;  1G25 A;  4FO9 A;  2L84 A;  4Z0R A;  4HXP A;  4YH4 A;  4CUS A;  5LJ1 A;  2MJV B;  1WEW A;  2PUY A;  4LK9 A;  2RS9 B;  3N9N A;  4TQN A;  5D3T A;  3DWD A;  3SOX A;  3C5K A;  5D3R A;  5CQ6 A;  2C2V S;  4V3K C;  2YW5 A;  4ZDT A;  5TDR A;  5II2 A;  4LC2 A;  5A5N A;  1WIL A;  4MR5 A;  4LJN A;  5TBN A;  1CHC A;  2YQM A;  2YUR A;  5L98 A;  5A5O A;  4NR8 A;  2XOY A;  3HMH A;  5E9M A;  5IBN A;  2EA6 A;  2D8S A;  5KH3 A;  5EPR A;  5FE4 A;  2XP0 A;  2RR4 A;  4A9I A;  5G0F A;  5CZG A;  3QZT A;  4H9D A;  2ECI A;  2KFT A;  2D82 A;  4O70 A;  2NXB A;  3JVL A;  4UI9 B;  4NRB A;  2E6R A;  3M99 A;  2QIC A;  4A9O A;  4WHW A;  4XI1 A;  4GPJ A;  2XEU A;  4N4H A;  3DWY A;  4AYC A;  5DKH A;  4YH3 A;  4OUF A;  2JM3 A;  5EQ1 A;  4NUC A;  3FM8 C;  5FFV A;  4KV4 A;  2MA5 A;  3U5P A;  2VJF B;  2F42 A;  3FJU B;  4I7C A;  3KDE C;  5A5S A;  2OXQ C;  3LQJ A;  3LQI A;  5KTX A;  5H9M A;  1WIM A;  4B86 C;  2QIZ A;  5E73 A;  5E9V A;  4TTE A;  2OUO A;  2M13 A;  4IOO A;  4I7B A;  1RMD A;  3LRQ A;  1K2F A;  3MHS A;  5F1L A;  4OGJ A;  4LYI A;  4QEV A;  1WUG A;  5LJ0 A;  3IHP A;  3LJW A;  3O34 A;  5F25 A;  4CFL A;  3T9K A;  2JMD A;  4UYE A;  5BT3 A;  5FE5 A;  1WFK A;  2KWO A;  4MEQ A;  4LYS A;  3O36 A;  5HFQ A;  4NYX A;  4HXL A;  5I83 A;  5ETB A;  2E7N A;  4YY4 A;  5D26 A;  3SVF A;  2BAY A;  3I2D A;  3N9L A;  4OGI A;  4PTB A;  2YEL A;  5ENE A;  5F1H A;  5AMF A;  1X4J A;  2KKX A;  1EQF A;  4BW2 A;  2DAT A;  3P1F A;  5C8G A;  4TT4 A;  4Z0O A;  3MUL A;  1DVP A;  3KV6 A;  4QZS A;  5FG4 A;  1X4I A;  1ZS5 A;  2KWJ A;  4YYD A;  5AIU A;  4O7B A;  4AI6 A;  2GRC A;  4CA1 A;  4O78 A;  3TLP A;  5LVR A;  3UV5 A;  2LXH C;  4L7X A;  3MQM A;  2YDW A;  2L5U A;  3S92 A;  5DBM A;  5C4Q A;  4QF2 A;  4QR5 A;  1N87 A;  3SOU A;  5SVY A;  4UYF B;  4NUE A;  4WHU A;  3SVG A;  4BW4 A;  4R8P K;  2YYN A;  3U5O A;  3PHD A;  5D24 A;  5HM0 A;  2VP7 A;  2EXU A;  1N72 A;  2RSD A;  4J1P A;  4MEP A;  5EU1 A;  4NYW A;  2E6S A;  5CP5 A;  2JMJ A;  4BBQ A;  5DFB A;  2AN6 A;  4IOR