5H1TA

Complex structure of trim24 phd-bromodomain and inhibitor 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1tA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1tA01
4ZW1A 4C66A 1WGMA 3ZVZB 4IR5A 5FH6A 4UIWA 3U5PA 4B86C 5AD2A 3LXJA 5HENA 1ZS5A 3HCUA 5II1A 4UI9B 1Z60A 5FERA 5CQ3A 2HDPA 4LJNA 2LGLA 5BT3A 5EI4A 5B77A 4S3OC 2I8NA 1VFYA 4GNEA 4LDFA 5FDZA 4NYXA 2WP2A 3EB5A 2YYNA 4I7CA 5CFWA 5EPRA 3C6WA 2M1RA 2FSAA 2JMDA 4HXOA 4LKAA 5H1VA 5EWCA 4X3GA 4LADB 4MR6A 4MEOA 5KU3A 2KU3A 5D1KB 2R0YA 3P1EA 1MM3A 4CCGX 4Z1SA 1WE9A 4MENA 5HRXA 4GPJA 4QEUA 2CKLB 5EP7A 2ECWA 4YATA 3N9LA 4WZ3B 3IU6A 2LDRA 4QSUA 5I40A 4A0CD 5F3AA 4QUTA 5HRVA 5L98A 4XYAA 3G0LA 5J0DA 2L5EA 1WFKA 2MD7B 1JM4B 2KWKA 3QZTA 2G45A 2K4DA 2I7KA 4CUQA 5KO4A 3KV6A 4LZRA 4QSRA 3T6RA 1EQFA 2I50A 4NQNA 2LXPC 4A9FA 5HCLA 1Z6UA 3T7LA 5CPEA 5IBNA 4IC2A 3SHBA 1WEPA 4YYKA 3LQIA 2VPBA 3MUKA 4OUFA 4XY8A 5IGKA 2YW8A 4CUUA 3L11A 3MB3A 4LR6A 4YBTA 3MQMA 4O7FA 3N9PA 2VJEB 4O78A 2RO1A 3N9MA 1HYIA 5E74A 5I86A 2N9GA 5DKDA 4LRGA 2NXBA 5A81A 5G4RA 5L96A 5LJ0A 5CS8A 5CY9A 5KH7A 3Q2FA 3MHHA 5CUBA 2PUYA 2G6QA 1FBVA 1BORA 3FL2A 3KV5A 5LKTA 3MXFA 5EWWA 2LN0A 4RVRA 5CUGA 4CUPA 2H0DB 5A5PA 3D7CA 2LGVA 5B76A 2YHOA 2QIZA 3JVJA 2YQDA 5F62A 2VJFA 5I83A 3SVHA 4NUEA 1WEOA 3L1XA 3P5OA 2NAAA 4V3KC 5LKZA 2RS9B 4YBMA 4ZC9A 5TCMA 5ENBA 4IC3A 5EPSA 3DQVR 4NR6A 5D3SA 3FKMX 4O71A 5CQ6A 4I7DA 4CL9A 5I1QA 4ZQLA 5F60A 5LJ2A 2KFTA 3I2DA 4GNFA 3RPGB 3LRQA 2PNXA 5F36A 1WUGA 4MR3A 4YYDA 3LQHA 3Q2EA 5E9MA 5KTWA 4O64A 4A4CA 5EM3A 4QSVA 1U6GB 3IHPA 3MHSA 2YDWA 5E9YA 5L99A 5FFWA 4HXPA 4TT6A 4TU4A 4NN2A 1T1HA 5D3TA 5FE4A 2YHNA 2E6SA 1JM7A 2MT5A 4OGIA 1F68A 3QZSA 3DAIA 5D3NA 3PUQA 2K1JA 4MSXA 2M6MA 1CHCA 5D3RA 4IOOA 3U5OA 4MR4A 5EWVA 4QF3A 3HMEA 2D82A 3ZPV1 5D26A 4NR9A 3TLPA 3ONIA 4NR5A 5I89A 3O7AA 3DWYA 4IR3A 4FLPA 5HRWA 5FE8A 5E7DA 5HFRA 4F52B 2LXHC 4A9KA 4HXMA 5EGUA 2DVVA 2E6RA 3O33A 4O76A 2LGKA 4CFKA 4YBSA 3HCSA 3NG2A 5I7YA 5TDWA 5DYAA 3AQAA 5FE7A 4TKPB 5EK9A 4DONA 2KWNA 4R8PK 4Y03A 5H9MA 2L75A 4UYDA 2GRCA 5DX4A 4AP4A 5FB0A 2YEKA 5LJ1A 4HXSA 4QC3A 5D3JA 3RPGC 5TB6A 2MUMA 4YYJA 2RFJA 4UIYA 4NRAA 2RSDA 2OUOA 4IOQA 4UIUA 5HJCA 2F42A 1E6IA 4UIZA 4HXNA 2R10A 4HBWA 4O75A 4CURA 4YYGA 5AIUA 5ENHA 5ENJA 4GB0A 2LSPB 2YUCA 4Z93A 2ECIA 5DFCA 4TYLA 3QZVA 5EA1A 3UVYA 5KH3A 2YELA 3EB6A 4TT2A 5F1LA 5DY7A 2L0BA 4UYFA 2H60A 4A9JA 5LKUA 3HTKC 4CUSA 5DFBA 4O7BA 4HXLA 4YAXA 5IGNA 2JMJA 5A5QA 4AYCB 1K2FA 2EODA 4UP5A 3O36A 4TQNA 4LYSA 5EVAA 2FUIA 5I3LA 4A9LA 5D3HA 5EU1A 1LDKC 2YSJA 3JVKA 4HBVA 2F6JA 4WIVA 5L97A 4A9OA 5HELA 3KNVA 4LK9A 5II2A 4X2IA 5C85A 5L8UA 3LJWA 5EWDA 3U5JA 1F62A 4CLBA 1VYXA 3JVMA 2E7OA 3U5MA 5D3PA 5J3XA 3S91A 4Z1QA 4TTEA 4TU6A 4LYIA 4LZSA 4UYGA 5IGMA 4NR4A 4C67A 2CSZA 2VPEA 5DYCA 2DKWA 3ASLA 3HCTA 3SOUA 5JI8A 4XI1A 4QSSA 2KYUA 4OGJA 4V3LC 2L85A 5FB1A 4FJCA 4Q0NA 3L1ZB 3AADA 4NRCA 5F61A 4KV4A 1WEMA 3ZYUA 2DVQA 2RI7A 3U5LA 4PY6A 4NS5A 4NR7A 5C13A 4BW4A 5ETBA 2LGGA 4MEQA 5A7CA 5AD3A 2OO1A 2DVRA 5F1HA 4QR4A 5CP5A 4UP0A 4NUCA 5FFYA 2YURA 4PTBA 5KH9A 5FE2A 1N87A 5CRZA 4B7YC 4TZ8A 2M85A 4UIVA 5A82A 4WZ0A 4WHWA 5EYAF 5HFQA 5IG6A 5TABA 4WZ2A 5G0FA 3ZTGA 2VJFB 2AN6A 2Y1MA 2KGIA 1XWHA 3UV5A 4F3IA 5A5SA 2F6NA 3P1CA 4NXJA 4UIXA 5E3GA 5C7NA 4YY4A 1X4UA 5DKCA 4AUQB 4GNDA 5CQAA 4HBYA 5C89A 1WEWA 4Q6FA 5EISA 3MB4A 5DINA 4TS8A 4NYWA 2Y43A 4Z6HA 3N9OA 4NRBA 2KIZA 4ZDTA 2C2VS 4ALHA 1WESA 4TT4A 5CUCA 4IORA 5G4SA 2CKLA 5FE5A 5EPBA 4L7XA 3IU5A 3HMFA 5ENIA 3KQIA 5B75A 1ZBDB 1G25A 4NUDA 3UVXA 5F2PA 5A83A 5BT5A 5CQ4A 4O72A 2YSMA 5E9IA 4WA6A 3PURA 3ZVYA 2DVSA 5TBNA 5E9VA 4YADA 5DW1A 4TZ2A 5F25A 5FE9A 4PCIA 2OSSA 3O34A 5CQ8A 5F5ZA 4XUBA 3PHDA 2YEMA 5IIDA 2KWOA 4QSXA 4QSTA 4IR4A 2ZETC 5C11A 5DYUA 5D25A 5LUUA 2K16A 5D1MB 5DW2A 2VJEA 2D8SA 4YK0A 4ALGA 5FG6A 5FH7A 2XEUA 4O7CA 5DYXA 2L84A 2FUUA 2MD8C 2ECGA 4HXKA 5A5NA 5D0CA 1LDJB 3DPLR 4QSWA 5FG4A 2HYED 4WHUA 4GNGA 2LQ6A 5CRMA 3VK6A 1N72A 5AITA 2MA6A 2H0DA 3ZYQA 3MULA 2KGGA 4QB3A 2MNZA 5FG5A 5IGLA 4FK5A 4A9NA 5G05B 1Z2QA 1WEQA 5CQ7A 5E73A 4Q0OA 4QR5A 5LVQA 4CUTA 3P1DA 1DVPA 2RNWA 4BHWA 