5H1TA

Complex structure of trim24 phd-bromodomain and inhibitor 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1tA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1tA01
2L75A 5TRBA 2MJVB 4NS5A 4IR6A 3SVHA 2MT5A 2FSAA 2KGIA 2G43A 2YHNA 5E9LA 5FE7A 3HCSA 3N9OA 3KQIA 4QSWA 5CQ4A 5FE1A 4C67A 2YQLA 4QNSA 5CQ7A 5CUEA 5D3TA 5A5QA 4CCGX 3U5PA 4LZSA 2KFTA 5TDRA 3ZTGA 2Y43A 2FUIA 4A9HA 5D3SA 1MM3A 3ZNIA 4LYWA 4A4CA 4O76A 4O77A 2YELA 5D24A 5LJ0A 4A49A 4J0SA 2ECWA 2QJ0A 5F36A 3VK6A 4YYIA 3HCUA 4J0RA 5CP5A 5DKCA 4NR4A 5A85A 2WP2A 3O33A 1JSPB 4MSXA 3K2JA 5IG6A 2PUYA 2CKLB 2KWKA 4N4HA 5CGPA 5F60A 4A9FA 5HM0A 4XY8A 5D3JA 2VJFA 2DVVA 5LKUA 4YBSA 4HXMA 5DFDA 4AYCB 4E96A 5KU3A 5F1HA 3ASLA 2G45A 4UYGA 5DFCA 4QR3A 2L80A 5C89A 3D7CA 2LGVA 4MR4A 5I88A 1X0JA 5LVRA 2EODA 3T7LA 4UYDA 3UV5A 2LGLA 5L99A 5FBXA 4BJXA 4OUFA 3ONIA 5EGUA 3LQJA 4QB3A 2YQMA 5I3LA 4YYHA 5IGMA 4QSVA 5HENA 1X4IA 3JVKA 5ENFA 4KCXA 4QYDA 2M3HA 4TU6A 3MQMA 5CUAA 3P1FA 2OUOA 5A5OA 5CTLA 5HRVA 3ZYQA 2LQ6A 2E6SA 4RVRA 4WIVA 5FE6A 2D9EA 4UIVA 5I40A 1IYMA 3G0JA 2KWJA 5CUBA 2MNYA 3U5NA 4KV1A 2JRJA 4GNFA 2F6NA 5L8UA 5BT3A 1X4JA 2OO1A 5J3XA 4UP5A 4CURA 5HRXA 5I83A 2M6MA 3KV6A 4FIPA 4TT4A 2YDWA 5EICA 3UVYA 3UVXA 4S3OB 1JM7A 4MR6A 1X4UA 3O36A 2DATA 3L1ZB 5B79A 3FL2A 1CHCA 5D3LA 2DKWA 2GRCA 4OGIA 2YURA 5TB6A 4O74A 3O70A 1WENA 3O7AA 4LKAA 5ENGA 5KH7A 5A5NA 4XI1A 4CUQA 2M1RA 3LQHA 5FH8A 5AD2A 2ECIA 4GNDA 3I2DA 4HXNA 4QUTA 4WZ2A 4QSTA 5G05B 2JMDA 2LXPC 4O70A 5ETBA 4R2YA 4X3GA 5AIUA 1F62A 4PCEA 3PHDA 5COIA 3U5LA 5FH7A 4NYXA 5HEMA 5DY7A 5A7CA 4YYKA 5AMFA 4UYFB 5CUDA 3MUKA 4QC3A 4IORA 5E9YA 3SOWA 5DLXA 5DYXA 1WUGA 5KO4A 4HXKA 5FE8A 2EGPA 4PKLA 2LV9A 4IR5A 1T1HA 4QYLA 2XEUA 5C7NA 5H9MA 4NR6A 4V3LC 2K4DA 4WHUA 5CQ3A 2UZGA 4C66A 4NN2A 1WEOA 1JM4B 2R0VA 5FE2A 4Q0NA 2XB1A 4ZC9A 2KYUA 4GNEA 2G4AA 2LRIC 4YBTA 4Z1QA 4YABA 1BORA 1EQFA 4QSUA 5ENJA 5I80A 5F5ZA 5CRZA 1WEPA 4YAXA 2DWWA 1F68A 2R10A 2KR4A 3L11A 4NQMA 1JM7B 4LYSA 2YT5A 2MA5A 5FE0A 3ZPVE 4O71A 2YHOA 5FFYA 5EPRA 5EWVA 3ZYUA 5I7YA 4NR5A 2R0SA 2DVRA 4YATA 5F25A 4OGJA 2MNZA 3M99A 5FG4A 4HBVA 5DYAA 4QZSA 4I7CA 4LK9A 2MA6A 2KIZA 2LXHC 4LLBA 5L98A 4HBWA 4IR4A 5G0FA 4CUSA 2CT2A 5H1UA 4QSXA 4N4GA 2CSZA 2E7OA 4I7DA 5AMEA 2KREA 4CUPA 2MD7B 5B75A 4QR4A 2F6JA 2YEMA 3LJWA 4KV4A 4X2IA 5G4SA 5L97A 4YYNA 3RPGC 5D7XA 2KU3A 2OXQC 4QEVA 4LC2A 5CQ8A 4LDFA 5F61A 5LKTA 3FKMX 4HBXA 4A0CD 5CQ5A 5A82A 4YY4A 3P1EA 4Z6HA 5B77A 5EP7A 2E7NA 4W4UA 4YADA 5FE5A 3AADA 4NRCA 4QBMA 2C2LA 1V87A 4TS8A 3U5MA 4TU4A 1VFYA 2L5UA 2RNWA 2L43A 3P1CA 4Q0OA 4TYLA 5CY9A 4HBYA 4ALGA 5L8TA 5DKHA 5FERA 4L58A 5F3AA 2FUUA 2QIZA 4QEWA 3MHSA 4B7YC 5E9IA 5ETDA 3P1DA 2CSYA 3N9PA 4O7FA 5E73A 2VNFA 1G25A 4GB0A 5IBNA 3IHPA 5EYAF 4QSQA 3S92A 3PURA 4O7EA 2YU4A 1WEWA 4YYJA 4YBMA 5HQ5A 2DVSA 3HMHA 2R0YA 4LYIA 4PPEA 5B76A 3NXBA 2VJEA 4O78A 5EM3A 4Z1SA 2L84A 5E3DA 4N4IA 5EV9A 4O72A 2RI7A 3JVJA 4YY6A 5CFWA 5JI8A 5K29A 1U6GB 2LGKA 3RCWA 5CS8A 1DVPA 1VD4A 4GNGA 5I7XA 1N87A 1WEQA 4FO9A 2DX8A 5HQ6A 5E0RA 5J0DA 1XWHA 3MB3A 5E3GA 2QICA 2VPDA 2KTBB 4R8PK 2YREA 5AITA 5F62A 4BW4A 5D0CA 3T6RA 5FFVA 3ZVYA 4LR6A 1K2FA 5CU8A 5JG6A 5D3PA 4HXLA 4HXSA 5LKZA 5E9MA 4UP0A 2I7KA 2VJFB 4YYDA 3C6WA 5D1MB 2H0DA 4MEPA 4CUUA 2M85A 4CFKA 3HMFA 4YC9A 1N72A 5A5RA 5LKXA 4QSPA 2VPGA 3LRQA 2YYNA 4O7CA 5A83A 3MB4A 4B86C 5CUCA 2L0BA 4MR5A 5DINA 1Z6UA 5D25A 2WP1A 4A9EA 1FBVA 1JOCA 4BW1A 4J1PA 5A5SA 4UIYA 4GPJA 2LDRA 5EPSA 2YQDA 2K1JA 4LJNA 5D1KB 5HQ7A 3GV4A 2ECVA 5BT5A 2MD8C 3P5OA 5F1LA 2MIQA 2I8NA 3MULA 4C9ZA 4QF3A 2KGGA 4NR9A 3SVGA 2IDAA 4NR7A 5FFWA 5DW2A 1LDJB 4WZ3B 5D3NA 4UI9B 3ZPV1 2K17A 1Z60A 4YH4A 3JVLA 5TBNA 5C87A 5LVQA 5CQTA 4CFLA 4FJCA 4NQNA 3EB5A 4BW3A 4FLPA 3AQAA 5FG6A 2ECTA 5D1LB 5I89A 5DW1A 2JMJA 2ECGA 5G04B 5HELA 1Z2QA 2N9GA 2JMIA 5C13A 3LQIA 5B8DA 2RO1A 4MEOA 2Y1NA 5FG5A 4ZDTA 1WGMA 2G6QA 3N9NA 4QC1A 4QEUA 2RNXA 3DQVR 4YYGA 5EQ1A 3I3JA 4N4FA 5FE3A 5CQ6A 4O7BA 5EA1A 5FDZA 2LGGA 3GL6A 2K16A 4MEQA 2H0DB 2RFJA 5EI4A 4N3WA 5E9VA 4A9JA 5LCWB 4YYMA 5BT4A 5EWCA 3QZVA 4LZ2A 5HFRA 5F2PA 1ZBDB 4MR3A 2D8SA 5E7DA 4TTEA 1WIMA 3DWYA 2ECJA 4F52B 5HFQA 2MUMA 3N9MA 4S3OC 5ENBA 1E6IA 4TT2A 5KH3A 5C11A 2NAAA 4NRBA 4IC2A 5KH9A 4AUQB 4LZRA 2PNXA 4NRAA 2F42A 1WESA 2VP7A 4HXPA 5EPBA 4Q6FA 3SVFA 5FEYA 3LXJA 5C85A 5A5PA 4IOQA 2I50A 2ECNA 4A9KA 3JVMA 5TCMA 1HYJA 2YW5A 1WEVA 5TDWA 5I1QA 5B78A 1WILA 5C8GA 4HXRA 5HJCA 5HRWA 1E4UA 3NG2A 4QSRA 3G0LA 2YYRA 2ZETC 3L1XA 5EU1A 5L96A 1VYXA 3UV2A 4QSSA 2RSDA 4AP4A 5DYCA 4TKPB 5DKDA 5EISA 3UW9A 5EWHA 5EVAA 2VPBA 3Q2FA 4AKNA 4ZW1A 2C2VS 4LADB 4IOOA 5I86A 5CQAA 2RS9B 5HLSA 2BAYA 4YH3A 3QZTA 5ACYA 1WUMA 3S91A 4TT6A 5KTXA 5FE9A 4Y03A 3HMEA 4NUEA 4A9LA 1HYIA 4ZQLA 2H60A 5A81A 2LSPB 5CZGA 3Q2EA 3EB6A 4I7BA 2YEKA 5DYUA 5KTWA 3O34A 5IGNA 4A9NA 4AVXA 4UYFA 5ENEA 5DBMA 5IIDA 2L85A 5DFBA 5E74A 4IC3A 4XUAA 4NYVA 3QZSA 4PY6A 3SOXA 2YSJA 4L7XA 4QR5A 4NYWA 4PS5A 4ZUXU 4UYEA 5DLZA 4NUCA 5CUGA 1FP0A 5II2A 3N9QA 4UITA 5KTUA 3SOUA 5LJ1A 4CA1A 4XY9A 5JWMA 4QF2A 5IGLA 4V3KC 4YK0A 4MENA 5D3HA 2KWNA 4XYAA 4BBQA 3U5KA 4TQNA 5CPEA 5ENCA 3DPLR 2YUCA 4QUUA 4BHWA 4O64A 3U5OA 3KNVA 4UIWA 5D26A 5EWDA 3DAIA 5EWWA 1LDKC 2YW8A 1WFKA 3IU6A 4P5OB 4Z93A 4ALHA 3RPGB 1ZS5A 3UVWA 2HDPA 4BW2A 4TZ8A 5I29A 4CL9A 5E9KA 4QY4A 5FE4A 5IGKA 5FB1A 1WEUA 2YSMA 3TLPA 4WZ0A 4MVTA 4TZ2A 4UYHA 4CUTA 1WE9A 3RTRB 4R7EA 3SHBA 5EK9A 1RMDA 2VPEA 2NXBA 3N9LA 3M62A 3UVDA 3GG3A 4Z6IA 4WHWA 4F3IA 3V43A 4O75A 2D82A 4J3IA 2VJEB 5II1A 4A9IA 4WA6A 5HCLA 4CLBA 5G4RA 5DKAA 5KHMA 2CKLA 3HCTA 2Y1MA 4XUBA 4FK5A 2EA6A 5FB0A 1WEEA 3MXFA 4NXJA 5ENIA 2E6RA 3HTKC 3ZVZB 2KE1A 4PTBA 2AN6A 3PUQA 4UIZA 4A9MA 5CRMA 5LUUA 1WEMA 4UIXA 5TABA 3O37A 5ENHA 4AYCA 5D3RA 1MM2A 4IR3A 3KV5A 5FH6A 2L5EA 5LJ2A 3O35A 4O7AA 5AD3A 4DONA 5C4QA 3M63A 2OSSA 3C5KA 4PCIA 4A9OA 5F63A 2KWOA 3MHHA 4LRGA 4A4BA 4UIUA 2LN0A 5H85A 2HYED 3U5JA 5DX4A 4NUDA 5H1TA 4NR8A 4HXOA 5H1VA 2DVQA 3IU5A 3UV4A 2E3KA 2RNYA