A;  2R10 A;  3IU6 A;  2WP1 A;  5J0D A;  2VJE B;  5DLX A;  5HRV A;  1WEQ A;  5E74 A;  5C7N A;  4YYJ A;  2F6J A;  4TS8 A;  2Y1M A;  4A4C A;  5SVI A;  5FG6 A;  1WEN A;  3U5J A;  5CGP A;  5D1L B;  5DYC A;  2ECV A;  4YYI A;  3MXF A;  2UZG A;  4QR3 A;  5F3A A;  5TDW A;  4CCG X;  3UV2 A;  5KU3 A;  4O7C A;  4UIW A;  5FB0 A;  4PCI A;  2ECT A;  4QSV A;  2EOD A;  2L7P A;  3ZPV E;  4MR4 A;  5HLS A;  5TAB A;  4LR6 A;  3PLW A;  4BW3 A;  5I29 A;  2CKL A;  5CQ4 A;  2ECN A;  4A9J A;  5IGM A;  5H1T A;  5L8U A;  2L75 A;  5SVX A;  4A49 A;  4LYW A;  1HYI A;  5A5R A;  4YY6 A;  5DLZ A;  5L97 A;  5KTW A;  4NR9 A;  3D1B A;  4HBV A;  5B75 A;  2E7O A;  4QSQ A;  4YK0 A;  5FE6 A;  3HCU A;  4YAD A;  2DVV A;  5LVQ A;  4J0S A;  2MNY A;  4AKN A;  4TZ2 A;  3IU5 A;  1VD4 A;  5CPE A;  4LAD B;  2LAU A;  5EIS A;  1E6I A;  2YRE A;  4UYD A;  4CLB A;  1LDK C;  4GB0 A;  5HQ5 A;  2LGL A;  4O75 A;  5D3J A;  4UIZ A;  5A7C A;  4UYH A;  4QC1 A;  5CQT A;  4OGE A;  2KTB B;  2IDA A;  2DVS A;  5CUD A;  5L8T A;  1X4U A;  2EGP A;  4QEW A;  3LVR E;  4S3O C;  4NR5 A;  4MSX A;  4OGC A;  4LDF A;  4N4I A;  1IYM A;  4NYV A;  2H0D B;  4X3G A;  4TKP B;  2OO1 A;  5B8D A;  1U6G B;  1BOR A;  2CRW A;  5EV9 A;  3ZYU A;  5A5P A;  5HFR A;  3D1D A;  4NN2 A;  2RI7 A;  5ENJ A;  2DVQ A;  5DIN A;  5C85 A;  2YW8 A;  5FER A;  4AKH A;  5I7Y A;  2YHO A;  4YYH A;  3MUK A;  2DSM A;  4CL9 A;  2L85 A;  4YBM A;  4IOQ A;  5D3P A;  5FE8 A;  2FUI A;  5LKZ A;  4O64 A;  2RFJ A;  3GG3 A;  2K1J A;  1MM2 A;  2E3K A;  4XUA A;  1WEM A;  2MIQ A;  2VJF A;  4W4U A;  5F5Z A;  5ENC A;  4F52 B;  5I80 A;  5EP7 A;  1VYX A;  5CY9 A;  2K4D A;  5HEL A;  4ZW1 A;  5LKT A;  4UP0 A;  5EWD A;  2RNW A;  4RVR A;  2KR4 A;  5EIC A;  5F61 A;  3ZNI A;  2D9E A;  5CUG A;  4YC9 A;  4O71 A;  5I7X A;  5IGN A;  2FFW A;  3QZV A;  2IQJ A;  2LQ6 A;  5JWM A;  5D1M B;  3LXJ A;  4UP5 A;  4AKI A;  4LZ2 A;  5LUU A;  5E3G A;  5H85 A;  4A9L A;  2KWN A;  2HDP A;  4F1P A;  4WIV A;  5E3D A;  4TU6 A;  4QC3 A;  1MBM A;  4YYN A;  