3N9NA 4LC2A 3S92A 4LLBA 4KCXA 5ENCA 2G43A 4C9ZA 5I7XA 2DX8A 5C87A 3ZPVE 3SVFA 3ZNIA 5CZGA 3U5KA 5CUAA 5K29A 2XB1A 4O77A 3P1FA 5G04B 5AMFA 5I80A 5FE1A 4YH4A 5DFDA 5ETDA 2YT5A 4PPEA 4QEWA 4A4BA 4A9IA 3GL6A 5DLZA 3UV2A 2YU4A 5HQ6A 2E3KA 5A5RA 4LZ2A 4UITA 5FH8A 2YW5A 4P5OB 1IYMA 3UVWA 5JWMA 4Z6IA 5D7XA 4W4UA 5CGPA 3LQJA 4J0SA 2RNYA 4O74A 2DWWA 3SVGA 3O35A 2WP1A 4J1PA 4QEVA 5A5OA 2QJ0A 5H85A 1JM7B 3C5KA 5LKXA 3RCWA 5HQ5A 2L43A 2CT2A 5DKHA 1WIMA 5F63A 4YH3A 5FBXA 1JSPB 2UZGA 4QR3A 5DLXA 3M63A 5I29A 3GV4A 4QUUA 5COIA 2OXQC 5B79A 5H1UA 5A85A 4E96A 5EQ1A 4QC1A 4A9EA 5BT4A 2MJVB 2EA6A 1JOCA 2E7NA 1VD4A 4BW2A 5D24A 4UYEA 2BAYA 2MNYA 4N4IA 2EGPA 4MVTA 4MEPA 4QY4A 4XUAA 4O7AA 5HQ7A 4YC9A 5I88A 4LYWA 2YQMA 1X0JA 5E9KA 3M99A 4PS5A 4FO9A 4L58A 5D3LA 1E4UA 4A9HA 4N4HA 4N3WA 5FEYA 4NR8A 3UV4A 2VNFA 2MIQA 5H1TA 3NXBA 5EV9A 4ZUXU 4NYVA 4AVXA 5KHMA 4QYLA 2ECTA 4PCEA 1X4IA 4YYMA 5D1LB 2D9EA 1FP0A 1WEUA 2IDAA 5DKAA 4O70A 5CQ5A 2M3HA 2QICA 5C4QA 2YREA 5FFVA 4QSPA 4YABA 2LV9A 2KE1A 3I3JA 4HBXA 4AYCA 5ENFA 4NQMA 4BW3A 5CQTA 4QSQA 2YYRA 4QBMA 4AKNA 2ECJA 4UYFB 4XY9A 1V87A 4BBQA 3O70A 3SOXA 5FE3A 4KV1A 1HYJA 5E0RA 5B78A 3U5NA 4O7EA 4YYIA 1WEVA 5B8DA 3K2JA 5E9LA 4QNSA 2VPGA 2YQLA 5LCWB 4I7BA 5CUDA 5DBMA 5KTXA 5LVRA 4N4GA 5TDRA 4CA1A 1WEEA 3HMHA 4QF2A 5ENEA 4CFLA 2LRIC 5KTUA 2KWJA 5CTLA 1WENA 4MR5A 4A9MA 4S3OB 5ACYA 5C8GA 5HLSA 5FE0A 1WILA 2KR4A 5CU8A 2K17A 2ECVA 5FE6A 2L80A 4J3IA 2C2LA 1MM2A 4YYNA 3V43A 4HXRA 2VP7A 5HEMA 5AMEA 2R0VA 4IR6A 2VPDA 5HM0A 4J0RA 5L8TA 3JVLA 4YYHA 4N4FA 3GG3A 3M62A 3SOWA 4BW1A 3G0JA 2ECNA 2KREA 2DATA 3UW9A 5CUEA 5E3DA 1WUMA 2KTBB 4FIPA 5EWHA 5TRBA 2MA5A 4QYDA 4YY6A 2JRJA 4A49A 4R7EA 2Y1NA 4QZSA 2R0SA 4UYHA 4R2YA 4PKLA 1RMDA 1X4JA 5ENGA 2G4AA 2RNXA 4BJXA 2CSYA 3N9QA 5EICA 3RTRB 5JG6A 2JMIA 3UVDA 2L5UA 3O37A
chains in the Genus database with same CATH superfamily
4ZW1A 4C66A 1WGMA 3ZVZB 4IR5A 5FH6A 4UIWA 3U5PA 4B86C 5AD2A 3LXJA 5HENA 1ZS5A 3HCUA 5II1A 4UI9B 1Z60A 2MKEA 5FERA 5CQ3A 2HDPA 4LJNA 2LGLA 5BT3A 5EI4A 5B77A 4S3OC 2I8NA 1VFYA 4GNEA 4LDFA 5FDZA 4NYXA 2WP2A 3EB5A 2YYNA 4H9DA 4I7CA 5CFWA 5EPRA 3C6WA 3LDYA 2M1RA 2FSAA 2JMDA 4HXOA 2D8UA 4LKAA 5H1VA 5EWCA 4X3GA 4LADB 4MR6A 4MEOA 5KU3A 2KU3A 3E2DA 2R0YA 3P1EA 3H7HA 1MM3A 5D1KB 4CCGX 4Z1SA 1WE9A 4MENA 5HRXA 4GPJA 4QEUA 2CKLB 5EP7A 2ECWA 4YATA 3N9LA 4WZ3B 3IU6A 2LDRA 4QSUA 5I40A 4A0CD 5F3AA 4QUTA 5HRVA 5L98A 4XYAA 3G0LA 2JM3A 4Z0RA 5J0DA 1MBMA 2L5EA 1WFKA 2MD7B 1JM4B 2KWKA 3QZTA 2G45A 2K4DA 2I7KA 4CUQA 5KO4A 3KV6A 4LZRA 4QSRA 3T6RA 1EQFA 2I50A 5SVXA 4NQNA 2LXPC 4A9FA 5HCLA 1Z6UA 3T7LA 5CPEA 5IBNA 4IC2A 3SHBA 1WEPA 3D1DA 3LQIA 4YYKA 3MUKA 4OUFA 4XY8A 5IGKA 2VPBA 2YW8A 4CUUA 3L11A 3MB3A 4LR6A 3Q1DA 4YBTA 3MQMA 4O7FA 3N9PA 2VJEB 4O78A 2RO1A 3N9MA 1HYIA 5E74A 5I86A 3VKGA 2N9GA 5DKDA 4LRGA 2NXBA 5A81A 5G4RA 5L96A 5LJ0A 5CS8A 5CY9A 2DSMA 5KH7A 3Q2FA 3MHHA 5CUBA 2PUYA 2G6QA 2L7PA 1FBVA 1BORA 3FL2A 3KV5A 5LKTA 3MXFA 5EWWA 2LN0A 4RVRA 5CUGA 4CUPA 2H0DB 2IQJA 5A5PA 3D7CA 3D1BA 2LGVA 2YHOA 2QIZA 3FANA 5B76A 3JVJA 2YQDA 5F62A 2VJFA 5I83A 3SVHA 4NUEA 1WEOA 3L1XA 3P5OA 2NAAA 4V3KC 5SVIA 5LKZA 2RS9B 4YBMA 4ZC9A 5TCMA 5ENBA 3FJUB 4IC3A 5EPSA 3KDEC 3DQVR 4NR6A 5D3SA 3FKMX 4O71A 5CQ6A 4I7DA 4CL9A 2OWAA 3FM8C 5I1QA 4ZQLA 5F60A 5LJ2A 2KFTA 3I2DA 4GNFA 3RPGB 4F1PA 3LJUX 3LRQA 2PNXA 5F36A 1WUGA 4MR3A 4YYDA 3LQHA 3Q2EA 5E9MA 5KTWA 4O64A 4A4CA 5EM3A 4QSVA 1U6GB 3IHPA 3MHSA 2YDWA 5E9YA 5L99A 5FFWA 4HXPA 4TT6A 4TU4A 4NN2A 1T1HA 5D3TA 5FE4A 2YHNA 2E6SA 1JM7A 2MT5A 4OGIA 1F68A 3QZSA 3DAIA 5D3NA 3PUQA 2K1JA 4MSXA 2M6MA 1CHCA 5D3RA 4IOOA 3U5OA 4MR4A 5EWVA 2YVRA 4QF3A 3HMEA 1ZKRA 2D82A 3ZPV1 5D26A 4NR9A 3TLPA 3ONIA 4NR5A 5I89A 3O7AA 3DWYA 4IR3A 4FLPA 5HRWA 5FE8A 5E7DA 5HFRA 4F52B 2LXHC 4A9KA 4HXMA 5EGUA 2DVVA 2E6RA 3O33A 4O76A 2LGKA 4CFKA 4YBSA 3HCSA 3NG2A 5I7YA 5TDWA 5DYAA 3AQAA 5FE7A 4TKPB 5EK9A 4DONA 2KWNA 4R8PK 4Y03A 5H9MA 2L75A 4UYDA 2GRCA 5DX4A 4AP4A 5FB0A 2YEKA 5LJ1A 4HXSA 4QC3A 5D3JA 3RPGC 5TB6A 2MUMA 4YYJA 2RFJA 4UIYA 4NRAA 2RSDA 2OUOA 4IOQA 4UIUA 5HJCA 2F42A 1E6IA 4UIZA 4HXNA 2R10A 4HBWA 