chains in the Genus database with same CATH superfamily
2L75A 5TRBA 2MJVB 4NS5A 4IR6A 3SVHA 2MT5A 2FSAA 2KGIA 2G43A 2YHNA 5E9LA 5FE7A 3HCSA 3N9OA 3KQIA 4QSWA 5CQ4A 5FE1A 1PUOA 4C67A 2YQLA 4QNSA 5CQ7A 5CUEA 5D3TA 5A5QA 4CCGX 3U5PA 4LZSA 2KFTA 5TDRA 3ZTGA 2Y43A 2FUIA 4A9HA 5D3SA 1MM3A 3ZNIA 4LYWA 4A4CA 4O76A 4O77A 2YELA 5D24A 5LJ0A 4A49A 4J0SA 2ECWA 2QJ0A 5F36A 3VK6A 1DCQA 4YYIA 3HCUA 4J0RA 5CP5A 5DKCA 4NR4A 5A85A 2WP2A 3O33A 1JSPB 4MSXA 3K2JA 5IG6A 2PUYA 2CKLB 2KWKA 4N4HA 5CGPA 5F60A 4A9FA 5HM0A 4XY8A 5D3JA 2VJFA 2DVVA 5LKUA 4YBSA 4HXMA 5DFDA 4AYCB 4E96A 5KU3A 5F1HA 3ASLA 2G45A 4UYGA 5DFCA 4QR3A 2L80A 5C89A 3D7CA 2LGVA 4MR4A 5I88A 1X0JA 5LVRA 2EODA 3T7LA 4UYDA 3UV5A 2LGLA 5L99A 5FBXA 4BJXA 4OUFA 3ONIA 5EGUA 3LQJA 4QB3A 2YQMA 5I3LA 4YYHA 5IGMA 4QSVA 5HENA 1X4IA 3JVKA 3LDYA 5ENFA 4KCXA 4QYDA 2M3HA 4TU6A 3MQMA 5CUAA 3P1FA 2OUOA 5A5OA 5CTLA 5HRVA 4OGCA 2CONA 3ZYQA 2KKXA 2LQ6A 2E6SA 4RVRA 4WIVA 5FE6A 2D9EA 4UIVA 5I40A 1IYMA 3G0JA 2KWJA 5CUBA 2MNYA 3U5NA 4KV1A 2JRJA 3LJUX 4GNFA 2F6NA 5L8UA 5BT3A 2CSVA 1X4JA 2OO1A 5J3XA 4UP5A 4CURA 5HRXA 5I83A 2M6MA 3KV6A 4FIPA 4TT4A 2YDWA 5EICA 3UVYA 3UVXA 4S3OB 1JM7A 4MR6A 1X4UA 3O36A 2DATA 2EGMA 3L1ZB 5B79A 3FL2A 1CHCA 5D3LA 2DKWA 2GRCA 4OGIA 2YURA 5TB6A 4O74A 3O70A 1WENA 3O7AA 4LKAA 5ENGA 5KH7A 5A5NA 4XI1A 4CUQA 1MBMA 2M1RA 3LQHA 5FH8A 5AD2A 2ECIA 4GNDA 3O47A 3I2DA 4HXNA 4QUTA 2MKEA 4WZ2A 4QSTA 5G05B 2JMDA 2LXPC 4O70A 5ETBA 2YVRA 4R2YA 4X3GA 5AIUA 1F62A 4PCEA 3PHDA 5COIA 3U5LA 5FH7A 4NYXA 3Q1DA 5HEMA 5DY7A 5A7CA 4YYKA 5AMFA 4UYFB 3FAOA 5CUDA 3MUKA 3DDTA 4QC3A 4IORA 5E9YA 3SOWA 5DLXA 5DYXA 1WUGA 5KO4A 4HXKA 5FE8A 2EGPA 4PKLA 2LV9A 4IR5A 1T1HA 2RR4A 4QYLA 2XEUA 5C7NA 5H9MA 4NR6A 4V3LC 3LVQE 5SVIB 2K4DA 4WHUA 5CQ3A 2UZGA 4C66A 4NN2A 1WEOA 1JM4B 2R0VA 5FE2A 4Q0NA 2XB1A 4ZC9A 2DSMA 2KYUA 4GNEA 2G4AA 2LRIC 4YBTA 4Z1QA 4YABA 1BORA 1EQFA 4QSUA 5ENJA 5I80A 5F5ZA 5CRZA 5SVYA 1WEPA 4YAXA 2DWWA 1F68A 2R10A 2KR4A 3L11A 4NQMA 4Z0OA 4LYSA 2YT5A 1JM7B 2MA5A 5FE0A 3ZPVE 4O71A 2YHOA 5FFYA 5EPRA 5EWVA 3ZYUA 5I7YA 4NR5A 2R0SA 2DVRA 4YATA 5F25A 4OGJA 2MNZA 3M99A 5FG4A 4HBVA 5DYAA 4QZSA 4I7CA 4LK9A 2MA6A 2KIZA 2LXHC 4LLBA 5L98A 4HBWA 4IR4A 5G0FA 4CUSA 2CT2A 2LAUA 5H1UA 4QSXA 4N4GA 2CSZA 2E7OA 2M13A 5AMEA 2KREA 2XOYA 4I7DA 4CUPA 2MD7B 5B75A 4QR4A 2F6JA 2YEMA 3LJWA 4KV4A 4X2IA 5G4SA 5L97A 4YYNA 2EXUA 3RPGC 5D7XA 3FM8C 2KU3A 2OXQC 4QEVA 4LC2A 5CQ8A 4LDFA 5F61A 5LKTA 3FKMX 4HBXA 4A0CD 5CQ5A 5A82A 4YY4A 3P1EA 4Z6HA 5B77A 5EP7A 2E7NA 4W4UA 4YADA 4AKHA 5FE5A 3FJUB 3AADA 4NRCA 4QBMA 2C2LA 1V87A 3T9KA 4TS8A 3U5MA 4TU4A 1VFYA 2L5UA 2RNWA 2L7PA 2L43A 3P1CA 4Q0OA 4TYLA 5CY9A 4HBYA 4ALGA 5L8TA 5DKHA 5FERA 4L58A 5F3AA 2FUUA 2QIZA 4QEWA 2B0OE 3MHSA 4B7YC 5E9IA 5ETDA 3P1DA 2CSYA 3N9PA 4O7FA 5E73A 2VNFA 1G25A 4GB0A 5IBNA 3IHPA 5EYAF 4QSQA 3S92A 3PURA 4O7EA 2YU4A 1WEWA 4YYJA 4YBMA 5HQ5A 2DVSA 3HMHA 2R0YA 4LYIA 4PPEA 4OGEA 3D1DA 5B76A 3NXBA 5K3QA 2VJEA 4O78A 5EM3A 4Z1SA 2L84A 5E3DA 4N4IA 5EV9A 4O72A 2RI7A 3JVJA 4YY6A 5CFWA 5JI8A 5K29A 1U6GB 2LGKA 3RCWA 5CS8A 1DVPA 1VD4A 4GNGA 5I7XA 1N87A 1WEQA 4FO9A 2DX8A 5HQ6A 5E0RA 5J0DA 1XWHA 3MB3A 5E3GA 2QICA 2VPDA 2KTBB 2XOCA 2YREA 2IQJA 5AITA 4R8PK 5F62A 4BW4A 5D0CA 3T6RA 5FFVA 3ZVYA 4LR6A 1K2FA 5CU8A 5JG6A 5D3PA 4HXLA 4HXSA 5LKZA 5E9MA 4UP0A 2I7KA 2VJFB 4YYDA 4QQ4A 3C6WA 5D1MB 2H0DA 4MEPA 4CUUA 2M85A 4CFKA 3HMFA 4YC9A 1N72A 5A5RA 5LKXA 4QSPA 2VPGA 3LRQA 2YYNA 4O7CA 3SUBA 5A83A 3MB4A 4B86C 5CUCA 2L0BA 4MR5A 5DINA 1Z6UA 5D25A 3MDBC 2WP1A 2XOZA 4A9EA 1FBVA 1JOCA 2KKYA 4BW1A 4J1PA 5A5SA 4UIYA 3VKHA 4GPJA 2LDRA 5EPSA 2YQDA 2K1JA 4LJNA 5D1KB 5HQ7A 3GV4A 2ECVA 5BT5A 2MD8C 3P5OA 5F1LA 2MIQA 2I8NA 3MULA 4C9ZA 4QF3A 2KGGA 4NR9A 3SVGA 2IDAA 4NR7A 5FFWA 5DW2A 1LDJB 4WZ3B 5D3NA 4UI9B 3ZPV1 2K17A 1Z60A 4YH4A 3JVLA 5TBNA 5C87A 5LVQA 5CQTA 4CFLA 4FJCA 4NQNA 3EB5A 4BW3A 2CRWA 4FLPA 3AQAA 5FG6A 2ECTA 5D1LB 5I89A 5DW1A 2JMJA 2ECGA 5G04B 5HELA 1Z2QA 2N9GA 2JMIA 5C13A 3LQIA 5B8DA 2RO1A 4MEOA 2Y1NA 5FG5A 4ZDTA 1WGMA 2G6QA 3N9NA 4QC1A 3JUEA 4QEUA 2RNXA 3DQVR 4YYGA 5EQ1A 3I3JA 4N4FA 5FE3A 2E61A 5CQ6A 4O7BA 5EA1A 5FDZA 2FFWA 2LGGA 2K16A 4MEQA 3GL6A 2H0DB 4Z0RA 2RFJA 5EI4A 4N3WA 5E9VA 4A9JA 5LCWB 4YYMA 2EJNA 5BT4A 5EWCA 3QZVA 4LZ2A 5HFRA 5F2PA 1ZBDB 4MR3A 2D8SA 5E7DA 3FANA 4TTEA 1WIMA 3DWYA 2ECJA 4F52B 5HFQA 2MUMA 3N9MA 4S3OC 5ENBA 1E6IA 4TT2A 5KH3A 5C11A 2NAAA 4NRBA 4IC2A 5KH9A 4AUQB 4LZRA 2PNXA 4NRAA 2F42A 1WESA 2VP7A 4HXPA 5EPBA 4Q6FA 3SVFA 5FEYA 3LXJA 5C85A 5A5PA 3VKGA 4IOQA 2I50A 2ECNA 4A9KA 3JVMA 5TCMA 1HYJA 2YW5A 1WEVA 5TDWA 2D8UA 5I1QA 2JUNA 4AI6A 5B78A 1WILA 5C8GA 3DWDA 4HXRA 5HJCA 5HRWA 1E4UA 3NG2A 4QSRA 3G0LA 2YYRA 2ZETC 3L1XA 5EU1A 5L96A 1VYXA 3UV2A 4QSSA 2RSDA 4AP4A 5DYCA 4TKPB 5DKDA 5EISA 3UW9A 5EWHA 5EVAA 2VPBA 3Q2FA 4AKNA 4ZW1A 2C2VS 4LADB 4IOOA 5I86A 5CQAA 2RS9B 5HLSA 2BAYA 1ZKRA 4YH3A 3QZTA 5ACYA 1WUMA 3M7KA 3S91A 4TT6A 5KTXA 5FE9A 4Y03A 4H9DA 3HMEA 4NUEA 4A9LA 2OWAA 4ZQLA 1HYIA 2H60A 5A81A 2LSPB 5CZGA 3Q2EA 3EB6A 4I7BA 2YEKA 5DYUA 5KTWA 3O34A 5IGNA 4A9NA 3PLWA 4AVXA 4UYFA 5ENEA 5DBMA 5IIDA 2L85A 5DFBA 5E74A 4IC3A 4XUAA 4NYVA 2JM3A 3QZSA 4PY6A 3SOXA 2YSJA 4L7XA 4QR5A 4NYWA 4PS5A 4O62A 5SVXA 4ZUXU 4UYEA 5DLZA 4NUCA 5CUGA 1FP0A 5II2A 3N9QA 5SVIA 4UITA 5KTUA 3SOUA 5LJ1A 4CA1A 4XY9A 5JWMA 