2M6M A;  5F60 A;  4WZ2 A;  1WUM A;  4NS5 A;  4MEO A;  4QR4 A;  3M63 A;  5CQ7 A;  3FL2 A;  3AQA A;  4IR3 A;  4QYD A;  3KQI A;  5EGU A;  5LKX A;  3D7C A;  3G0L A;  5DFC A;  4Z6I A;  4GNF A;  4R7E A;  4A9N A;  3DQV R;  5F62 A;  3M62 A;  5D3S A;  4QQ4 A;  4A9M A;  3QZS A;  5DFD A;  4MR6 A;  5EPB A;  1VFY A;  5E9Y A;  2LXP C;  2P57 A;  3SOW A;  5HEM A;  5CUA A;  1V87 A;  2G6Q A;  4QSP A;  5KHM A;  3VK6 A;  4S3O B;  4YBS A;  3EB6 A;  4WZ0 A;  3HCT A;  5EWC A;  2XB1 A;  2HYE D;  2QJ0 A;  5FE0 A;  5E9K A;  4AP4 A;  2KIZ A;  5EYA F;  2XOZ A;  3O33 A;  1WGM A;  2FD4 A;  4NR6 A;  4O62 A;  2YHN A;  2ECW A;  3HMF A;  2KU3 A;  3U5N A;  4I7D A;  5ENI A;  2F6N A;  5FH6 A;  4HBY A;  2L80 A;  4HXK A;  5DW1 A;  5HJC A;  1WEV A;  5D3L A;  2MT5 A;  2Y1N A;  5DYA A;  5A81 A;  5HQ6 A;  4QST A;  2CT2 A;  3O37 A;  3ZTG A;  2L0B A;  3UV4 A;  1XWH A;  4HXM A;  3O35 A;  3GL6 A;  2RNY A;  3HME A;  2KWK A;  5D3N A;  3N9O A;  4CUU A;  3Q1D A;  2RNX A;  5EA1 A;  5IGK A;  3P1C A;  5HRW A;  5A85 A;  1ZBD B;  2VJE A;  3G0J A;  5ENH A;  2VPD A;  3V43 A;  4TU4 A;  1WEU A;  5DYX A;  3LDY A;  2M85 A;  2YT5 A;  1JM7 A;  5IG6 A;  5ENB A;  2EGM A;  4CUQ A;  4IC3 A;  2LDR A;  5F63 A;  2DX8 A;  4WA6 A;  3Q2F A;  4PCE A;  5H1U A;  5K3Q A;  4B7Y C;  4PY6 A;  4C9Z A;  3JVK A;  4FJC A;  4KV1 A;  1WEE A;  4Z93 A;  4A9F A;  3L1X A;  5G04 B;  2YEK A;  2YSM A;  3RPG C;  2VNF A;  4Q0O A;  4NRA A;  5FBX A;  5EWH A;  5CUE A; 
#chains in the Genus database with same CATH homology
 4X2I A;  5IID A;  1Z6U A;  5CQ8 A;  5FFY A;  3LQH A;  3N9M A;  5B79 A;  2JMI A;  5I86 A;  5CU8 A;  1WE9 A;  5ETD A;  4ALH A;  4LRG A;  1WES A;  2OSS A;  4O7A A;  4O7F A;  4QEU A;  4Z1S A;  3SVH A;  3ONI A;  4Q6F A;  3T6R A;  4QNS A;  5TRB A;  1E4U A;  5DX4 A;  3DPL R;  4Q0N A;  5C13 A;  4N4G A;  5EWW A;  2KRE A;  1F68 A;  5JG6 A;  5FG5 A;  4YAB A;  3ZYQ A;  4HXO A;  2YQL A;  4YBT A;  2YU4 A;  5G4R A;  4TT2 A;  5CRM A;  2H0D A;  2M1R A;  4MR3 A;  5EPS A;  2M3H A;  3UVW A;  4ALG