4O75A 4CURA 4OGCA 4YYGA 5AIUA 5ENHA 5ENJA 4GB0A 2LSPB 2YUCA 4Z93A 2ECIA 4AI6A 5DFCA 4TYLA 3MDBC 3QZVA 5EA1A 3UVYA 2RR4A 5KH3A 2YELA 1PUOA 4TT2A 5F1LA 5DY7A 2L0BA 3EB6A 4UYFA 2H60A 4A9JA 5LKUA 3DDTA 4CUSA 5DFBA 3HTKC 4O7BA 4HXLA 4AKGA 3JUEA 4YAXA 5IGNA 2JMJA 5A5QA 4AYCB 1K2FA 2EODA 4UP5A 3O36A 4TQNA 4LYSA 5EVAA 2FUIA 5I3LA 4A9LA 5D3HA 5EU1A 1LDKC 2YSJA 3JVKA 4HBVA 2F6JA 4WIVA 5L97A 4A9OA 5HELA 3KNVA 4LK9A 5II2A 4X2IA 5C85A 5L8UA 3LJWA 2LAUA 5EWDA 3U5JA 1F62A 4CLBA 1VYXA 3JVMA 2E7OA 3U5MA 5D3PA 5J3XA 3S91A 4Z1QA 4TTEA 4TU6A 4LYIA 4LZSA 2KKYA 4UYGA 2XP0A 5IGMA 4NR4A 4C67A 2CSZA 2VPEA 5DYCA 2DKWA 3ASLA 3HCTA 3SOUA 5JI8A 1DCQA 4XI1A 4QSSA 2KYUA 4OGJA 4V3LC 2L85A 5FB1A 4FJCA 4Q0NA 3L1ZB 3AADA 4NRCA 2M13A 5F61A 4KV4A 1WEMA 3ZYUA 2DVQA 2RI7A 3U5LA 3VKHA 4PY6A 4NS5A 4O62A 4NR7A 5C13A 4BW4A 5ETBA 2LGGA 4MEQA 5A7CA 5AD3A 2OO1A 2DVRA 5F1HA 4QR4A 5CP5A 4UP0A 4NUCA 5FFYA 2YURA 4PTBA 5KH9A 5FE2A 2E61A 1N87A 5CRZA 4B7YC 4TZ8A 2M85A 4UIVA 5A82A 4WZ0A 4WHWA 5EYAF 5HFQA 5IG6A 5TABA 4WZ2A 5G0FA 3ZTGA 2VJFB 5K3QA 2AN6A 2Y1MA 2KGIA 1XWHA 3UV5A 4F3IA 5A5SA 2F6NA 3P1CA 4NXJA 4UIXA 5E3GA 5C7NA 4YY4A 1X4UA 5DKCA 4AUQB 4GNDA 5CQAA 4HBYA 5C89A 1WEWA 4Q6FA 5EISA 3MB4A 5DINA 4TS8A 4NYWA 2XOYA 2Y43A 2JUNA 4Z6HA 3N9OA 4NRBA 2KIZA 4ZDTA 2C2VS 4ALHA 1WESA 4TT4A 2CRRA 5CUCA 4IORA 5G4SA 2CKLA 5FE5A 5EPBA 4L7XA 3IU5A 4QQ4A 3HMFA 5ENIA 3KQIA 5B75A 2DJAA 1ZBDB 1G25A 4NUDA 3UVXA 5F2PA 5A83A 2FFWA 5BT5A 5CQ4A 4O72A 2YSMA 5E9IA 4WA6A 3PURA 3ZVYA 2DVSA 4OGEA 5E9VA 4YADA 5DW1A 5TBNA 4TZ2A 5F25A 5FE9A 4PCIA 2OSSA 3O34A 5CQ8A 5F5ZA 4XUBA 2EGMA 3PHDA 2YEMA 3FAOA 4AKHA 5IIDA 2KWOA 4QSXA 4QSTA 4IR4A 2ZETC 5C11A 5DYUA 5D25A 5LUUA 2K16A 5D1MB 5DW2A 2VJEA 2D8SA 4YK0A 4ALGA 5FG6A 5FH7A 2XEUA 4O7CA 5DYXA 2L84A 2FUUA 2MD8C 2ECGA 4HXKA 5A5NA 5D0CA 1LDJB 3DPLR 4QSWA 5FG4A 2HYED 4WHUA 4GNGA 2LQ6A 5CRMA 3VK6A 1N72A 5AITA 2MA6A 2H0DA 3ZYQA 3MULA 2KGGA 4QB3A 2MNZA 5FG5A 5IGLA 4FK5A 2P57A 3PLWA 4A9NA 5G05B 1Z2QA 1WEQA 5CQ7A 5E73A 4Q0OA 4QR5A 5LVQA 4CUTA 3P1DA 1DVPA 2RNWA 4BHWA 2CSVA 3N9NA 4LC2A 3S92A 4LLBA 4KCXA 5ENCA 2G43A 2CRWA 4C9ZA 5I7XA 2DX8A 2CONA 5C87A 3ZPVE 3SVFA 5SVIB 3ZNIA 5CZGA 3U5KA 5CUAA 5K29A 2XB1A 4O77A 3P1FA 5G04B 5AMFA 5I80A 5FE1A 4YH4A 5DFDA 5ETDA 2YT5A 4PPEA 3ERRA 4QEWA 4A4BA 4A9IA 3GL6A 5DLZA 3UV2A 2YU4A 3FEHA 3O47A 5HQ6A 2E3KA 5A5RA 4LZ2A 4UITA 5FH8A 2YW5A 4P5OB 1IYMA 3UVWA 5JWMA 4Z6IA 5D7XA 4W4UA 5CGPA 3LQJA 3M7KA 4J0SA 4AKIA 2RNYA 4O74A 2DWWA 3SVGA 3O35A 2WP1A 4J1PA 4QEVA 5A5OA 2QJ0A 5H85A 1JM7B 3C5KA 5LKXA 3RCWA 5HQ5A 2L43A 2CT2A 5DKHA 1WIMA 5F63A 4YH3A 5FBXA 1JSPB 2UZGA 4QR3A 5DLXA 3M63A 5I29A 3GV4A 4QUUA 5COIA 2OXQC 5B79A 5H1UA 2EXUA 5A85A 4E96A 3LVQE 2EJNA 5EQ1A 4QC1A 4A9EA 5BT4A 2MJVB 2EA6A 1JOCA 2E7NA 1VD4A 4BW2A 5D24A 4UYEA 2BAYA 2MNYA 4N4IA 3LVRE 2EGPA 4MVTA 4MEPA 4QY4A 4XUAA 4O7AA 5HQ7A 4YC9A 5I88A 4LYWA 2YQMA 1X0JA 5E9KA 3M99A 4PS5A 4FO9A 4L58A 5D3LA 1E4UA 4A9HA 4N4HA 4N3WA 5FEYA 4NR8A 3UV4A 2VNFA 2MIQA 5H1TA 3NXBA 5EV9A 4ZUXU 4NYVA 4AVXA 5KHMA 4QYLA 2ECTA 4PCEA 1X4IA 4YYMA 5D1LB 2D9EA 1FP0A 1WEUA 2IDAA 5DKAA 4O70A 3T9KA 5CQ5A 2M3HA 2QICA 5C4QA 2YREA 5FFVA 4QSPA 4YABA 2LV9A 2KE1A 3I3JA 4HBXA 4AYCA 5ENFA 4NQMA 4BW3A 5CQTA 4QSQA 2YYRA 4QBMA 4AKNA 2ECJA 4UYFB 4XY9A 1V87A 4BBQA 3O70A 3SOXA 5FE3A 4KV1A 1HYJA 5E0RA 5B78A 3U5NA 4O7EA 4YYIA 1WEVA 5B8DA 3K2JA 5E9LA 4QNSA 2VPGA 2YQLA 5LCWB 4I7BA 5CUDA 5DBMA 5KTXA 5LVRA 4N4GA 5TDRA 4CA1A 2B0OE 1WEEA 3HMHA 3DWDA 4QF2A 5ENEA 4CFLA 2LRIC 5KTUA 2KWJA 5CTLA 1WENA 4MR5A 4A9MA 4S3OB 5ACYA 3SUBA 5C8GA 5HLSA 5FE0A 1WILA 2KR4A 5CU8A 2K17A 5SVYA 2ECVA 5FE6A 2L80A 4J3IA 2C2LA 1MM2A 4YYNA 2KKXA 3V43A 4HXRA 2VP7A 5HEMA 5AMEA 2R0VA 4IR6A 2FD4A 2VPDA 5HM0A 4J0RA 5L8TA 3JVLA 4YYHA 4N4FA 3GG3A 3M62A 3SOWA 4BW1A 3G0JA 2ECNA 2KREA 2DATA 3UW9A 5CUEA 5E3DA 1WUMA 2KTBB 4FIPA 4Z0OA 5EWHA 5TRBA 2XOCA 2MA5A 4QYDA 4YY6A 2JRJA 4A49A 4R7EA 2Y1NA 4QZSA 2R0SA 4UYHA 4R2YA 4PKLA 1RMDA 1X4JA 5ENGA 2G4AA 2RNXA 4BJXA 2CSYA 3N9QA 5EICA 3RTRB 2XOZA 5JG6A 2JMIA 3UVDA 2L5UA 3O37A
chains in the Genus database with same CATH topology