4QF2A 5IGLA 4V3KC 4YK0A 4MENA 5D3HA 2KWNA 4XYAA 4BBQA 3U5KA 4TQNA 5CPEA 5ENCA 3DPLR 2YUCA 4QUUA 4BHWA 2DJAA 4O64A 3U5OA 3KNVA 4UIWA 5D26A 2FD4A 5EWDA 3DAIA 5EWWA 1LDKC 2YW8A 1WFKA 3IU6A 3ERRA 4P5OB 4Z93A 3D1BA 4ALHA 3LVRE 3RPGB 1ZS5A 3UVWA 2HDPA 4BW2A 4TZ8A 5I29A 4CL9A 5E9KA 4QY4A 5FE4A 5IGKA 5FB1A 4AKIA 4AKGA 1WEUA 2YSMA 4F1PA 3TLPA 4WZ0A 4MVTA 4TZ2A 4UYHA 4CUTA 1WE9A 3RTRB 4R7EA 3SHBA 5EK9A 2XP0A 1RMDA 2VPEA 2NXBA 3N9LA 3M62A 3UVDA 3GG3A 4Z6IA 4WHWA 4F3IA 3V43A 4O75A 3H7HA 2D82A 4J3IA 2VJEB 3E2DA 5II1A 4A9IA 4WA6A 5HCLA 4CLBA 5G4RA 5DKAA 5KHMA 2CKLA 3HCTA 2P57A 2Y1MA 4XUBA 4FK5A 2EA6A 5FB0A 1WEEA 3MXFA 4NXJA 5ENIA 2E6RA 3HTKC 3ZVZB 2KE1A 4PTBA 2AN6A 3PUQA 4UIZA 4A9MA 5CRMA 5LUUA 1WEMA 4UIXA 5TABA 3O37A 5ENHA 4AYCA 5D3RA 1MM2A 2CRRA 4IR3A 3KV5A 5FH6A 2L5EA 5LJ2A 3O35A 3FEHA 4O7AA 5AD3A 4DONA 5C4QA 3M63A 2OSSA 3C5KA 4PCIA 4A9OA 5F63A 2KWOA 3MHHA 4LRGA 4A4BA 4UIUA 2LN0A 5H85A 2HYED 3U5JA 5DX4A 4NUDA 5H1TA 4NR8A 4HXOA 5H1VA 3KDEC 2DVQA 3IU5A 3UV4A 2E3KA 2RNYA
chains in the Genus database with same CATH topology
2L75A 5TRBA 2MJVB 4NS5A 4IR6A 3SVHA 2MT5A 2FSAA 2KGIA 2G43A 2YHNA 5E9LA 5FE7A 3HCSA 3N9OA 3KQIA 4QSWA 5CQ4A 5FE1A 4C67A 2YQLA 4QNSA 5CQ7A 5CUEA 5D3TA 5A5QA 4CCGX 3U5PA 4LZSA 2KFTA 5TDRA 3ZTGA 2Y43A 2FUIA 4A9HA 5D3SA 1MM3A 3ZNIA 4LYWA 4A4CA 4O76A 4O77A 2YELA 5D24A 5LJ0A 4A49A 4J0SA 2ECWA 2QJ0A 5F36A 3VK6A 4YYIA 3HCUA 4J0RA 5CP5A 5DKCA 4NR4A 5A85A 2WP2A 3O33A 1JSPB 4MSXA 3K2JA 5IG6A 2PUYA 2CKLB 2KWKA 4N4HA 5CGPA 5F60A 4A9FA 5HM0A 4XY8A 5D3JA 2VJFA 2DVVA 5LKUA 4YBSA 4HXMA 5DFDA 4AYCB 4E96A 5KU3A 5F1HA 3ASLA 2G45A 4UYGA 5DFCA 4QR3A 2L80A 5C89A 3D7CA 2LGVA 4MR4A 5I88A 1X0JA 5LVRA 2EODA 3T7LA 4UYDA 3UV5A 2LGLA 5L99A 5FBXA 4BJXA 4OUFA 3ONIA 5EGUA 3LQJA 4QB3A 2YQMA 5I3LA 4YYHA 5IGMA 4QSVA 5HENA 1X4IA 3JVKA 5ENFA 4KCXA 4QYDA 2M3HA 4TU6A 3MQMA 5CUAA 3P1FA 2OUOA 5A5OA 5CTLA 5HRVA 3ZYQA 2LQ6A 2E6SA 4RVRA 4WIVA 5FE6A 2D9EA 4UIVA 5I40A 1IYMA 3G0JA 2KWJA 5CUBA 2MNYA 3U5NA 4KV1A 2JRJA 4GNFA 2F6NA 5L8UA 5BT3A 1X4JA 2OO1A 5J3XA 4UP5A 4CURA 5HRXA 5I83A 2M6MA 3KV6A 4FIPA 4TT4A 2YDWA 5EICA 3UVYA 3UVXA 4S3OB 1JM7A 4MR6A 1X4UA 3O36A 2DATA 3L1ZB 5B79A 3FL2A 1CHCA 5D3LA 2DKWA 2GRCA 4OGIA 2YURA 5TB6A 4O74A 3O70A 1WENA 3O7AA 4LKAA 5ENGA 5KH7A 5A5NA 4XI1A 4CUQA 2M1RA 3LQHA 5FH8A 5AD2A 2ECIA 4GNDA 3I2DA 4HXNA 4QUTA 4WZ2A 4QSTA 5G05B 2JMDA 2LXPC 4O70A 5ETBA 4R2YA 4X3GA 5AIUA 1F62A 4PCEA 3PHDA 5COIA 3U5LA 5FH7A 4NYXA 5HEMA 5DY7A 5A7CA 4YYKA 5AMFA 4UYFB 5CUDA 3MUKA 4QC3A 4IORA 5E9YA 3SOWA 5DLXA 5DYXA 1WUGA 5KO4A 4HXKA 5FE8A 2EGPA 4PKLA 2LV9A 4IR5A 1T1HA 4QYLA 2XEUA 5C7NA 5H9MA 4NR6A 4V3LC 2K4DA 4WHUA 5CQ3A 2UZGA 4C66A 4NN2A 1WEOA 1JM4B 2R0VA 5FE2A 4Q0NA 2XB1A 4ZC9A 2KYUA 4GNEA 2G4AA 2LRIC 4YBTA 4Z1QA 4YABA 1BORA 1EQFA 4QSUA 5ENJA 5I80A 5F5ZA 5CRZA 1WEPA 4YAXA 2DWWA 1F68A 2R10A 2KR4A 3L11A 4NQMA 1JM7B 4LYSA 2YT5A 2MA5A 5FE0A 3ZPVE 4O71A 2YHOA 5FFYA 5EPRA 5EWVA 3ZYUA 5I7YA 4NR5A 2R0SA 2DVRA 4YATA 5F25A 4OGJA 2MNZA 3M99A 5FG4A 4HBVA 5DYAA 4QZSA 4I7CA 4LK9A 2MA6A 2KIZA 2LXHC 4LLBA 5L98A 4HBWA 4IR4A 5G0FA 4CUSA 2CT2A 5H1UA 4QSXA 4N4GA 2CSZA 2E7OA 4I7DA 5AMEA 2KREA 4CUPA 2MD7B 5B75A 4QR4A 2F6JA 2YEMA 3LJWA 4KV4A 4X2IA 5G4SA 5L97A 4YYNA 3RPGC 5D7XA 2KU3A 2OXQC 4QEVA 4LC2A 5CQ8A 4LDFA 5F61A 5LKTA 3FKMX 4HBXA 4A0CD 5CQ5A 5A82A 4YY4A 3P1EA 4Z6HA 5B77A 5EP7A 2E7NA 4W4UA 4YADA 5FE5A 3AADA 4NRCA 4QBMA 2C2LA 1V87A 4TS8A 3U5MA 4TU4A 1VFYA 2L5UA 2RNWA 2L43A 3P1CA 4Q0OA 4TYLA 5CY9A 4HBYA 4ALGA 5L8TA 5DKHA 5FERA 4L58A 5F3AA 2FUUA 2QIZA 4QEWA 3MHSA 4B7YC 5E9IA 5ETDA 3P1DA 2CSYA 3N9PA 4O7FA 5E73A 2VNFA 1G25A 4GB0A 5IBNA 3IHPA 5EYAF 4QSQA 3S92A 3PURA 4O7EA 2YU4A 1WEWA 4YYJA 4YBMA 5HQ5A 2DVSA 3HMHA 2R0YA 4LYIA 4PPEA 5B76A 3NXBA 2VJEA 4O78A 5EM3A 4Z1SA 2L84A 5E3DA 4N4IA 5EV9A 4O72A 2RI7A 3JVJA 4YY6A 5CFWA 5JI8A 5K29A 1U6GB 2LGKA 3RCWA 5CS8A 1DVPA 1VD4A 4GNGA 5I7XA 1N87A 1WEQA 4FO9A 2DX8A 5HQ6A 5E0RA 5J0DA 1XWHA 3MB3A 5E3GA 2QICA 2VPDA 2KTBB 4R8PK 2YREA 5AITA 5F62A 4BW4A 5D0CA 3T6RA 5FFVA 3ZVYA 4LR6A 1K2FA 5CU8A 5JG6A 5D3PA 4HXLA 4HXSA 5LKZA 5E9MA 4UP0A 2I7KA 2VJFB 4YYDA 3C6WA 5D1MB 2H0DA 4MEPA 4CUUA 2M85A 4CFKA 3HMFA 4YC9A 1N72A 5A5RA 5LKXA 4QSPA 2VPGA 3LRQA 2YYNA 4O7CA 5A83A 3MB4A 4B86C 5CUCA 2L0BA 4MR5A 5DINA 1Z6UA 5D25A 2WP1A 4A9EA 1FBVA 1JOCA 4BW1A 4J1PA 5A5SA 4UIYA 4GPJA 2LDRA 5EPSA 2YQDA 2K1JA 4LJNA 5D1KB 5HQ7A 3GV4A 2ECVA 5BT5A 2MD8C 3P5OA 5F1LA 2MIQA 2I8NA 3MULA 4C9ZA 4QF3A 2KGGA 4NR9A 3SVGA 2IDAA 4NR7A 5FFWA 5DW2A 1LDJB 4WZ3B 5D3NA 4UI9B 3ZPV1 2K17A 1Z60A 4YH4A 3JVLA 5TBNA 5C87A 5LVQA 5CQTA 4CFLA 4FJCA 4NQNA 3EB5A 4BW3A 4FLPA 3AQAA 5FG6A 2ECTA 5D1LB 5I89A 5DW1A 2JMJA 2ECGA 5G04B 5HELA 1Z2QA 2N9GA 2JMIA 5C13A 3LQIA 5B8DA 2RO1A 4MEOA 2Y1NA 5FG5A 4ZDTA 1WGMA 2G6QA 3N9NA 4QC1A 4QEUA 2RNXA 3DQVR 4YYGA 5EQ1A 3I3JA 4N4FA 5FE3A 5CQ6A 4O7BA 5EA1A 5FDZA 2LGGA 3GL6A 2K16A 4MEQA 2H0DB 2RFJA 5EI4A 4N3WA 5E9VA 4A9JA 5LCWB 4YYMA 5BT4A 5EWCA 3QZVA 4LZ2A 5HFRA 5F2PA 1ZBDB 4MR3A 2D8SA 5E7DA 4TTEA 1WIMA 3DWYA 2ECJA 4F52B 5HFQA 2MUMA 3N9MA 4S3OC 5ENBA 1E6IA 4TT2A 5KH3A 5C11A 2NAAA 4NRBA 4IC2A 5KH9A 4AUQB 4LZRA 2PNXA 4NRAA 2F42A 1WESA 2VP7A 4HXPA 5EPBA 4Q6FA 3SVFA 5FEYA 3LXJA 5C85A 5A5PA 4IOQA 2I50A 2ECNA 4A9KA 3JVMA 5TCMA 1HYJA 2YW5A 1WEVA 5TDWA 5I1QA 5B78A 1WILA 5C8GA 4HXRA 5HJCA 5HRWA 1E4UA 3NG2A 4QSRA 3G0LA 2YYRA 2ZETC 3L1XA 5EU1A 5L96A 1VYXA 3UV2A 4QSSA 2RSDA 4AP4A 5DYCA 4TKPB 5DKDA 5EISA 3UW9A 5EWHA 5EVAA 2VPBA 3Q2FA 4AKNA 4ZW1A 2C2VS 4LADB 4IOOA 5I86A 5CQAA 2RS9B 5HLSA 2BAYA 4YH3A 3QZTA 5ACYA 1WUMA 3S91A 4TT6A 5KTXA 5FE9A 4Y03A 3HMEA 4NUEA 4A9LA 1HYIA 4ZQLA 2H60A 5A81A 