A;  5J3X A;  2NAA A;  2RO1 A;  3RTR B;  3HCS A;  4LZS A;  5FE1 A;  3L11 A;  4AVX A;  4HXR A;  4QSS A;  5AME A;  5DKC A;  2LN0 A;  2MUM A;  4UIV A;  3FKM X;  5G05 B;  5LCW B;  1Z2Q A;  5AIT A;  3O7A A;  4GNG A;  4O77 A;  5A82 A;  4UIX A;  4YAT A;  2YSJ A;  4LLB A;  4V3L C;  5E7D A;  4R2Y A;  1LDJ B;  4XY9 A;  5IGL A;  4HBW A;  4MVT A;  5FE9 A;  3U5M A;  5K29 A;  3RPG B;  2DWW A;  4YYM A;  4L58 A;  4P5O B;  5B76 A;  4FLP A;  4QSW A;  5FE2 A;  4CUR A;  1FP0 A;  3P1E A;  4FK5 A;  5C89 A;  4UIU A;  5B78 A;  4NUD A;  5E9L A;  5FE7 A;  4YYK A;  2LV9 A;  5HQ7 A;  2YEM A;  4WZ3 B;  2PNX A;  4HXS A;  4TYL A;  5DY7 A;  3JVM A;  2LGG A;  2ECJ A;  3C6W A;  5C11 A;  3K2J A;  5JI8 A;  3PUR A;  5CQ3 A;  4BHW A;  1FBV A;  3KV5 A;  2I8N A;  3MB3 A;  5COI A;  2KGG A;  3L1Z B;  3UVX A;  2G45 A;  4O76 A;  4QB3 A;  3ZVZ B;  4PKL A;  5I89 A;  5D25 A;  5DKA A;  4YYG A;  2MD7 B;  3P5O A;  4N4F A;  4A4B A;  4GNE A;  4XYA A;  4N3W A;  4O74 A;  3UVY A;  4UYG A;  5TCM A;  5G4S A;  5FFW A;  3AAD A;  4NXJ A;  4QY4 A;  2G4A A;  5EVA A;  5F36 A;  5FH8 A;  5HRX A;  5BT4 A;  2FSA A;  4AYC B;  2LGK A;  5ENF A;  5CUB A;  4ZC9 A;  2YQD A;  3N9P A;  3MB4 A;  5AD2 A;  4ZUX U;  5AD3 A;  2WP2 A;  4QYL A;  3UVD A;  4IC2 A;  3ASL A;  2L43 A;  5EM3 A;  5FE3 A;  5L96 A;  5FH7 A;  5FEY A;  4LKA A;  5D1K B;  5ACY A;  4UYF A;  2KGI A;  4O72 A;  5F2P A;  5HEN A;  4A9H A;  5LJ2 A;  4QF3 A;  3ZVY A;  4PPE A;  2C2L A;  3O70 A;  4GND A;  5EK9 A;  2Y43 A;  4XUB A;  5D7X A;  4MEN A;  4HXN A;  4BJX A;  5B77 A;  2G43 A;  5D3H A;  4CUP A;  5I1Q A;  2MNZ A;  4J3I A;  3SHB A;  5CQA A;  4BW1 A;  4O7E A;  2MD8 C;  4QBM A;  3RCW A;  4QSU A;  3MHH A;  3U5K A;  5TB6 A;  2VPB A;  4Z1Q A;  3PUQ A;  4QSX A;  4C66 A;  2VPE A;  2K16 A;  2CSY A;  5ENG A;  3U5L A;  1JOC A;  2FUU A;  5CUC A;  2L5E A;  4Y03 A;  4IR6 A;  4QUT A;  5EI4 A;  4CFK A;  4YAX A;  2YYR A;  5DW2 A;  5CRZ A;  5II1 A;  1WEP A;  4DON A;  2CSZ A;  3NG2 A;  4CUT A;  5CTL A;  5KH9 A;  2LSP B;  2LRI C;  2N9G