4ZW1A 4C66A 1WGMA 3ZVZB 4IR5A 5FH6A 4UIWA 3U5PA 4B86C 5AD2A 3LXJA 5HENA 1ZS5A 3HCUA 5II1A 4UI9B 1Z60A 5FERA 5CQ3A 2HDPA 4LJNA 2LGLA 5BT3A 5EI4A 5B77A 4S3OC 2I8NA 1VFYA 4GNEA 4LDFA 5FDZA 4NYXA 2WP2A 3EB5A 2YYNA 4I7CA 5CFWA 5EPRA 3C6WA 2M1RA 2FSAA 2JMDA 4HXOA 4LKAA 5H1VA 5EWCA 4X3GA 4LADB 4MR6A 4MEOA 5KU3A 2KU3A 5D1KB 2R0YA 3P1EA 1MM3A 4CCGX 4Z1SA 1WE9A 4MENA 5HRXA 4GPJA 4QEUA 2CKLB 5EP7A 2ECWA 4YATA 3N9LA 4WZ3B 3IU6A 2LDRA 4QSUA 5I40A 4A0CD 5F3AA 4QUTA 5HRVA 5L98A 4XYAA 3G0LA 5J0DA 2L5EA 1WFKA 2MD7B 1JM4B 2KWKA 3QZTA 2G45A 2K4DA 2I7KA 4CUQA 5KO4A 3KV6A 4LZRA 4QSRA 3T6RA 1EQFA 2I50A 4NQNA 2LXPC 4A9FA 5HCLA 1Z6UA 3T7LA 5CPEA 5IBNA 4IC2A 3SHBA 1WEPA 4YYKA 3LQIA 2VPBA 3MUKA 4OUFA 4XY8A 5IGKA 2YW8A 4CUUA 3L11A 3MB3A 4LR6A 4YBTA 3MQMA 4O7FA 3N9PA 2VJEB 4O78A 2RO1A 3N9MA 1HYIA 5E74A 5I86A 2N9GA 5DKDA 4LRGA 2NXBA 5A81A 5G4RA 5L96A 5LJ0A 5CS8A 5CY9A 5KH7A 3Q2FA 3MHHA 5CUBA 2PUYA 2G6QA 1FBVA 1BORA 3FL2A 3KV5A 5LKTA 3MXFA 5EWWA 2LN0A 4RVRA 5CUGA 4CUPA 2H0DB 5A5PA 3D7CA 2LGVA 5B76A 2YHOA 2QIZA 3JVJA 2YQDA 5F62A 2VJFA 5I83A 3SVHA 4NUEA 1WEOA 3L1XA 3P5OA 2NAAA 4V3KC 5LKZA 2RS9B 4YBMA 4ZC9A 5TCMA 5ENBA 4IC3A 5EPSA 3DQVR 4NR6A 5D3SA 3FKMX 4O71A 5CQ6A 4I7DA 4CL9A 5I1QA 4ZQLA 5F60A 5LJ2A 2KFTA 3I2DA 4GNFA 3RPGB 3LRQA 2PNXA 5F36A 1WUGA 4MR3A 4YYDA 3LQHA 3Q2EA 5E9MA 5KTWA 4O64A 4A4CA 5EM3A 4QSVA 1U6GB 3IHPA 3MHSA 2YDWA 5E9YA 5L99A 5FFWA 4HXPA 4TT6A 4TU4A 4NN2A 1T1HA 5D3TA 5FE4A 2YHNA 2E6SA 1JM7A 2MT5A 4OGIA 1F68A 3QZSA 3DAIA 5D3NA 3PUQA 2K1JA 4MSXA 2M6MA 1CHCA 5D3RA 4IOOA 3U5OA 4MR4A 5EWVA 4QF3A 3HMEA 2D82A 3ZPV1 5D26A 4NR9A 3TLPA 3ONIA 4NR5A 5I89A 3O7AA 3DWYA 4IR3A 4FLPA 5HRWA 5FE8A 5E7DA 5HFRA 4F52B 2LXHC 4A9KA 4HXMA 5EGUA 2DVVA 2E6RA 3O33A 4O76A 2LGKA 4CFKA 4YBSA 3HCSA 3NG2A 5I7YA 5TDWA 5DYAA 3AQAA 5FE7A 4TKPB 5EK9A 4DONA 2KWNA 4R8PK 4Y03A 5H9MA 2L75A 4UYDA 2GRCA 5DX4A 4AP4A 5FB0A 2YEKA 5LJ1A 4HXSA 4QC3A 5D3JA 3RPGC 5TB6A 2MUMA 4YYJA 2RFJA 4UIYA 4NRAA 2RSDA 2OUOA 4IOQA 4UIUA 5HJCA 2F42A 1E6IA 4UIZA 4HXNA 2R10A 4HBWA 4O75A 4CURA 4YYGA 5AIUA 5ENHA 5ENJA 4GB0A 2LSPB 2YUCA 4Z93A 2ECIA 5DFCA 4TYLA 3QZVA 5EA1A 3UVYA 5KH3A 2YELA 3EB6A 4TT2A 5F1LA 5DY7A 2L0BA 4UYFA 2H60A 4A9JA 5LKUA 3HTKC 4CUSA 5DFBA 4O7BA 4HXLA 4YAXA 5IGNA 2JMJA 5A5QA 4AYCB 1K2FA 2EODA 4UP5A 3O36A 4TQNA 4LYSA 5EVAA 2FUIA 5I3LA 4A9LA 5D3HA 5EU1A 1LDKC 2YSJA 3JVKA 4HBVA 2F6JA 4WIVA 5L97A 4A9OA 5HELA 3KNVA 4LK9A 5II2A 4X2IA 5C85A 5L8UA 3LJWA 5EWDA 3U5JA 1F62A 4CLBA 1VYXA 3JVMA 2E7OA 3U5MA 5D3PA 5J3XA 3S91A 4Z1QA 4TTEA 4TU6A 4LYIA 4LZSA 4UYGA 5IGMA 4NR4A 4C67A 2CSZA 2VPEA 5DYCA 2DKWA 3ASLA 3HCTA 3SOUA 5JI8A 4XI1A 4QSSA 2KYUA 4OGJA 4V3LC 2L85A 5FB1A 4FJCA 4Q0NA 3L1ZB 3AADA 4NRCA 5F61A 4KV4A 1WEMA 3ZYUA 2DVQA 2RI7A 3U5LA 4PY6A 4NS5A 4NR7A 5C13A 4BW4A 5ETBA 2LGGA 4MEQA 5A7CA 5AD3A 2OO1A 2DVRA 5F1HA 4QR4A 5CP5A 4UP0A 4NUCA 5FFYA 2YURA 4PTBA 5KH9A 5FE2A 1N87A 5CRZA 4B7YC 4TZ8A 2M85A 4UIVA 5A82A 4WZ0A 4WHWA 5EYAF 5HFQA 5IG6A 5TABA 4WZ2A 5G0FA 3ZTGA 2VJFB 2AN6A 2Y1MA 2KGIA 1XWHA 3UV5A 4F3IA 5A5SA 2F6NA 3P1CA 4NXJA 4UIXA 5E3GA 5C7NA 4YY4A 1X4UA 5DKCA 4AUQB 4GNDA 5CQAA 4HBYA 5C89A 1WEWA 4Q6FA 5EISA 3MB4A 5DINA 4TS8A 4NYWA 2Y43A 4Z6HA 3N9OA 4NRBA 2KIZA 4ZDTA 2C2VS 4ALHA 1WESA 4TT4A 5CUCA 4IORA 5G4SA 2CKLA 5FE5A 5EPBA 4L7XA 3IU5A 3HMFA 5ENIA 3KQIA 5B75A 1ZBDB 1G25A 4NUDA 3UVXA 5F2PA 5A83A 5BT5A 5CQ4A 4O72A 2YSMA 5E9IA 4WA6A 3PURA 3ZVYA 2DVSA 5TBNA 5E9VA 4YADA 5DW1A 4TZ2A 5F25A 5FE9A 4PCIA 2OSSA 3O34A 5CQ8A 5F5ZA 4XUBA 3PHDA 2YEMA 5IIDA 2KWOA 4QSXA 4QSTA 4IR4A 2ZETC 5C11A 5DYUA 5D25A 5LUUA 2K16A 5D1MB 5DW2A 2VJEA 2D8SA 4YK0A 4ALGA 5FG6A 5FH7A 2XEUA 4O7CA 5DYXA 2L84A 2FUUA 2MD8C 2ECGA 4HXKA 5A5NA 5D0CA 1LDJB 3DPLR 4QSWA 5FG4A 2HYED 4WHUA 4GNGA 2LQ6A 5CRMA 3VK6A 1N72A 5AITA 2MA6A 2H0DA 3ZYQA 3MULA 2KGGA 4QB3A 2MNZA 5FG5A 5IGLA 4FK5A 4A9NA 5G05B 1Z2QA 1WEQA 5CQ7A 5E73A 4Q0OA 4QR5A 5LVQA 4CUTA 3P1DA 1DVPA 2RNWA 4BHWA 3N9NA 4LC2A 3S92A 4LLBA 4KCXA 5ENCA 2G43A 4C9ZA 5I7XA 2DX8A 5C87A 3ZPVE 3SVFA 3ZNIA 5CZGA 3U5KA 5CUAA 5K29A 2XB1A 4O77A 3P1FA 5G04B 5AMFA 5I80A 5FE1A 4YH4A 5DFDA 5ETDA 2YT5A 4PPEA 4QEWA 