2LSPB 5CZGA 3Q2EA 3EB6A 4I7BA 2YEKA 5DYUA 5KTWA 3O34A 5IGNA 4A9NA 4AVXA 4UYFA 5ENEA 5DBMA 5IIDA 2L85A 5DFBA 5E74A 4IC3A 4XUAA 4NYVA 3QZSA 4PY6A 3SOXA 2YSJA 4L7XA 4QR5A 4NYWA 4PS5A 4ZUXU 4UYEA 5DLZA 4NUCA 5CUGA 1FP0A 5II2A 3N9QA 4UITA 5KTUA 3SOUA 5LJ1A 4CA1A 4XY9A 5JWMA 4QF2A 5IGLA 4V3KC 4YK0A 4MENA 5D3HA 2KWNA 4XYAA 4BBQA 3U5KA 4TQNA 5CPEA 5ENCA 3DPLR 2YUCA 4QUUA 4BHWA 4O64A 3U5OA 3KNVA 4UIWA 5D26A 5EWDA 3DAIA 5EWWA 1LDKC 2YW8A 1WFKA 3IU6A 4P5OB 4Z93A 4ALHA 3RPGB 1ZS5A 3UVWA 2HDPA 4BW2A 4TZ8A 5I29A 4CL9A 5E9KA 4QY4A 5FE4A 5IGKA 5FB1A 1WEUA 2YSMA 3TLPA 4WZ0A 4MVTA 4TZ2A 4UYHA 4CUTA 1WE9A 3RTRB 4R7EA 3SHBA 5EK9A 1RMDA 2VPEA 2NXBA 3N9LA 3M62A 3UVDA 3GG3A 4Z6IA 4WHWA 4F3IA 3V43A 4O75A 2D82A 4J3IA 2VJEB 5II1A 4A9IA 4WA6A 5HCLA 4CLBA 5G4RA 5DKAA 5KHMA 2CKLA 3HCTA 2Y1MA 4XUBA 4FK5A 2EA6A 5FB0A 1WEEA 3MXFA 4NXJA 5ENIA 2E6RA 3HTKC 3ZVZB 2KE1A 4PTBA 2AN6A 3PUQA 4UIZA 4A9MA 5CRMA 5LUUA 1WEMA 4UIXA 5TABA 3O37A 5ENHA 4AYCA 5D3RA 1MM2A 4IR3A 3KV5A 5FH6A 2L5EA 5LJ2A 3O35A 4O7AA 5AD3A 4DONA 5C4QA 3M63A 2OSSA 3C5KA 4PCIA 4A9OA 5F63A 2KWOA 3MHHA 4LRGA 4A4BA 4UIUA 2LN0A 5H85A 2HYED 3U5JA 5DX4A 4NUDA 5H1TA 4NR8A 4HXOA 5H1VA 2DVQA 3IU5A 3UV4A 2E3KA 2RNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L75 A;  5TRB A;  2MJV B;  4NS5 A;  4IR6 A;  3SVH A;  2MT5 A;  2FSA A;  2KGI A;  2G43 A;  2YHN A;  5E9L A;  5FE7 A;  3HCS A;  3N9O A;  3KQI A;  4QSW A;  5CQ4 A;  5FE1 A;  4C67 A;  2YQL A;  4QNS A;  5CQ7 A;  5CUE A;  5D3T A;  5A5Q A;  4CCG X;  3U5P A;  4LZS A;  2KFT A;  5TDR A;  3ZTG A;  2Y43 A;  2FUI A;  4A9H A;  5D3S A;  1MM3 A;  3ZNI A;  4LYW A;  4A4C A;  4O76 A;  4O77 A;  2YEL A;  5D24 A;  5LJ0 A;  4A49 A;  4J0S A;  2ECW A;  2QJ0 A;  5F36 A;  3VK6 A;  4YYI A;  3HCU A;  4J0R A;  5CP5 A;  5DKC A;  4NR4 A;  5A85 A;  2WP2 A;  3O33 A;  1JSP B;  4MSX A;  3K2J A;  5IG6 A;  2PUY A;  2CKL B;  2KWK A;  4N4H A;  5CGP A;  5F60 A;  4A9F A;  5HM0 A;  4XY8 A;  5D3J A;  2VJF A;  2DVV A;  5LKU A;  4YBS A;  4HXM A;  5DFD A;  4AYC B;  4E96 A;  5KU3 A;  5F1H A;  3ASL A;  2G45 A;  4UYG A;  5DFC A;  4QR3 A;  2L80 A;  5C89 A;  3D7C A;  2LGV A;  4MR4 A;  5I88 A;  1X0J A;  5LVR A;  2EOD A;  3T7L A;  4UYD A;  3UV5 A;  2LGL A;  5L99 A;  5FBX A;  4BJX A;  4OUF A;  3ONI A;  5EGU A;  3LQJ A;  4QB3 A;  2YQM A;  5I3L A;  4YYH A;  5IGM A;  4QSV A;  5HEN A;  1X4I A;  3JVK A;  5ENF A;  4KCX A;  4QYD A;  2M3H A;  4TU6 A;  3MQM A;  5CUA A;  3P1F A;  2OUO A;  5A5O A;  5CTL A;  5HRV A;  3ZYQ A;  2LQ6 A;  2E6S A;  4RVR A;  4WIV A;  5FE6 A;  2D9E A;  4UIV A;  5I40 A;  1IYM A;  3G0J A;  2KWJ A;  5CUB A;  2MNY A;  3U5N A;  4KV1 A;  2JRJ A;  4GNF A;  2F6N A;  5L8U A;  5BT3 A;  1X4J A;  2OO1 A;  5J3X A;  4UP5 A;  4CUR A;  5HRX A;  5I83 A;  2M6M A;  3KV6 A;  4FIP A;  4TT4 A;  2YDW A;  5EIC A;  3UVY A;  3UVX A;  4S3O B;  1JM7 A;  4MR6 A;  1X4U A;  3O36 A;  2DAT A;  3L1Z B;  5B79 A;  3FL2 A;  1CHC A;  5D3L A;  2DKW A;  2GRC A;  4OGI A;  2YUR A;  5TB6 A;  4O74 A;  3O70 A;  1WEN A;  3O7A A;  4LKA A;  5ENG A;  5KH7 A;  5A5N A;  4XI1 A;  4CUQ A;  2M1R A;  3LQH A;  5FH8 A;  5AD2 A;  2ECI A;  4GND A;  3I2D A;  4HXN A;  4QUT A;  4WZ2 A;  4QST A;  5G05 B;  2JMD A;  2LXP C;  4O70 A;  5ETB A;  4R2Y A;  4X3G A;  5AIU A;  1F62 A;  4PCE A;  3PHD A;  5COI A;  3U5L A;  5FH7 A;  4NYX A;  5HEM A;  5DY7 A;  5A7C A;  4YYK A;  5AMF A;  4UYF B;  5CUD A;  3MUK A;  4QC3 A;  4IOR A;  5E9Y A;  3SOW A;  5DLX A;  5DYX A;  1WUG A;  5KO4 A;  4HXK A;  5FE8 A;  2EGP A;  4PKL A;  2LV9 A;  4IR5 A;  1T1H A;  4QYL A;  2XEU A;  5C7N A;  5H9M A;  4NR6 A;  4V3L C;  2K4D A;  4WHU A;  5CQ3 A;  2UZG A;  4C66 A;  4NN2 A;  1WEO A;  1JM4 B;  2R0V A;  5FE2 A;  4Q0N A;  2XB1 A;  4ZC9 A;  2KYU A;  4GNE A;  2G4A A;  2LRI C;  4YBT A;  4Z1Q A;  4YAB A;  1BOR A;  1EQF A;  4QSU A;  5ENJ A;  5I80 A;  5F5Z A;  5CRZ A;  1WEP A;  4YAX A;  2DWW A;  1F68 A;  2R10 A;  2KR4 A;  3L11 A;  4NQM A;  1JM7 B;  4LYS A;  2YT5 A;  2MA5 A;  5FE0 A;  3ZPV E;  4O71 A;  2YHO A;  5FFY A;  5EPR A;  5EWV A;  3ZYU A;  5I7Y A;  4NR5 A;  2R0S A;  2DVR A;  4YAT A;  5F25 A;  4OGJ A;  2MNZ A;  3M99 A;  5FG4 A;  4HBV A;  5DYA A;  4QZS A;  4I7C A;  4LK9 A;  2MA6 A;  2KIZ A;  2LXH C;  4LLB A;  5L98 A;  4HBW A;  4IR4 A;  5G0F A;  4CUS A;  2CT2 A;  5H1U A;  4QSX A;  4N4G A;  2CSZ A;  2E7O A;  4I7D A;  5AME A;  2KRE A;  4CUP A;  2MD7 B;  5B75 A;  4QR4 A;  2F6J A;  2YEM A;  3LJW A;  4KV4 A;  4X2I A;  5G4S A;  5L97 A;  4YYN A;  3RPG C;  5D7X A;  2KU3 A;  2OXQ C;  4QEV A;  4LC2 A;  5CQ8 A;  4LDF A;  5F61 A;  5LKT A;  3FKM X;  4HBX A;  4A0C D;  5CQ5 A;  5A82 A;  4YY4 A;  3P1E A;  4Z6H A;  5B77 A;  5EP7 A;  2E7N A;  4W4U A;  4YAD A;  5FE5 A;  3AAD A;  4NRC A;  4QBM A;  2C2L A;  1V87 A;  4TS8 A;  3U5M A;  4TU4 A;  1VFY A;  2L5U A;  2RNW A;  2L43 A;  3P1C A;  4Q0O A;  4TYL A;  5CY9 A;  4HBY A;  4ALG A;  5L8T A;  5DKH A;  5FER A;  4L58 A;  5F3A A;  2FUU A;  2QIZ A;  4QEW A;  3MHS A;  4B7Y C;  5E9I A;  5ETD A;  3P1D A;  2CSY A;  3N9P A;  4O7F A;  5E73 A;  2VNF A;  1G25 A;  4GB0 A;  5IBN A;  3IHP A;  5EYA F;  4QSQ A;  3S92 A;  3PUR A;  4O7E A;  2YU4 A;  1WEW A;  4YYJ A;  4YBM A;  5HQ5 A;  2DVS A;  3HMH A;  2R0Y A;  4LYI A;  4PPE A;  5B76 A;  3NXB A;  2VJE A;  4O78 A;  5EM3 A;  4Z1S A;  2L84 A;  5E3D A;  4N4I A;  5EV9 A;  4O72 A;  2RI7 A;  3JVJ A;  4YY6 A;  5CFW A;  5JI8 A;  5K29 A;  1U6G B;  2LGK A;  3RCW A;  5CS8 A;  1DVP A;  1VD4 A;  4GNG A;  5I7X A;  1N87 A;  1WEQ A;  4FO9 A;  2DX8 A;  5HQ6 A;  5E0R A;  5J0D A;  1XWH A;  3MB3 A;  5E3G A;  2QIC A;  2VPD A;  2KTB B;  4R8P