A;  2LGV A;  5KH7 A;  3I3J A;  4NQN A;  4E96 A;  3Q2E A;  5A83 A;  1Z60 A;  3T7L A;  5E0R A;  1WEO A;  4PS5 A;  5I3L A;  5H1V A;  5FB1 A;  1T1H A;  3N9Q A;  3KNV A;  2ZET C;  4LZR A;  3NXB A;  4FIP A;  5DYU A;  4NQM A;  4C67 A;  4TT6 A;  4IR4 A;  2I50 A;  4A9E A;  3DAI A;  5HCL A;  2H60 A;  2R0Y A;  3HTK C;  4A0C D;  5D0C A;  5C87 A;  5KO4 A;  4NRC A;  4UIY A;  1JM7 B;  2R0V A;  4A9K A;  4UIT A;  4KCX A;  3ZPV 1;  3UW9 A;  4QUU A;  4Z6H A;  2K17 A;  4TZ8 A;  4J0R A;  2R0S A;  3P1D A;  5I88 A;  2YUC A;  5L99 A;  1JSP B;  2I7K A;  5LKU A;  4XY8 A;  2ECG A;  1F62 A;  5KTU A;  2DKW A;  1JM4 B;  4HBX A;  4NR4 A;  5CQ5 A;  2KE1 A;  1HYJ A;  5CFW A;  2KYU A;  4QSR A;  5A5Q A;  5CS8 A;  3EB5 A;  4F3I A;  5BT5 A;  5E9I A;  2VPG A;  1X0J A;  5EWV A;  4ZQL A;  1MM3 A;  2CKL B;  4AUQ B;  5I40 A;  2DVR A;  2JRJ A;  3JVJ A;  4IR5 A;  5FDZ A;  3S91 A;  3GV4 A;  4NR7 A;  5DKD A;  2MA6 A;  1G25 A;  4FO9 A;  2L84 A;  4HXP A;  4YH4 A;  4CUS A;  5LJ1 A;  2MJV B;  1WEW A;  2PUY A;  4LK9 A;  2RS9 B;  3N9N A;  4TQN A;  5D3T A;  3SOX A;  3C5K A;  5D3R A;  5CQ6 A;  2C2V S;  4V3K C;  2YW5 A;  4ZDT A;  5TDR A;  5II2 A;  4LC2 A;  5A5N A;  1WIL A;  4MR5 A;  4LJN A;  5TBN A;  1CHC A;  2YQM A;  2YUR A;  5L98 A;  5A5O A;  4NR8 A;  3HMH A;  5E9M A;  5IBN A;  2EA6 A;  2D8S A;  5KH3 A;  5EPR A;  5FE4 A;  4A9I A;  5G0F A;  5CZG A;  3QZT A;  2ECI A;  2KFT A;  2D82 A;  4O70 A;  2NXB A;  3JVL A;  4UI9 B;  4NRB A;  2E6R A;  3M99 A;  2QIC A;  4A9O A;  4WHW A;  4XI1 A;  4GPJ A;  2XEU A;  4N4H A;  3DWY A;  4AYC A;  5DKH A;  4YH3 A;  4OUF A;  5EQ1 A;  4NUC A;  5FFV A;  4KV4 A;  2MA5 A;  3U5P A;  2VJF B;  2F42 A;  4I7C A;  5A5S A;  2OXQ C;  3LQJ A;  3LQI A;  5KTX A;  5H9M A;  1WIM A;  4B86 C;  2QIZ A;  5E73 A;  5E9V A;  4TTE A;  2OUO A;  4IOO A;  4I7B A;  1RMD A;  3LRQ A;  1K2F A;  3MHS A;  5F1L A;  4OGJ A;  4LYI A;  4QEV A;  1WUG A;  5LJ0 A;  3IHP A;  3LJW A;  3O34 A;  5F25 A;  4CFL A;  2JMD A;  4UYE A;  5BT3 A;  5FE5 A;  1WFK A;  2KWO A;  