4A4BA 4A9IA 3GL6A 5DLZA 3UV2A 2YU4A 5HQ6A 2E3KA 5A5RA 4LZ2A 4UITA 5FH8A 2YW5A 4P5OB 1IYMA 3UVWA 5JWMA 4Z6IA 5D7XA 4W4UA 5CGPA 3LQJA 4J0SA 2RNYA 4O74A 2DWWA 3SVGA 3O35A 2WP1A 4J1PA 4QEVA 5A5OA 2QJ0A 5H85A 1JM7B 3C5KA 5LKXA 3RCWA 5HQ5A 2L43A 2CT2A 5DKHA 1WIMA 5F63A 4YH3A 5FBXA 1JSPB 2UZGA 4QR3A 5DLXA 3M63A 5I29A 3GV4A 4QUUA 5COIA 2OXQC 5B79A 5H1UA 5A85A 4E96A 5EQ1A 4QC1A 4A9EA 5BT4A 2MJVB 2EA6A 1JOCA 2E7NA 1VD4A 4BW2A 5D24A 4UYEA 2BAYA 2MNYA 4N4IA 2EGPA 4MVTA 4MEPA 4QY4A 4XUAA 4O7AA 5HQ7A 4YC9A 5I88A 4LYWA 2YQMA 1X0JA 5E9KA 3M99A 4PS5A 4FO9A 4L58A 5D3LA 1E4UA 4A9HA 4N4HA 4N3WA 5FEYA 4NR8A 3UV4A 2VNFA 2MIQA 5H1TA 3NXBA 5EV9A 4ZUXU 4NYVA 4AVXA 5KHMA 4QYLA 2ECTA 4PCEA 1X4IA 4YYMA 5D1LB 2D9EA 1FP0A 1WEUA 2IDAA 5DKAA 4O70A 5CQ5A 2M3HA 2QICA 5C4QA 2YREA 5FFVA 4QSPA 4YABA 2LV9A 2KE1A 3I3JA 4HBXA 4AYCA 5ENFA 4NQMA 4BW3A 5CQTA 4QSQA 2YYRA 4QBMA 4AKNA 2ECJA 4UYFB 4XY9A 1V87A 4BBQA 3O70A 3SOXA 5FE3A 4KV1A 1HYJA 5E0RA 5B78A 3U5NA 4O7EA 4YYIA 1WEVA 5B8DA 3K2JA 5E9LA 4QNSA 2VPGA 2YQLA 5LCWB 4I7BA 5CUDA 5DBMA 5KTXA 5LVRA 4N4GA 5TDRA 4CA1A 1WEEA 3HMHA 4QF2A 5ENEA 4CFLA 2LRIC 5KTUA 2KWJA 5CTLA 1WENA 4MR5A 4A9MA 4S3OB 5ACYA 5C8GA 5HLSA 5FE0A 1WILA 2KR4A 5CU8A 2K17A 2ECVA 5FE6A 2L80A 4J3IA 2C2LA 1MM2A 4YYNA 3V43A 4HXRA 2VP7A 5HEMA 5AMEA 2R0VA 4IR6A 2VPDA 5HM0A 4J0RA 5L8TA 3JVLA 4YYHA 4N4FA 3GG3A 3M62A 3SOWA 4BW1A 3G0JA 2ECNA 2KREA 2DATA 3UW9A 5CUEA 5E3DA 1WUMA 2KTBB 4FIPA 5EWHA 5TRBA 2MA5A 4QYDA 4YY6A 2JRJA 4A49A 4R7EA 2Y1NA 4QZSA 2R0SA 4UYHA 4R2YA 4PKLA 1RMDA 1X4JA 5ENGA 2G4AA 2RNXA 4BJXA 2CSYA 3N9QA 5EICA 3RTRB 5JG6A 2JMIA 3UVDA 2L5UA 3O37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZW1 A;  4C66 A;  1WGM A;  3ZVZ B;  4IR5 A;  5FH6 A;  4UIW A;  3U5P A;  4B86 C;  5AD2 A;  3LXJ A;  5HEN A;  1ZS5 A;  3HCU A;  5II1 A;  4UI9 B;  1Z60 A;  5FER A;  5CQ3 A;  2HDP A;  4LJN A;  2LGL A;  5BT3 A;  5EI4 A;  5B77 A;  4S3O C;  2I8N A;  1VFY A;  4GNE A;  4LDF A;  5FDZ A;  4NYX A;  2WP2 A;  3EB5 A;  2YYN A;  4I7C A;  5CFW A;  5EPR A;  3C6W A;  2M1R A;  2FSA A;  2JMD A;  4HXO A;  4LKA A;  5H1V A;  5EWC A;  4X3G A;  4LAD B;  4MR6 A;  4MEO A;  5KU3 A;  2KU3 A;  5D1K B;  2R0Y A;  3P1E A;  1MM3 A;  4CCG X;  4Z1S A;  1WE9 A;  4MEN A;  5HRX A;  4GPJ A;  4QEU A;  2CKL B;  5EP7 A;  2ECW A;  4YAT A;  3N9L A;  4WZ3 B;  3IU6 A;  2LDR A;  4QSU A;  5I40 A;  4A0C D;  5F3A A;  4QUT A;  5HRV A;  5L98 A;  4XYA A;  3G0L A;  5J0D A;  2L5E A;  1WFK A;  2MD7 B;  1JM4 B;  2KWK A;  3QZT A;  2G45 A;  2K4D A;  2I7K A;  4CUQ A;  5KO4 A;  3KV6 A;  4LZR A;  4QSR A;  3T6R A;  1EQF A;  2I50 A;  4NQN A;  2LXP C;  4A9F A;  5HCL A;  1Z6U A;  3T7L A;  5CPE A;  5IBN A;  4IC2 A;  3SHB A;  1WEP A;  4YYK A;  3LQI A;  2VPB A;  3MUK A;  4OUF A;  4XY8 A;  5IGK A;  2YW8 A;  4CUU A;  3L11 A;  3MB3 A;  4LR6 A;  4YBT A;  3MQM A;  4O7F A;  3N9P A;  2VJE B;  4O78 A;  2RO1 A;  3N9M A;  1HYI A;  5E74 A;  5I86 A;  2N9G A;  5DKD A;  4LRG A;  2NXB A;  5A81 A;  5G4R A;  5L96 A;  5LJ0 A;  5CS8 A;  5CY9 A;  5KH7 A;  3Q2F A;  3MHH A;  5CUB A;  2PUY A;  2G6Q A;  1FBV A;  1BOR A;  3FL2 A;  3KV5 A;  5LKT A;  3MXF A;  5EWW A;  2LN0 A;  4RVR A;  5CUG A;  4CUP A;  2H0D B;  5A5P A;  3D7C A;  2LGV A;  5B76 A;  2YHO A;  2QIZ A;  3JVJ A;  2YQD A;  5F62 A;  2VJF A;  5I83 A;  3SVH A;  4NUE A;  1WEO A;  3L1X A;  3P5O A;  2NAA A;  4V3K C;  5LKZ A;  2RS9 B;  4YBM A;  4ZC9 A;  5TCM A;  5ENB A;  4IC3 A;  5EPS A;  3DQV R;  4NR6 A;  5D3S A;  3FKM X;  4O71 A;  5CQ6 A;  4I7D A;  4CL9 A;  5I1Q A;  4ZQL A;  5F60 A;  5LJ2 A;  2KFT A;  3I2D A;  4GNF A;  3RPG B;  3LRQ A;  2PNX A;  5F36 A;  1WUG A;  4MR3 A;  4YYD A;  3LQH A;  3Q2E A;  5E9M A;  5KTW A;  4O64 A;  4A4C A;  5EM3 A;  4QSV A;  1U6G B;  3IHP A;  3MHS A;  2YDW A;  5E9Y A;  5L99 A;  5FFW A;  4HXP A;  4TT6 A;  4TU4 A;  4NN2 A;  1T1H A;  5D3T A;  5FE4 A;  2YHN A;  2E6S A;  1JM7 A;  2MT5 A;  4OGI A;  1F68 A;  3QZS A;  3DAI A;  5D3N A;  3PUQ A;  2K1J A;  4MSX A;  2M6M A;  1CHC A;  5D3R A;  4IOO A;  3U5O A;  4MR4 A;  5EWV A;  4QF3 A;  3HME A;  2D82 A;  3ZPV 1;  5D26 A;  