K;  2YRE A;  5AIT A;  5F62 A;  4BW4 A;  5D0C A;  3T6R A;  5FFV A;  3ZVY A;  4LR6 A;  1K2F A;  5CU8 A;  5JG6 A;  5D3P A;  4HXL A;  4HXS A;  5LKZ A;  5E9M A;  4UP0 A;  2I7K A;  2VJF B;  4YYD A;  3C6W A;  5D1M B;  2H0D A;  4MEP A;  4CUU A;  2M85 A;  4CFK A;  3HMF A;  4YC9 A;  1N72 A;  5A5R A;  5LKX A;  4QSP A;  2VPG A;  3LRQ A;  2YYN A;  4O7C A;  5A83 A;  3MB4 A;  4B86 C;  5CUC A;  2L0B A;  4MR5 A;  5DIN A;  1Z6U A;  5D25 A;  2WP1 A;  4A9E A;  1FBV A;  1JOC A;  4BW1 A;  4J1P A;  5A5S A;  4UIY A;  4GPJ A;  2LDR A;  5EPS A;  2YQD A;  2K1J A;  4LJN A;  5D1K B;  5HQ7 A;  3GV4 A;  2ECV A;  5BT5 A;  2MD8 C;  3P5O A;  5F1L A;  2MIQ A;  2I8N A;  3MUL A;  4C9Z A;  4QF3 A;  2KGG A;  4NR9 A;  3SVG A;  2IDA A;  4NR7 A;  5FFW A;  5DW2 A;  1LDJ B;  4WZ3 B;  5D3N A;  4UI9 B;  3ZPV 1;  2K17 A;  1Z60 A;  4YH4 A;  3JVL A;  5TBN A;  5C87 A;  5LVQ A;  5CQT A;  4CFL A;  4FJC A;  4NQN A;  3EB5 A;  4BW3 A;  4FLP A;  3AQA A;  5FG6 A;  2ECT A;  5D1L B;  5I89 A;  5DW1 A;  2JMJ A;  2ECG A;  5G04 B;  5HEL A;  1Z2Q A;  2N9G A;  2JMI A;  5C13 A;  3LQI A;  5B8D A;  2RO1 A;  4MEO A;  2Y1N A;  5FG5 A;  4ZDT A;  1WGM A;  2G6Q A;  3N9N A;  4QC1 A;  4QEU A;  2RNX A;  3DQV R;  4YYG A;  5EQ1 A;  3I3J A;  4N4F A;  5FE3 A;  5CQ6 A;  4O7B A;  5EA1 A;  5FDZ A;  2LGG A;  3GL6 A;  2K16 A;  4MEQ A;  2H0D B;  2RFJ A;  5EI4 A;  4N3W A;  5E9V A;  4A9J A;  5LCW B;  4YYM A;  5BT4 A;  5EWC A;  3QZV A;  4LZ2 A;  5HFR A;  5F2P A;  1ZBD B;  4MR3 A;  2D8S A;  5E7D A;  4TTE A;  1WIM A;  3DWY A;  2ECJ A;  4F52 B;  5HFQ A;  2MUM A;  3N9M A;  4S3O C;  5ENB A;  1E6I A;  4TT2 A;  5KH3 A;  5C11 A;  2NAA A;  4NRB A;  4IC2 A;  5KH9 A;  4AUQ B;  4LZR A;  2PNX A;  4NRA A;  2F42 A;  1WES A;  2VP7 A;  4HXP A;  5EPB A;  4Q6F A;  3SVF A;  5FEY A;  3LXJ A;  5C85 A;  5A5P A;  4IOQ A;  2I50 A;  2ECN A;  4A9K A;  3JVM A;  5TCM A;  1HYJ A;  2YW5 A;  1WEV A;  5TDW A;  5I1Q A;  5B78 A;  1WIL A;  5C8G A;  4HXR A;  5HJC A;  5HRW A;  1E4U A;  3NG2 A;  4QSR A;  3G0L A;  2YYR A;  2ZET C;  3L1X A;  5EU1 A;  5L96 A;  1VYX A;  3UV2 A;  4QSS A;  2RSD A;  4AP4 A;  5DYC A;  4TKP B;  5DKD A;  5EIS A;  3UW9 A;  5EWH A;  5EVA A;  2VPB A;  3Q2F A;  4AKN A;  4ZW1 A;  2C2V S;  4LAD B;  4IOO A;  5I86 A;  5CQA A;  2RS9 B;  5HLS A;  2BAY A;  4YH3 A;  3QZT A;  5ACY A;  1WUM A;  3S91 A;  4TT6 A;  5KTX A;  5FE9 A;  4Y03 A;  3HME A;  4NUE A;  4A9L A;  1HYI A;  4ZQL A;  2H60 A;  5A81 A;  2LSP B;  5CZG A;  3Q2E A;  3EB6 A;  4I7B A;  2YEK A;  5DYU A;  5KTW A;  3O34 A;  5IGN A;  4A9N A;  4AVX A;  4UYF A;  5ENE A;  5DBM A;  5IID A;  2L85 A;  5DFB A;  5E74 A;  4IC3 A;  4XUA A;  4NYV A;  3QZS A;  4PY6 A;  3SOX A;  2YSJ A;  4L7X A;  4QR5 A;  4NYW A;  4PS5 A;  4ZUX U;  4UYE A;  5DLZ A;  4NUC A;  5CUG A;  1FP0 A;  5II2 A;  3N9Q A;  4UIT A;  5KTU A;  3SOU A;  5LJ1 A;  4CA1 A;  4XY9 A;  5JWM A;  4QF2 A;  5IGL A;  4V3K C;  4YK0 A;  4MEN A;  5D3H A;  2KWN A;  4XYA A;  4BBQ A;  3U5K A;  4TQN A;  5CPE A;  5ENC A;  3DPL R;  2YUC A;  4QUU A;  4BHW A;  4O64 A;  3U5O A;  3KNV A;  4UIW A;  5D26 A;  5EWD A;  3DAI A;  5EWW A;  1LDK C;  2YW8 A;  1WFK A;  3IU6 A;  4P5O B;  4Z93 A;  4ALH A;  3RPG B;  1ZS5 A;  3UVW A;  2HDP A;  4BW2 A;  4TZ8 A;  5I29 A;  4CL9 A;  5E9K A;  4QY4 A;  5FE4 A;  5IGK A;  5FB1 A;  1WEU A;  2YSM A;  3TLP A;  4WZ0 A;  4MVT A;  4TZ2 A;  4UYH A;  4CUT A;  1WE9 A;  3RTR B;  4R7E A;  3SHB A;  5EK9 A;  1RMD A;  2VPE A;  2NXB A;  3N9L A;  3M62 A;  3UVD A;  3GG3 A;  4Z6I A;  4WHW A;  4F3I A;  3V43 A;  4O75 A;  2D82 A;  4J3I A;  2VJE B;  5II1 A;  4A9I A;  4WA6 A;  5HCL A;  4CLB A;  5G4R A;  5DKA A;  5KHM A;  2CKL A;  3HCT A;  2Y1M A;  4XUB A;  4FK5 A;  2EA6 A;  5FB0 A;  1WEE A;  3MXF A;  4NXJ A;  5ENI A;  2E6R A;  3HTK C;  3ZVZ B;  2KE1 A;  4PTB A;  2AN6 A;  3PUQ A;  4UIZ A;  4A9M A;  5CRM A;  5LUU A;  1WEM A;  4UIX A;  5TAB A;  3O37 A;  5ENH A;  4AYC A;  5D3R A;  1MM2 A;  4IR3 A;  3KV5 A;  5FH6 A;  2L5E A;  5LJ2 A;  3O35 A;  4O7A A;  5AD3 A;  4DON A;  5C4Q A;  3M63 A;  2OSS A;  3C5K A;  4PCI A;  4A9O A;  5F63 A;  2KWO A;  3MHH A;  4LRG A;  4A4B A;  4UIU A;  2LN0 A;  5H85 A;  2HYE D;  3U5J A;  5DX4 A;  4NUD A;  5H1T A;  4NR8 A;  4HXO A;  5H1V A;  2DVQ A;  3IU5 A;  3UV4 A;  2E3K A;  2RNY A; 
#chains in the Genus database with same CATH topology
 2L75 A;  5TRB A;  2MJV B;  4NS5 A;  4IR6 A;  3SVH A;  2MT5 A;  2FSA A;  2KGI A;  2G43 A;  2YHN A;  5E9L A;  5FE7 A;  3HCS A;  3N9O A;  3KQI A;  4QSW A;  5CQ4 A;  5FE1 A;  1PUO A;  4C67 A;  2YQL A;  4QNS A;  5CQ7 A;  5CUE A;  5D3T A;  5A5Q A;  4CCG X;  3U5P A;  4LZS A;  2KFT A;  5TDR A;  3ZTG A;  2Y43 A;  2FUI A;  4A9H A;  5D3S A;  1MM3 A;  3ZNI A;  4LYW A;  4A4C A;  4O76 A;  4O77 A;  2YEL A;  5D24 A;  5LJ0 A;  4A49 A;  4J0S A;  2ECW A;  2QJ0 A;  5F36 A;  3VK6 A;  1DCQ A;  4YYI A;  3HCU A;  4J0R A;  5CP5 A;  5DKC A;  4NR4 A;  5A85 A;  2WP2 A;  3O33 A;  1JSP B;  4MSX A;  3K2J A;  5IG6 A;  2PUY A;  2CKL B;  2KWK A;  4N4H A;  5CGP A;  5F60 A;  4A9F A;  5HM0 A;  4XY8 A;  5D3J A;  2VJF A;  2DVV A;  5LKU A;  4YBS A;  4HXM A;  5DFD A;  4AYC B;  4E96 A;  5KU3 A;  5F1H A;  3ASL A;  2G45 A;  4UYG A;  5DFC A;  4QR3 A;  2L80 A;  5C89 A;  3D7C A;  2LGV A;  4MR4 A;  5I88 A;  1X0J A;  5LVR A;  2EOD A;  3T7L A;  4UYD A;  3UV5 A;  2LGL A;  5L99 A;  5FBX A;  4BJX A;  4OUF A;  3ONI A;  5EGU A;  3LQJ A;  4QB3 A;  2YQM A;  5I3L A;  4YYH A;  5IGM A;  4QSV A;  5HEN A;  1X4I A;  3JVK A;  3LDY A;  5ENF A;  4KCX A;  4QYD A;  2M3H A;  4TU6 A;  3MQM A;  5CUA A;  3P1F A;  2OUO A;  5A5O A;  5CTL A;  5HRV A;  4OGC A;  