4MEQ A;  4LYS A;  3O36 A;  5HFQ A;  4NYX A;  4HXL A;  5I83 A;  5ETB A;  2E7N A;  4YY4 A;  5D26 A;  3SVF A;  2BAY A;  3I2D A;  3N9L A;  4OGI A;  4PTB A;  2YEL A;  5ENE A;  5F1H A;  5AMF A;  1X4J A;  1EQF A;  4BW2 A;  2DAT A;  3P1F A;  5C8G A;  4TT4 A;  3MUL A;  1DVP A;  3KV6 A;  4QZS A;  5FG4 A;  1X4I A;  1ZS5 A;  2KWJ A;  4YYD A;  5AIU A;  4O7B A;  4CA1 A;  2GRC A;  4O78 A;  3TLP A;  5LVR A;  3UV5 A;  2LXH C;  4L7X A;  3MQM A;  2YDW A;  2L5U A;  3S92 A;  5DBM A;  5C4Q A;  4QF2 A;  4QR5 A;  1N87 A;  3SOU A;  4UYF B;  4NUE A;  4WHU A;  3SVG A;  4BW4 A;  4R8P K;  2YYN A;  3U5O A;  3PHD A;  5D24 A;  5HM0 A;  2VP7 A;  1N72 A;  2RSD A;  4J1P A;  4MEP A;  5EU1 A;  4NYW A;  2E6S A;  5CP5 A;  2JMJ A;  4BBQ A;  5DFB A;  2AN6 A;  4IOR A;  2R10 A;  3IU6 A;  2WP1 A;  5J0D A;  2VJE B;  5DLX A;  5HRV A;  1WEQ A;  5E74 A;  5C7N A;  4YYJ A;  2F6J A;  4TS8 A;  2Y1M A;  4A4C A;  5FG6 A;  1WEN A;  3U5J A;  5CGP A;  5D1L B;  5DYC A;  2ECV A;  4YYI A;  3MXF A;  2UZG A;  4QR3 A;  5F3A A;  5TDW A;  4CCG X;  3UV2 A;  5KU3 A;  4O7C A;  4UIW A;  5FB0 A;  4PCI A;  2ECT A;  4QSV A;  2EOD A;  3ZPV E;  4MR4 A;  5HLS A;  5TAB A;  4LR6 A;  4BW3 A;  5I29 A;  2CKL A;  5CQ4 A;  2ECN A;  4A9J A;  5IGM A;  5H1T A;  5L8U A;  2L75 A;  4A49 A;  4LYW A;  1HYI A;  5A5R A;  4YY6 A;  5DLZ A;  5L97 A;  5KTW A;  4NR9 A;  4HBV A;  5B75 A;  2E7O A;  4QSQ A;  4YK0 A;  5FE6 A;  3HCU A;  4YAD A;  2DVV A;  5LVQ A;  4J0S A;  2MNY A;  4AKN A;  4TZ2 A;  3IU5 A;  1VD4 A;  5CPE A;  4LAD B;  5EIS A;  1E6I A;  2YRE A;  4UYD A;  4CLB A;  1LDK C;  4GB0 A;  5HQ5 A;  2LGL A;  4O75 A;  5D3J A;  4UIZ A;  5A7C A;  4UYH A;  4QC1 A;  5CQT A;  2KTB B;  2IDA A;  2DVS A;  5CUD A;  5L8T A;  1X4U A;  2EGP A;  4QEW A;  4S3O C;  4NR5 A;  4MSX A;  4LDF A;  4N4I A;  1IYM A;  4NYV A;  2H0D B;  4X3G A;  4TKP B;  2OO1 A;  5B8D A;  1U6G B;  1BOR A;  5EV9 A;  3ZYU A;  5A5P A;  5HFR A;  4NN2 A;  2RI7 A;  5ENJ A;  2DVQ A;  5DIN A;  5C85 A;  2YW8 A;  5FER A;  5I7Y A;  2YHO A;  4YYH A;  