4NR9 A;  3TLP A;  3ONI A;  4NR5 A;  5I89 A;  3O7A A;  3DWY A;  4IR3 A;  4FLP A;  5HRW A;  5FE8 A;  5E7D A;  5HFR A;  4F52 B;  2LXH C;  4A9K A;  4HXM A;  5EGU A;  2DVV A;  2E6R A;  3O33 A;  4O76 A;  2LGK A;  4CFK A;  4YBS A;  3HCS A;  3NG2 A;  5I7Y A;  5TDW A;  5DYA A;  3AQA A;  5FE7 A;  4TKP B;  5EK9 A;  4DON A;  2KWN A;  4R8P K;  4Y03 A;  5H9M A;  2L75 A;  4UYD A;  2GRC A;  5DX4 A;  4AP4 A;  5FB0 A;  2YEK A;  5LJ1 A;  4HXS A;  4QC3 A;  5D3J A;  3RPG C;  5TB6 A;  2MUM A;  4YYJ A;  2RFJ A;  4UIY A;  4NRA A;  2RSD A;  2OUO A;  4IOQ A;  4UIU A;  5HJC A;  2F42 A;  1E6I A;  4UIZ A;  4HXN A;  2R10 A;  4HBW A;  4O75 A;  4CUR A;  4YYG A;  5AIU A;  5ENH A;  5ENJ A;  4GB0 A;  2LSP B;  2YUC A;  4Z93 A;  2ECI A;  5DFC A;  4TYL A;  3QZV A;  5EA1 A;  3UVY A;  5KH3 A;  2YEL A;  3EB6 A;  4TT2 A;  5F1L A;  5DY7 A;  2L0B A;  4UYF A;  2H60 A;  4A9J A;  5LKU A;  3HTK C;  4CUS A;  5DFB A;  4O7B A;  4HXL A;  4YAX A;  5IGN A;  2JMJ A;  5A5Q A;  4AYC B;  1K2F A;  2EOD A;  4UP5 A;  3O36 A;  4TQN A;  4LYS A;  5EVA A;  2FUI A;  5I3L A;  4A9L A;  5D3H A;  5EU1 A;  1LDK C;  2YSJ A;  3JVK A;  4HBV A;  2F6J A;  4WIV A;  5L97 A;  4A9O A;  5HEL A;  3KNV A;  4LK9 A;  5II2 A;  4X2I A;  5C85 A;  5L8U A;  3LJW A;  5EWD A;  3U5J A;  1F62 A;  4CLB A;  1VYX A;  3JVM A;  2E7O A;  3U5M A;  5D3P A;  5J3X A;  3S91 A;  4Z1Q A;  4TTE A;  4TU6 A;  4LYI A;  4LZS A;  4UYG A;  5IGM A;  4NR4 A;  4C67 A;  2CSZ A;  2VPE A;  5DYC A;  2DKW A;  3ASL A;  3HCT A;  3SOU A;  5JI8 A;  4XI1 A;  4QSS A;  2KYU A;  4OGJ A;  4V3L C;  2L85 A;  5FB1 A;  4FJC A;  4Q0N A;  3L1Z B;  3AAD A;  4NRC A;  5F61 A;  4KV4 A;  1WEM A;  3ZYU A;  2DVQ A;  2RI7 A;  3U5L A;  4PY6 A;  4NS5 A;  4NR7 A;  5C13 A;  4BW4 A;  5ETB A;  2LGG A;  4MEQ A;  5A7C A;  5AD3 A;  2OO1 A;  2DVR A;  5F1H A;  4QR4 A;  5CP5 A;  4UP0 A;  4NUC A;  5FFY A;  2YUR A;  4PTB A;  5KH9 A;  5FE2 A;  1N87 A;  5CRZ A;  4B7Y C;  4TZ8 A;  2M85 A;  4UIV A;  5A82 A;  4WZ0 A;  4WHW A;  5EYA F;  5HFQ A;  5IG6 A;  5TAB A;  4WZ2 A;  5G0F A;  3ZTG A;  2VJF B;  2AN6 A;  2Y1M A;  2KGI A;  1XWH A;  3UV5 A;  4F3I A;  5A5S A;  2F6N A;  3P1C A;  4NXJ A;  4UIX A;  5E3G A;  5C7N A;  4YY4 A;  1X4U A;  5DKC A;  4AUQ B;  4GND A;  5CQA A;  4HBY A;  5C89 A;  1WEW A;  4Q6F A;  5EIS A;  3MB4 A;  5DIN A;  4TS8 A;  4NYW A;  2Y43 A;  4Z6H A;  3N9O A;  4NRB A;  2KIZ A;  4ZDT A;  2C2V S;  4ALH A;  1WES A;  4TT4 A;  5CUC A;  4IOR A;  5G4S A;  2CKL A;  5FE5 A;  5EPB A;  4L7X A;  3IU5 A;  3HMF A;  5ENI A;  3KQI A;  5B75 A;  1ZBD B;  1G25 A;  4NUD A;  3UVX A;  5F2P A;  5A83 A;  5BT5 A;  5CQ4 A;  4O72 A;  2YSM A;  5E9I A;  4WA6 A;  3PUR A;  3ZVY A;  2DVS A;  5TBN A;  5E9V A;  4YAD A;  5DW1 A;  4TZ2 A;  5F25 A;  5FE9 A;  4PCI A;  2OSS A;  3O34 A;  5CQ8 A;  5F5Z A;  4XUB A;  3PHD A;  2YEM A;  5IID A;  2KWO A;  4QSX A;  4QST A;  4IR4 A;  2ZET C;  5C11 A;  5DYU A;  5D25 A;  5LUU A;  2K16 A;  5D1M B;  5DW2 A;  2VJE A;  2D8S A;  4YK0 A;  4ALG A;  5FG6 A;  5FH7 A;  2XEU A;  4O7C A;  5DYX A;  2L84 A;  2FUU A;  2MD8 C;  2ECG A;  4HXK A;  5A5N A;  5D0C A;  1LDJ B;  3DPL R;  4QSW A;  5FG4 A;  2HYE D;  4WHU A;  4GNG A;  2LQ6 A;  5CRM A;  3VK6 A;  1N72 A;  5AIT A;  2MA6 A;  2H0D A;  3ZYQ A;  3MUL A;  2KGG A;  4QB3 A;  2MNZ A;  5FG5 A;  5IGL A;  4FK5 A;  4A9N A;  5G05 B;  1Z2Q A;  1WEQ A;  5CQ7 A;  5E73 A;  4Q0O A;  4QR5 A;  5LVQ A;  4CUT A;  3P1D A;  1DVP A;  2RNW A;  4BHW A;  3N9N A;  4LC2 A;  3S92 A;  4LLB A;  4KCX A;  5ENC A;  2G43 A;  4C9Z A;  5I7X A;  2DX8 A;  5C87 A;  3ZPV E;  3SVF A;  3ZNI A;  5CZG A;  3U5K A;  5CUA A;  5K29 A;  2XB1 A;  4O77 A;  3P1F A;  5G04 B;  5AMF A;  5I80 A;  5FE1 A;  4YH4 A;  5DFD A;  5ETD A;  2YT5 A;  4PPE A;  4QEW A;  4A4B A;  4A9I A;  3GL6 A;  5DLZ A;  3UV2 A;  2YU4 A;  5HQ6 A;  2E3K A;  5A5R A;  4LZ2 A;  4UIT A;  5FH8 A;  2YW5 A;  4P5O B;  1IYM A;  3UVW A;  5JWM A;  4Z6I A;  5D7X A;  4W4U A;  5CGP A;  3LQJ A;  4J0S A;  2RNY A;  4O74 A;  2DWW A;  3SVG A;  3O35 A;  2WP1 A;  4J1P A;  4QEV A;  5A5O A;  2QJ0 A;  5H85 A;  1JM7 B;  3C5K A;  5LKX A;  