2CON A;  3ZYQ A;  2KKX A;  2LQ6 A;  2E6S A;  4RVR A;  4WIV A;  5FE6 A;  2D9E A;  4UIV A;  5I40 A;  1IYM A;  3G0J A;  2KWJ A;  5CUB A;  2MNY A;  3U5N A;  4KV1 A;  2JRJ A;  3LJU X;  4GNF A;  2F6N A;  5L8U A;  5BT3 A;  2CSV A;  1X4J A;  2OO1 A;  5J3X A;  4UP5 A;  4CUR A;  5HRX A;  5I83 A;  2M6M A;  3KV6 A;  4FIP A;  4TT4 A;  2YDW A;  5EIC A;  3UVY A;  3UVX A;  4S3O B;  1JM7 A;  4MR6 A;  1X4U A;  3O36 A;  2DAT A;  2EGM A;  3L1Z B;  5B79 A;  3FL2 A;  1CHC A;  5D3L A;  2DKW A;  2GRC A;  4OGI A;  2YUR A;  5TB6 A;  4O74 A;  3O70 A;  1WEN A;  3O7A A;  4LKA A;  5ENG A;  5KH7 A;  5A5N A;  4XI1 A;  4CUQ A;  1MBM A;  2M1R A;  3LQH A;  5FH8 A;  5AD2 A;  2ECI A;  4GND A;  3O47 A;  3I2D A;  4HXN A;  4QUT A;  2MKE A;  4WZ2 A;  4QST A;  5G05 B;  2JMD A;  2LXP C;  4O70 A;  5ETB A;  2YVR A;  4R2Y A;  4X3G A;  5AIU A;  1F62 A;  4PCE A;  3PHD A;  5COI A;  3U5L A;  5FH7 A;  4NYX A;  3Q1D A;  5HEM A;  5DY7 A;  5A7C A;  4YYK A;  5AMF A;  4UYF B;  3FAO A;  5CUD A;  3MUK A;  3DDT A;  4QC3 A;  4IOR A;  5E9Y A;  3SOW A;  5DLX A;  5DYX A;  1WUG A;  5KO4 A;  4HXK A;  5FE8 A;  2EGP A;  4PKL A;  2LV9 A;  4IR5 A;  1T1H A;  2RR4 A;  4QYL A;  2XEU A;  5C7N A;  5H9M A;  4NR6 A;  4V3L C;  3LVQ E;  5SVI B;  2K4D A;  4WHU A;  5CQ3 A;  2UZG A;  4C66 A;  4NN2 A;  1WEO A;  1JM4 B;  2R0V A;  5FE2 A;  4Q0N A;  2XB1 A;  4ZC9 A;  2DSM A;  2KYU A;  4GNE A;  2G4A A;  2LRI C;  4YBT A;  4Z1Q A;  4YAB A;  1BOR A;  1EQF A;  4QSU A;  5ENJ A;  5I80 A;  5F5Z A;  5CRZ A;  5SVY A;  1WEP A;  4YAX A;  2DWW A;  1F68 A;  2R10 A;  2KR4 A;  3L11 A;  4NQM A;  4Z0O A;  4LYS A;  2YT5 A;  1JM7 B;  2MA5 A;  5FE0 A;  3ZPV E;  4O71 A;  2YHO A;  5FFY A;  5EPR A;  5EWV A;  3ZYU A;  5I7Y A;  4NR5 A;  2R0S A;  2DVR A;  4YAT A;  5F25 A;  4OGJ A;  2MNZ A;  3M99 A;  5FG4 A;  4HBV A;  5DYA A;  4QZS A;  4I7C A;  4LK9 A;  2MA6 A;  2KIZ A;  2LXH C;  4LLB A;  5L98 A;  4HBW A;  4IR4 A;  5G0F A;  4CUS A;  2CT2 A;  2LAU A;  5H1U A;  4QSX A;  4N4G A;  2CSZ A;  2E7O A;  2M13 A;  5AME A;  2KRE A;  2XOY A;  4I7D A;  4CUP A;  2MD7 B;  5B75 A;  4QR4 A;  2F6J A;  2YEM A;  3LJW A;  4KV4 A;  4X2I A;  5G4S A;  5L97 A;  4YYN A;  2EXU A;  3RPG C;  5D7X A;  3FM8 C;  2KU3 A;  2OXQ C;  4QEV A;  4LC2 A;  5CQ8 A;  4LDF A;  5F61 A;  5LKT A;  3FKM X;  4HBX A;  4A0C D;  5CQ5 A;  5A82 A;  4YY4 A;  3P1E A;  4Z6H A;  5B77 A;  5EP7 A;  2E7N A;  4W4U A;  4YAD A;  4AKH A;  5FE5 A;  3FJU B;  3AAD A;  4NRC A;  4QBM A;  2C2L A;  1V87 A;  3T9K A;  4TS8 A;  3U5M A;  4TU4 A;  1VFY A;  2L5U A;  2RNW A;  2L7P A;  2L43 A;  3P1C A;  4Q0O A;  4TYL A;  5CY9 A;  4HBY A;  4ALG A;  5L8T A;  5DKH A;  5FER A;  4L58 A;  5F3A A;  2FUU A;  2QIZ A;  4QEW A;  2B0O E;  3MHS A;  4B7Y C;  5E9I A;  5ETD A;  3P1D A;  2CSY A;  3N9P A;  4O7F A;  5E73 A;  2VNF A;  1G25 A;  4GB0 A;  5IBN A;  3IHP A;  5EYA F;  4QSQ A;  3S92 A;  3PUR A;  4O7E A;  2YU4 A;  1WEW A;  4YYJ A;  4YBM A;  5HQ5 A;  2DVS A;  3HMH A;  2R0Y A;  4LYI A;  4PPE A;  4OGE A;  3D1D A;  5B76 A;  3NXB A;  5K3Q A;  2VJE A;  4O78 A;  5EM3 A;  4Z1S A;  2L84 A;  5E3D A;  4N4I A;  5EV9 A;  4O72 A;  2RI7 A;  3JVJ A;  4YY6 A;  5CFW A;  5JI8 A;  5K29 A;  1U6G B;  2LGK A;  3RCW A;  5CS8 A;  1DVP A;  1VD4 A;  4GNG A;  5I7X A;  1N87 A;  1WEQ A;  4FO9 A;  2DX8 A;  5HQ6 A;  5E0R A;  5J0D A;  1XWH A;  3MB3 A;  5E3G A;  2QIC A;  2VPD A;  2KTB B;  2XOC A;  2YRE A;  2IQJ A;  5AIT A;  4R8P K;  5F62 A;  4BW4 A;  5D0C A;  3T6R A;  5FFV A;  3ZVY A;  4LR6 A;  1K2F A;  5CU8 A;  5JG6 A;  5D3P A;  4HXL A;  4HXS A;  5LKZ A;  5E9M A;  4UP0 A;  2I7K A;  2VJF B;  4YYD A;  4QQ4 A;  3C6W A;  5D1M B;  2H0D A;  4MEP A;  4CUU A;  2M85 A;  4CFK A;  3HMF A;  4YC9 A;  1N72 A;  5A5R A;  5LKX A;  4QSP A;  2VPG A;  3LRQ A;  2YYN A;  4O7C A;  3SUB A;  5A83 A;  3MB4 A;  4B86 C;  5CUC A;  2L0B A;  4MR5 A;  5DIN A;  1Z6U A;  5D25 A;  3MDB C;  2WP1 A;  2XOZ A;  4A9E A;  1FBV A;  1JOC A;  2KKY A;  4BW1 A;  4J1P A;  5A5S A;  4UIY A;  3VKH A;  4GPJ A;  2LDR A;  5EPS A;  2YQD A;  2K1J A;  4LJN A;  5D1K B;  5HQ7 A;  3GV4 A;  2ECV A;  5BT5 A;  2MD8 C;  3P5O A;  5F1L A;  2MIQ A;  2I8N A;  3MUL A;  4C9Z A;  4QF3 A;  2KGG A;  4NR9 A;  3SVG A;  2IDA A;  4NR7 A;  5FFW A;  5DW2 A;  1LDJ B;  4WZ3 B;  5D3N A;  4UI9 B;  3ZPV 1;  2K17 A;  1Z60 A;  4YH4 A;  3JVL A;  5TBN A;  5C87 A;  5LVQ A;  5CQT A;  4CFL A;  4FJC A;  4NQN A;  3EB5 A;  4BW3 A;  2CRW A;  4FLP A;  3AQA A;  5FG6 A;  2ECT A;  5D1L B;  5I89 A;  5DW1 A;  2JMJ A;  2ECG A;  5G04 B;  5HEL A;  1Z2Q A;  2N9G A;  2JMI A;  5C13 A;  3LQI A;  5B8D A;  2RO1 A;  4MEO A;  2Y1N A;  5FG5 A;  4ZDT A;  1WGM A;  2G6Q A;  3N9N A;  4QC1 A;  3JUE A;  4QEU A;  2RNX A;  3DQV R;  4YYG A;  5EQ1 A;  3I3J A;  4N4F A;  5FE3 A;  2E61 A;  5CQ6 A;  4O7B A;  5EA1 A;  5FDZ A;  2FFW A;  2LGG A;  2K16 A;  4MEQ A;  3GL6 A;  2H0D B;  4Z0R A;  2RFJ A;  5EI4 A;  4N3W A;  5E9V A;  4A9J A;  5LCW B;  4YYM A;  2EJN A;  5BT4 A;  5EWC A;  3QZV A;  4LZ2 A;  5HFR A;  5F2P A;  1ZBD B;  4MR3 A;  2D8S A;  5E7D A;  3FAN A;  4TTE A;  1WIM A;  3DWY A;  2ECJ A;  4F52 B;  5HFQ A;  2MUM A;  3N9M A;  4S3O C;  5ENB A;  1E6I A;  4TT2 A;  5KH3 A;  5C11 A;  2NAA A;  4NRB A;  4IC2 A;  5KH9 A;  4AUQ B;  4LZR A;  2PNX A;  4NRA A;  2F42 A;  1WES A;  2VP7 A;  4HXP A;  5EPB A;  4Q6F A;  3SVF A;  5FEY A;  3LXJ A;  5C85 A;  5A5P A;  3VKG A;  4IOQ A;  2I50 A;  2ECN A;  4A9K A;  3JVM A;  5TCM A;  1HYJ A;  2YW5 A;  1WEV A;  5TDW A;  2D8U A;  5I1Q A;  2JUN A;  4AI6 A;  5B78 A;  1WIL A;  5C8G A;  3DWD A;  4HXR A;  5HJC A;  5HRW A;  1E4U A;  3NG2 A;  4QSR A;  