3MUK A;  4CL9 A;  2L85 A;  4YBM A;  4IOQ A;  5D3P A;  5FE8 A;  2FUI A;  5LKZ A;  4O64 A;  2RFJ A;  3GG3 A;  2K1J A;  1MM2 A;  2E3K A;  4XUA A;  1WEM A;  2MIQ A;  2VJF A;  4W4U A;  5F5Z A;  5ENC A;  4F52 B;  5I80 A;  5EP7 A;  1VYX A;  5CY9 A;  2K4D A;  5HEL A;  4ZW1 A;  5LKT A;  4UP0 A;  5EWD A;  2RNW A;  4RVR A;  2KR4 A;  5EIC A;  5F61 A;  3ZNI A;  2D9E A;  5CUG A;  4YC9 A;  4O71 A;  5I7X A;  5IGN A;  3QZV A;  2LQ6 A;  5JWM A;  5D1M B;  3LXJ A;  4UP5 A;  4LZ2 A;  5LUU A;  5E3G A;  5H85 A;  4A9L A;  2KWN A;  2HDP A;  4WIV A;  5E3D A;  4TU6 A;  4QC3 A;  4YYN A;  2M6M A;  5F60 A;  4WZ2 A;  1WUM A;  4NS5 A;  4MEO A;  4QR4 A;  3M63 A;  5CQ7 A;  3FL2 A;  3AQA A;  4IR3 A;  4QYD A;  3KQI A;  5EGU A;  5LKX A;  3D7C A;  3G0L A;  5DFC A;  4Z6I A;  4GNF A;  4R7E A;  4A9N A;  3DQV R;  5F62 A;  3M62 A;  5D3S A;  4A9M A;  3QZS A;  5DFD A;  4MR6 A;  5EPB A;  1VFY A;  5E9Y A;  2LXP C;  3SOW A;  5HEM A;  5CUA A;  1V87 A;  2G6Q A;  4QSP A;  5KHM A;  3VK6 A;  4S3O B;  4YBS A;  3EB6 A;  4WZ0 A;  3HCT A;  5EWC A;  2XB1 A;  2HYE D;  2QJ0 A;  5FE0 A;  5E9K A;  4AP4 A;  2KIZ A;  5EYA F;  3O33 A;  1WGM A;  4NR6 A;  2YHN A;  2ECW A;  3HMF A;  2KU3 A;  3U5N A;  4I7D A;  5ENI A;  2F6N A;  5FH6 A;  4HBY A;  2L80 A;  4HXK A;  5DW1 A;  5HJC A;  1WEV A;  5D3L A;  2MT5 A;  2Y1N A;  5DYA A;  5A81 A;  5HQ6 A;  4QST A;  2CT2 A;  3O37 A;  3ZTG A;  2L0B A;  3UV4 A;  1XWH A;  4HXM A;  3O35 A;  3GL6 A;  2RNY A;  3HME A;  2KWK A;  5D3N A;  3N9O A;  4CUU A;  2RNX A;  5EA1 A;  5IGK A;  3P1C A;  5HRW A;  5A85 A;  1ZBD B;  2VJE A;  3G0J A;  5ENH A;  2VPD A;  3V43 A;  4TU4 A;  1WEU A;  5DYX A;  2M85 A;  2YT5 A;  1JM7 A;  5IG6 A;  5ENB A;  4CUQ A;  4IC3 A;  2LDR A;  5F63 A;  2DX8 A;  4WA6 A;  3Q2F A;  4PCE A;  5H1U A;  4B7Y C;  4PY6 A;  4C9Z A;  3JVK A;  4FJC A;  4KV1 A;  1WEE A;  4Z93 A;  4A9F A;  3L1X A;  5G04 B;  2YEK A;  2YSM A;  3RPG C;  2VNF A;  4Q0O A;  4NRA A;  5FBX A;  5EWH A;  5CUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...