3RCW A;  5HQ5 A;  2L43 A;  2CT2 A;  5DKH A;  1WIM A;  5F63 A;  4YH3 A;  5FBX A;  1JSP B;  2UZG A;  4QR3 A;  5DLX A;  3M63 A;  5I29 A;  3GV4 A;  4QUU A;  5COI A;  2OXQ C;  5B79 A;  5H1U A;  5A85 A;  4E96 A;  5EQ1 A;  4QC1 A;  4A9E A;  5BT4 A;  2MJV B;  2EA6 A;  1JOC A;  2E7N A;  1VD4 A;  4BW2 A;  5D24 A;  4UYE A;  2BAY A;  2MNY A;  4N4I A;  2EGP A;  4MVT A;  4MEP A;  4QY4 A;  4XUA A;  4O7A A;  5HQ7 A;  4YC9 A;  5I88 A;  4LYW A;  2YQM A;  1X0J A;  5E9K A;  3M99 A;  4PS5 A;  4FO9 A;  4L58 A;  5D3L A;  1E4U A;  4A9H A;  4N4H A;  4N3W A;  5FEY A;  4NR8 A;  3UV4 A;  2VNF A;  2MIQ A;  5H1T A;  3NXB A;  5EV9 A;  4ZUX U;  4NYV A;  4AVX A;  5KHM A;  4QYL A;  2ECT A;  4PCE A;  1X4I A;  4YYM A;  5D1L B;  2D9E A;  1FP0 A;  1WEU A;  2IDA A;  5DKA A;  4O70 A;  5CQ5 A;  2M3H A;  2QIC A;  5C4Q A;  2YRE A;  5FFV A;  4QSP A;  4YAB A;  2LV9 A;  2KE1 A;  3I3J A;  4HBX A;  4AYC A;  5ENF A;  4NQM A;  4BW3 A;  5CQT A;  4QSQ A;  2YYR A;  4QBM A;  4AKN A;  2ECJ A;  4UYF B;  4XY9 A;  1V87 A;  4BBQ A;  3O70 A;  3SOX A;  5FE3 A;  4KV1 A;  1HYJ A;  5E0R A;  5B78 A;  3U5N A;  4O7E A;  4YYI A;  1WEV A;  5B8D A;  3K2J A;  5E9L A;  4QNS A;  2VPG A;  2YQL A;  5LCW B;  4I7B A;  5CUD A;  5DBM A;  5KTX A;  5LVR A;  4N4G A;  5TDR A;  4CA1 A;  1WEE A;  3HMH A;  4QF2 A;  5ENE A;  4CFL A;  2LRI C;  5KTU A;  2KWJ A;  5CTL A;  1WEN A;  4MR5 A;  4A9M A;  4S3O B;  5ACY A;  5C8G A;  5HLS A;  5FE0 A;  1WIL A;  2KR4 A;  5CU8 A;  2K17 A;  2ECV A;  5FE6 A;  2L80 A;  4J3I A;  2C2L A;  1MM2 A;  4YYN A;  3V43 A;  4HXR A;  2VP7 A;  5HEM A;  5AME A;  2R0V A;  4IR6 A;  2VPD A;  5HM0 A;  4J0R A;  5L8T A;  3JVL A;  4YYH A;  4N4F A;  3GG3 A;  3M62 A;  3SOW A;  4BW1 A;  3G0J A;  2ECN A;  2KRE A;  2DAT A;  3UW9 A;  5CUE A;  5E3D A;  1WUM A;  2KTB B;  4FIP A;  5EWH A;  5TRB A;  2MA5 A;  4QYD A;  4YY6 A;  2JRJ A;  4A49 A;  4R7E A;  2Y1N A;  4QZS A;  2R0S A;  4UYH A;  4R2Y A;  4PKL A;  1RMD A;  1X4J A;  5ENG A;  2G4A A;  2RNX A;  4BJX A;  2CSY A;  3N9Q A;  5EIC A;  3RTR B;  5JG6 A;  2JMI A;  3UVD A;  2L5U A;  3O37 A; 
#chains in the Genus database with same CATH topology
 4ZW1 A;  4C66 A;  1WGM A;  3ZVZ B;  4IR5 A;  5FH6 A;  4UIW A;  3U5P A;  4B86 C;  5AD2 A;  3LXJ A;  5HEN A;  1ZS5 A;  3HCU A;  5II1 A;  4UI9 B;  1Z60 A;  2MKE A;  5FER A;  5CQ3 A;  2HDP A;  4LJN A;  2LGL A;  5BT3 A;  5EI4 A;  5B77 A;  4S3O C;  2I8N A;  1VFY A;  4GNE A;  4LDF A;  5FDZ A;  4NYX A;  2WP2 A;  3EB5 A;  2YYN A;  4H9D A;  4I7C A;  5CFW A;  5EPR A;  3C6W A;  3LDY A;  2M1R A;  2FSA A;  2JMD A;  4HXO A;  2D8U A;  4LKA A;  5H1V A;  5EWC A;  4X3G A;  4LAD B;  4MR6 A;  4MEO A;  5KU3 A;  2KU3 A;  3E2D A;  2R0Y A;  3P1E A;  3H7H A;  1MM3 A;  5D1K B;  4CCG X;  4Z1S A;  1WE9 A;  4MEN A;  5HRX A;  4GPJ A;  4QEU A;  2CKL B;  5EP7 A;  2ECW A;  4YAT A;  3N9L A;  4WZ3 B;  3IU6 A;  2LDR A;  4QSU A;  5I40 A;  4A0C D;  5F3A A;  4QUT A;  5HRV A;  5L98 A;  4XYA A;  3G0L A;  2JM3 A;  4Z0R A;  5J0D A;  1MBM A;  2L5E A;  1WFK A;  2MD7 B;  1JM4 B;  2KWK A;  3QZT A;  2G45 A;  2K4D A;  2I7K A;  4CUQ A;  5KO4 A;  3KV6 A;  4LZR A;  4QSR A;  3T6R A;  1EQF A;  2I50 A;  5SVX A;  4NQN A;  2LXP C;  4A9F A;  5HCL A;  1Z6U A;  3T7L A;  5CPE A;  5IBN A;  4IC2 A;  3SHB A;  1WEP A;  3D1D A;  3LQI A;  4YYK A;  3MUK A;  4OUF A;  4XY8 A;  5IGK A;  2VPB A;  2YW8 A;  4CUU A;  3L11 A;  3MB3 A;  4LR6 A;  3Q1D A;  4YBT A;  3MQM A;  4O7F A;  3N9P A;  2VJE B;  4O78 A;  2RO1 A;  3N9M A;  1HYI A;  5E74 A;  5I86 A;  3VKG A;  2N9G A;  5DKD A;  4LRG A;  2NXB A;  5A81 A;  5G4R A;  5L96 A;  5LJ0 A;  5CS8 A;  5CY9 A;  2DSM A;  5KH7 A;  3Q2F A;  3MHH A;  5CUB A;  2PUY A;  2G6Q A;  2L7P A;  1FBV A;  1BOR A;  3FL2 A;  3KV5 A;  5LKT A;  3MXF A;  5EWW A;  2LN0 A;  4RVR A;  5CUG A;  4CUP A;  2H0D B;  2IQJ A;  5A5P A;  3D7C A;  3D1B A;  2LGV A;  2YHO A;  2QIZ A;  3FAN A;  5B76 A;  3JVJ A;  2YQD A;  5F62 A;  2VJF A;  5I83 A;  3SVH A;  4NUE A;  1WEO A;  3L1X A;  3P5O A;  2NAA A;  4V3K C;  5SVI A;  5LKZ A;  2RS9 B;  4YBM A;  4ZC9 A;  5TCM A;  5ENB A;  3FJU B;  4IC3 