3G0L A;  2YYR A;  2ZET C;  3L1X A;  5EU1 A;  5L96 A;  1VYX A;  3UV2 A;  4QSS A;  2RSD A;  4AP4 A;  5DYC A;  4TKP B;  5DKD A;  5EIS A;  3UW9 A;  5EWH A;  5EVA A;  2VPB A;  3Q2F A;  4AKN A;  4ZW1 A;  2C2V S;  4LAD B;  4IOO A;  5I86 A;  5CQA A;  2RS9 B;  5HLS A;  2BAY A;  1ZKR A;  4YH3 A;  3QZT A;  5ACY A;  1WUM A;  3M7K A;  3S91 A;  4TT6 A;  5KTX A;  5FE9 A;  4Y03 A;  4H9D A;  3HME A;  4NUE A;  4A9L A;  2OWA A;  4ZQL A;  1HYI A;  2H60 A;  5A81 A;  2LSP B;  5CZG A;  3Q2E A;  3EB6 A;  4I7B A;  2YEK A;  5DYU A;  5KTW A;  3O34 A;  5IGN A;  4A9N A;  3PLW A;  4AVX A;  4UYF A;  5ENE A;  5DBM A;  5IID A;  2L85 A;  5DFB A;  5E74 A;  4IC3 A;  4XUA A;  4NYV A;  2JM3 A;  3QZS A;  4PY6 A;  3SOX A;  2YSJ A;  4L7X A;  4QR5 A;  4NYW A;  4PS5 A;  4O62 A;  5SVX A;  4ZUX U;  4UYE A;  5DLZ A;  4NUC A;  5CUG A;  1FP0 A;  5II2 A;  3N9Q A;  5SVI A;  4UIT A;  5KTU A;  3SOU A;  5LJ1 A;  4CA1 A;  4XY9 A;  5JWM A;  4QF2 A;  5IGL A;  4V3K C;  4YK0 A;  4MEN A;  5D3H A;  2KWN A;  4XYA A;  4BBQ A;  3U5K A;  4TQN A;  5CPE A;  5ENC A;  3DPL R;  2YUC A;  4QUU A;  4BHW A;  2DJA A;  4O64 A;  3U5O A;  3KNV A;  4UIW A;  5D26 A;  2FD4 A;  5EWD A;  3DAI A;  5EWW A;  1LDK C;  2YW8 A;  1WFK A;  3IU6 A;  3ERR A;  4P5O B;  4Z93 A;  3D1B A;  4ALH A;  3LVR E;  3RPG B;  1ZS5 A;  3UVW A;  2HDP A;  4BW2 A;  4TZ8 A;  5I29 A;  4CL9 A;  5E9K A;  4QY4 A;  5FE4 A;  5IGK A;  5FB1 A;  4AKI A;  4AKG A;  1WEU A;  2YSM A;  4F1P A;  3TLP A;  4WZ0 A;  4MVT A;  4TZ2 A;  4UYH A;  4CUT A;  1WE9 A;  3RTR B;  4R7E A;  3SHB A;  5EK9 A;  2XP0 A;  1RMD A;  2VPE A;  2NXB A;  3N9L A;  3M62 A;  3UVD A;  3GG3 A;  4Z6I A;  4WHW A;  4F3I A;  3V43 A;  4O75 A;  3H7H A;  2D82 A;  4J3I A;  2VJE B;  3E2D A;  5II1 A;  4A9I A;  4WA6 A;  5HCL A;  4CLB A;  5G4R A;  5DKA A;  5KHM A;  2CKL A;  3HCT A;  2P57 A;  2Y1M A;  4XUB A;  4FK5 A;  2EA6 A;  5FB0 A;  1WEE A;  3MXF A;  4NXJ A;  5ENI A;  2E6R A;  3HTK C;  3ZVZ B;  2KE1 A;  4PTB A;  2AN6 A;  3PUQ A;  4UIZ A;  4A9M A;  5CRM A;  5LUU A;  1WEM A;  4UIX A;  5TAB A;  3O37 A;  5ENH A;  4AYC A;  5D3R A;  1MM2 A;  2CRR A;  4IR3 A;  3KV5 A;  5FH6 A;  2L5E A;  5LJ2 A;  3O35 A;  3FEH A;  4O7A A;  5AD3 A;  4DON A;  5C4Q A;  3M63 A;  2OSS A;  3C5K A;  4PCI A;  4A9O A;  5F63 A;  2KWO A;  3MHH A;  4LRG A;  4A4B A;  4UIU A;  2LN0 A;  5H85 A;  2HYE D;  3U5J A;  5DX4 A;  4NUD A;  5H1T A;  4NR8 A;  4HXO A;  5H1V A;  3KDE C;  2DVQ A;  3IU5 A;  3UV4 A;  2E3K A;  2RNY A; 
#chains in the Genus database with same CATH homology
 2L75 A;  5TRB A;  2MJV B;  4NS5 A;  4IR6 A;  3SVH A;  2MT5 A;  2FSA A;  2KGI A;  2G43 A;  2YHN A;  5E9L A;  5FE7 A;  3HCS A;  3N9O A;  3KQI A;  4QSW A;  5CQ4 A;  5FE1 A;  4C67 A;  2YQL A;  4QNS A;  5CQ7 A;  5CUE A;  5D3T A;  5A5Q A;  4CCG X;  3U5P A;  4LZS A;  2KFT A;  5TDR A;  3ZTG A;  2Y43 A;  2FUI A;  4A9H A;  5D3S A;  1MM3 A;  3ZNI A;  4LYW A;  4A4C A;  4O76 A;  4O77 A;  2YEL A;  5D24 A;  5LJ0 A;  4A49 A;  4J0S A;  2ECW A;  2QJ0 A;  5F36 A;  3VK6 A;  4YYI A;  3HCU A;  4J0R A;  5CP5 A;  5DKC A;  4NR4 A;  5A85 A;  2WP2 A;  3O33 A;  1JSP B;  4MSX A;  3K2J A;  5IG6 A;  2PUY A;  2CKL B;  2KWK A;  4N4H A;  5CGP A;  5F60 A;  4A9F A;  5HM0 A;  4XY8 A;  5D3J A;  2VJF A;  2DVV A;  5LKU A;  4YBS A;  4HXM A;  5DFD A;  4AYC B;  4E96 A;  5KU3 A;  5F1H A;  3ASL A;  2G45 A;  4UYG A;  5DFC A;  4QR3 A;  2L80 A;  5C89 A;  3D7C A;  2LGV A;  4MR4 A;  5I88 A;  1X0J A;  5LVR A;  2EOD A;  3T7L A;  4UYD A;  3UV5 A;  2LGL A;  5L99 A;  5FBX A;  4BJX A;  4OUF A;  3ONI A;  5EGU A;  3LQJ A;  4QB3 A;  2YQM A;  5I3L A;  4YYH A;  5IGM A;  4QSV A;  5HEN A;  1X4I A;  3JVK A;  5ENF A;  4KCX A;  4QYD A;  2M3H A;  4TU6 A;  3MQM A;  5CUA A;  3P1F A;  2OUO A;  5A5O A;  5CTL A;  5HRV A;  3ZYQ A;  2LQ6 A;  2E6S A;  4RVR A;  4WIV A;  5FE6 A;  2D9E A;  4UIV A;  5I40 A;  1IYM A;  3G0J A;  2KWJ A;  5CUB A;  2MNY A;  3U5N A;  4KV1 A;  2JRJ A;  4GNF A;  2F6N A;  5L8U A;  5BT3 A;  1X4J A;  2OO1 A;  5J3X A;  4UP5 A;  4CUR A;  5HRX A;  5I83 A;  2M6M A;  3KV6 A;  4FIP A;  4TT4 A;  2YDW A;  5EIC A;  3UVY A;  3UVX A;  4S3O B;  1JM7 A;  4MR6 A;  1X4U A;  3O36 A;  2DAT A;  3L1Z B;  5B79 A;  3FL2 A;  1CHC A;  5D3L A;  2DKW A;  2GRC A;  4OGI A;  2YUR A;  5TB6 A;  4O74 A;  3O70 A;  1WEN A;  3O7A A;  4LKA A;  5ENG A;  5KH7 A;  5A5N A;  4XI1 A;  4CUQ A;  2M1R A;  3LQH A;  5FH8 A;  5AD2 A;  2ECI A;  4GND A;  3I2D A;  4HXN A;  4QUT A;  4WZ2 A;  4QST A;  5G05 B;  2JMD A;  2LXP C;  4O70 A;  5ETB A;  4R2Y A;  4X3G A;  5AIU A;  1F62 A;  4PCE A;  3PHD A;  5COI A;  3U5L A;  5FH7 A;  4NYX A;  5HEM A;  5DY7 A;  5A7C A;  4YYK A;  5AMF A;  4UYF B;  5CUD A;  3MUK A;  4QC3 A;  4IOR A;  5E9Y A;  3SOW A;  5DLX A;  5DYX A;  1WUG A;  5KO4 A;  4HXK A;  5FE8 A;  2EGP A;  4PKL A;  2LV9 A;  4IR5 A;  1T1H A;  4QYL A;  2XEU A;  5C7N A;  5H9M A;  4NR6 A;  4V3L C;  2K4D A;  4WHU A;  5CQ3 A;  2UZG A;  4C66 A;  4NN2 A;  1WEO A;  1JM4 B;  2R0V A;  5FE2 A;  4Q0N A;  2XB1 A;  4ZC9 A;  2KYU A;  4GNE A;  2G4A A;  2LRI C;  4YBT A;  4Z1Q A;  4YAB A;  1BOR A;  1EQF A;  4QSU A;  5ENJ A;  5I80 A;  5F5Z A;  5CRZ A;  1WEP A;  4YAX A;  2DWW A;  1F68 A;  2R10 A;  2KR4 A;  3L11 A;  4NQM A;  1JM7 B;  4LYS A;  2YT5 A;  2MA5 A;  5FE0 A;  3ZPV E;  4O71 A;  2YHO A;  5FFY A;  5EPR A;  5EWV A;  3ZYU A;  5I7Y A;  4NR5 A;  2R0S A;  2DVR A;  4YAT A;  5F25 A;  4OGJ A;  2MNZ A;  3M99 A;  5FG4 A;  4HBV A;  5DYA A;  4QZS A;  4I7C A;  4LK9 A;  2MA6 A;  2KIZ A;  2LXH C;  4LLB A;  5L98 A;  4HBW A;  4IR4 A;  5G0F A;  4CUS A;  2CT2 A;  5H1U A;  4QSX A;  4N4G A;  2CSZ A;  2E7O A;  4I7D A;  5AME A;  2KRE A;  4CUP A;  2MD7 B;  5B75 A;  4QR4 A;  2F6J A;  2YEM A;  3LJW A;  4KV4 A;  4X2I A;  5G4S A;  5L97 A;  4YYN A;  3RPG C;  5D7X A;  2KU3 A;  2OXQ C;  4QEV A;  4LC2 A;  5CQ8 A;  4LDF A;  5F61 A;  5LKT A;  3FKM X;  4HBX A;  4A0C D;  5CQ5 A;  5A82 A;  4YY4 A;  3P1E A;  4Z6H A;  5B77 A;  5EP7 A;  2E7N A;  4W4U A;  4YAD A;  5FE5 A;  3AAD A;  4NRC A;  4QBM A;  2C2L A;  1V87 A;  4TS8 A;  3U5M A;  4TU4 A;  1VFY A;  2L5U A;  2RNW A;  2L43 A;  3P1C A;  4Q0O A;  4TYL A;  5CY9 A;  4HBY A;  4ALG A;  5L8T A;  5DKH A;  5FER A;  4L58 A;  5F3A A;  2FUU A;  2QIZ A;  4QEW A;  3MHS A;  4B7Y C;  5E9I A;  5ETD A;  3P1D A;  2CSY A;  3N9P A;  4O7F A;  5E73 A;  2VNF A;  1G25 A;  4GB0 A;  5IBN A;  3IHP A;  5EYA F;  4QSQ A;  3S92 A;  3PUR A;  4O7E A;  2YU4 A;  1WEW A;  4YYJ A;  4YBM A;  5HQ5 A;  2DVS A;  3HMH A;  2R0Y A;  4LYI A;  4PPE A;  5B76 A;  3NXB A;  2VJE A;  4O78 A;  5EM3 A;  4Z1S A;  2L84 A;  5E3D A;  4N4I A;  5EV9 A;  4O72 A;  2RI7 A;  3JVJ A;  4YY6 A;  5CFW A;  5JI8 A;  5K29 A;  1U6G B;  2LGK A;  3RCW A;  5CS8 A;  1DVP A;  1VD4 A;  4GNG A;  5I7X A;  1N87 A;  1WEQ A;  4FO9 A;  2DX8 A;  5HQ6 A;  5E0R A;  5J0D A;  1XWH A;  3MB3 A;  5E3G A;  2QIC A;  2VPD A;  2KTB B;  4R8P K;  2YRE A;  5AIT A;  5F62 A;  4BW4 A;  5D0C A;  3T6R A;  5FFV A;  3ZVY A;  4LR6 A;  1K2F A;  5CU8 A;  5JG6 A;  5D3P A;  4HXL A;  4HXS A;  5LKZ A;  5E9M A;  4UP0 A;  2I7K A;  2VJF B;  4YYD A;  3C6W A;  5D1M B;  2H0D A;  4MEP A;  4CUU A;  2M85 A;  4CFK A;  3HMF A;  4YC9 A;  1N72 A;  5A5R A;  5LKX A;  4QSP A;  2VPG A;  3LRQ A;  2YYN A;  4O7C A;  5A83 A;  3MB4 A;  4B86 C;  5CUC A;  2L0B A;  4MR5 A;  5DIN A;  1Z6U A;  5D25 A;  2WP1 A;  4A9E A;  1FBV A;  1JOC A;  4BW1 A;  4J1P A;  5A5S A;  4UIY A;  4GPJ A;  2LDR A;  5EPS A;  2YQD A;  2K1J A;  4LJN A;  5D1K B;  5HQ7 A;  3GV4 A;  2ECV A;  5BT5 A;  2MD8 C;  3P5O A;  5F1L A;  2MIQ A;  2I8N A;  3MUL A;  4C9Z A;  4QF3 A;  2KGG A;  4NR9 A;  3SVG A;  2IDA A;  4NR7 A;  5FFW A;  5DW2 A;  1LDJ B;  4WZ3 B;  5D3N A;  4UI9 B;  3ZPV 1;  2K17 A;  1Z60 A;  4YH4 A;  3JVL A;  5TBN A;  5C87 A;  5LVQ A;  5CQT A;  4CFL A;  4FJC A;  4NQN A;  3EB5 A;  4BW3 A;  4FLP A;  3AQA A;  5FG6 A;  2ECT A;  5D1L B;  5I89 A;  5DW1 A;  2JMJ A;  2ECG A;  5G04 B;  5HEL A;  1Z2Q A;  2N9G A;  2JMI A;  5C13 A;  3LQI A;  5B8D A;  2RO1 A;  4MEO A;  2Y1N A;  5FG5 A;  4ZDT A;  1WGM A;  2G6Q A;  3N9N A;  4QC1 A;  4QEU A;  2RNX A;  3DQV R;  4YYG A;  5EQ1 A;  3I3J A;  4N4F A;  5FE3 A;  5CQ6 A;  4O7B A;  5EA1 A;  5FDZ A;  2LGG A;  3GL6 A;  2K16 A;  4MEQ A;  2H0D B;  2RFJ A;  5EI4 A;  4N3W A;  5E9V A;  4A9J A;  5LCW B;  4YYM A;  5BT4 A;  5EWC A;  3QZV A;  4LZ2 A;  5HFR A;  5F2P A;  1ZBD B;  4MR3 A;  2D8S A;  5E7D A;  4TTE A;  1WIM A;  3DWY A;  2ECJ A;  4F52 B;  5HFQ A;  2MUM A;  3N9M A;  4S3O C;  5ENB A;  1E6I A;  4TT2 A;  5KH3 A;  5C11 A;  2NAA A;  4NRB A;  4IC2 A;  5KH9 A;  4AUQ B;  4LZR A;  2PNX A;  4NRA A;  2F42 A;  1WES A;  2VP7 A;  4HXP A;  5EPB A;  4Q6F A;  3SVF A;  5FEY A;  3LXJ A;  5C85 A;  5A5P A;  4IOQ A;  2I50 A;  2ECN A;  4A9K A;  3JVM A;  5TCM A;  1HYJ A;  2YW5 A;  1WEV A;  5TDW A;  5I1Q A;  5B78 A;  1WIL A;  5C8G A;  4HXR A;  5HJC A;  5HRW A;  1E4U A;  3NG2 A;  4QSR A;  3G0L A;  2YYR A;  2ZET C;  3L1X A;  5EU1 A;  5L96 A;  1VYX A;  3UV2 A;  4QSS A;  2RSD A;  4AP4 A;  5DYC A;  4TKP B;  5DKD A;  5EIS A;  3UW9 A;  5EWH A;  5EVA A;  2VPB A;  3Q2F A;  4AKN A;  4ZW1 A;  2C2V S;  4LAD B;  4IOO A;  5I86 A;  5CQA A;  2RS9 B;  5HLS A;  2BAY A;  4YH3 A;  3QZT A;  5ACY A;  1WUM A;  3S91 A;  4TT6 A;  5KTX A;  5FE9 A;  4Y03 A;  3HME A;  4NUE A;  4A9L A;  1HYI A;  4ZQL A;  2H60 A;  5A81 A;  2LSP B;  5CZG A;  3Q2E A;  3EB6 A;  4I7B A;  2YEK A;  5DYU A;  5KTW A;  3O34 A;  5IGN A;  4A9N A;  4AVX A;  4UYF A;  5ENE A;  5DBM A;  5IID A;  2L85 A;  5DFB A;  5E74 A;  4IC3 A;  4XUA A;  4NYV A;  3QZS A;  4PY6 A;  3SOX A;  2YSJ A;  4L7X A;  4QR5 A;  4NYW A;  4PS5 A;  4ZUX U;  4UYE A;  5DLZ A;  4NUC A;  5CUG A;  1FP0 A;  5II2 A;  3N9Q A;  4UIT A;  5KTU A;  3SOU A;  5LJ1 A;  4CA1 A;  4XY9 A;  5JWM A;  4QF2 A;  5IGL A;  4V3K C;  4YK0 A;  4MEN A;  5D3H A;  2KWN A;  4XYA A;  4BBQ A;  3U5K A;  4TQN A;  5CPE A;  5ENC A;  3DPL R;  2YUC A;  4QUU A;  4BHW A;  4O64 A;  3U5O A;  3KNV A;  4UIW A;  5D26 A;  5EWD A;  3DAI A;  5EWW A;  1LDK C;  2YW8 A;  1WFK A;  3IU6 A;  4P5O B;  4Z93 A;  4ALH A;  3RPG B;  1ZS5 A;  3UVW A;  2HDP A;  4BW2 A;  4TZ8 A;  5I29 A;  4CL9 A;  5E9K A;  4QY4 A;  5FE4 A;  5IGK A;  5FB1 A;  1WEU A;  2YSM A;  3TLP A;  4WZ0 A;  4MVT A;  4TZ2 A;  4UYH A;  4CUT A;  1WE9 A;  3RTR B;  4R7E A;  3SHB A;  5EK9 A;  1RMD A;  2VPE A;  2NXB A;  3N9L A;  3M62 A;  3UVD A;  3GG3 A;  4Z6I A;  4WHW A;  4F3I A;  3V43 A;  4O75 A;  2D82 A;  4J3I A;  2VJE B;  5II1 A;  4A9I A;  4WA6 A;  5HCL A;  4CLB A;  5G4R A;  5DKA A;  5KHM A;  2CKL A;  3HCT A;  2Y1M A;  4XUB A;  4FK5 A;  2EA6 A;  5FB0 A;  1WEE A;  3MXF A;  4NXJ A;  5ENI A;  2E6R A;  3HTK C;  3ZVZ B;  2KE1 A;  4PTB A;  2AN6 A;  3PUQ A;  4UIZ A;  4A9M A;  5CRM A;  5LUU A;  1WEM A;  4UIX A;  5TAB A;  3O37 A;  5ENH A;  4AYC A;  5D3R A;  1MM2 A;  4IR3 A;  3KV5 A;  5FH6 A;  2L5E A;  5LJ2 A;  3O35 A;  4O7A A;  5AD3 A;  4DON A;  5C4Q A;  3M63 A;  2OSS A;  3C5K A;  4PCI A;  4A9O A;  5F63 A;  2KWO A;  3MHH A;  4LRG A;  4A4B A;  4UIU A;  2LN0 A;  5H85 A;  2HYE D;  3U5J A;  5DX4 A;  4NUD A;  5H1T A;  4NR8 A;  4HXO A;  5H1V A;  2DVQ A;  3IU5 A;  3UV4 A;  2E3K A;  2RNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...