A;  5EPS A;  3KDE C;  3DQV R;  4NR6 A;  5D3S A;  3FKM X;  4O71 A;  5CQ6 A;  4I7D A;  4CL9 A;  2OWA A;  3FM8 C;  5I1Q A;  4ZQL A;  5F60 A;  5LJ2 A;  2KFT A;  3I2D A;  4GNF A;  3RPG B;  4F1P A;  3LJU X;  3LRQ A;  2PNX A;  5F36 A;  1WUG A;  4MR3 A;  4YYD A;  3LQH A;  3Q2E A;  5E9M A;  5KTW A;  4O64 A;  4A4C A;  5EM3 A;  4QSV A;  1U6G B;  3IHP A;  3MHS A;  2YDW A;  5E9Y A;  5L99 A;  5FFW A;  4HXP A;  4TT6 A;  4TU4 A;  4NN2 A;  1T1H A;  5D3T A;  5FE4 A;  2YHN A;  2E6S A;  1JM7 A;  2MT5 A;  4OGI A;  1F68 A;  3QZS A;  3DAI A;  5D3N A;  3PUQ A;  2K1J A;  4MSX A;  2M6M A;  1CHC A;  5D3R A;  4IOO A;  3U5O A;  4MR4 A;  5EWV A;  2YVR A;  4QF3 A;  3HME A;  1ZKR A;  2D82 A;  3ZPV 1;  5D26 A;  4NR9 A;  3TLP A;  3ONI A;  4NR5 A;  5I89 A;  3O7A A;  3DWY A;  4IR3 A;  4FLP A;  5HRW A;  5FE8 A;  5E7D A;  5HFR A;  4F52 B;  2LXH C;  4A9K A;  4HXM A;  5EGU A;  2DVV A;  2E6R A;  3O33 A;  4O76 A;  2LGK A;  4CFK A;  4YBS A;  3HCS A;  3NG2 A;  5I7Y A;  5TDW A;  5DYA A;  3AQA A;  5FE7 A;  4TKP B;  5EK9 A;  4DON A;  2KWN A;  4R8P K;  4Y03 A;  5H9M A;  2L75 A;  4UYD A;  2GRC A;  5DX4 A;  4AP4 A;  5FB0 A;  2YEK A;  5LJ1 A;  4HXS A;  4QC3 A;  5D3J A;  3RPG C;  5TB6 A;  2MUM A;  4YYJ A;  2RFJ A;  4UIY A;  4NRA A;  2RSD A;  2OUO A;  4IOQ A;  4UIU A;  5HJC A;  2F42 A;  1E6I A;  4UIZ A;  4HXN A;  2R10 A;  4HBW A;  4O75 A;  4CUR A;  4OGC A;  4YYG A;  5AIU A;  5ENH A;  5ENJ A;  4GB0 A;  2LSP B;  2YUC A;  4Z93 A;  2ECI A;  4AI6 A;  5DFC A;  4TYL A;  3MDB C;  3QZV A;  5EA1 A;  3UVY A;  2RR4 A;  5KH3 A;  2YEL A;  1PUO A;  4TT2 A;  5F1L A;  5DY7 A;  2L0B A;  3EB6 A;  4UYF A;  2H60 A;  4A9J A;  5LKU A;  3DDT A;  4CUS A;  5DFB A;  3HTK C;  4O7B A;  4HXL A;  4AKG A;  3JUE A;  4YAX A;  5IGN A;  2JMJ A;  5A5Q A;  4AYC B;  1K2F A;  2EOD A;  4UP5 A;  3O36 A;  4TQN A;  4LYS A;  5EVA A;  2FUI A;  5I3L A;  4A9L A;  5D3H A;  5EU1 A;  1LDK C;  2YSJ A;  3JVK A;  4HBV A;  2F6J A;  4WIV A;  5L97 A;  4A9O A;  5HEL A;  3KNV A;  4LK9 A;  5II2 A;  4X2I A;  5C85 A;  5L8U A;  3LJW A;  2LAU A;  5EWD A;  3U5J A;  1F62 A;  4CLB A;  1VYX A;  3JVM A;  2E7O A;  3U5M A;  5D3P A;  5J3X A;  3S91 A;  4Z1Q A;  4TTE A;  4TU6 A;  4LYI A;  4LZS A;  2KKY A;  4UYG A;  2XP0 A;  5IGM A;  4NR4 A;  4C67 A;  2CSZ A;  2VPE A;  5DYC A;  2DKW A;  3ASL A;  3HCT A;  3SOU A;  5JI8 A;  1DCQ A;  4XI1 A;  4QSS A;  2KYU A;  4OGJ A;  4V3L C;  2L85 A;  5FB1 A;  4FJC A;  4Q0N A;  3L1Z B;  3AAD A;  4NRC A;  2M13 A;  5F61 A;  4KV4 A;  1WEM A;  3ZYU A;  2DVQ A;  2RI7 A;  3U5L A;  3VKH A;  4PY6 A;  4NS5 A;  4O62 A;  4NR7 A;  5C13 A;  4BW4 A;  5ETB A;  2LGG A;  4MEQ A;  5A7C A;  5AD3 A;  2OO1 A;  2DVR A;  5F1H A;  4QR4 A;  5CP5 A;  4UP0 A;  4NUC A;  5FFY A;  2YUR A;  4PTB A;  5KH9 A;  5FE2 A;  2E61 A;  1N87 A;  5CRZ A;  4B7Y C;  4TZ8 A;  2M85 A;  4UIV A;  5A82 A;  4WZ0 A;  4WHW A;  5EYA F;  5HFQ A;  5IG6 A;  5TAB A;  4WZ2 A;  5G0F A;  3ZTG A;  2VJF B;  5K3Q A;  2AN6 A;  2Y1M A;  2KGI A;  1XWH A;  3UV5 A;  4F3I A;  5A5S A;  2F6N A;  3P1C A;  4NXJ A;  4UIX A;  5E3G A;  5C7N A;  4YY4 A;  1X4U A;  5DKC A;  4AUQ B;  4GND A;  5CQA A;  4HBY A;  5C89 A;  1WEW A;  4Q6F A;  5EIS A;  3MB4 A;  5DIN A;  4TS8 A;  4NYW A;  2XOY A;  2Y43 A;  2JUN A;  4Z6H A;  3N9O A;  4NRB A;  2KIZ A;  4ZDT A;  2C2V S;  4ALH A;  1WES A;  4TT4 A;  2CRR A;  5CUC A;  4IOR A;  5G4S A;  2CKL A;  5FE5 A;  5EPB A;  4L7X A;  3IU5 A;  4QQ4 A;  3HMF A;  5ENI A;  3KQI A;  5B75 A;  2DJA A;  1ZBD B;  1G25 A;  4NUD A;  3UVX A;  5F2P A;  5A83 A;  2FFW A;  5BT5 A;  5CQ4 A;  4O72 A;  2YSM A;  5E9I A;  4WA6 A;  3PUR A;  3ZVY A;  2DVS A;  4OGE A;  5E9V A;  4YAD A;  5DW1 A;  5TBN A;  4TZ2 A;  5F25 A;  5FE9 A;  4PCI A;  2OSS A;  3O34 A;  5CQ8 A;  5F5Z A;  4XUB A;  2EGM A;  3PHD A;  2YEM A;  3FAO A;  4AKH A;  5IID A;  2KWO A;  4QSX A;  4QST A;  4IR4 A;  2ZET C;  5C11 A;  5DYU A;  5D25 A;  5LUU A;  2K16 A;  5D1M B;  5DW2 A;  2VJE A;  2D8S A;  4YK0 A;  4ALG A;  5FG6 A;  5FH7 A;  2XEU A;  4O7C A;  5DYX A;  2L84 A;  2FUU A;  2MD8 C;  2ECG A;  4HXK A;  5A5N A;  5D0C A;  1LDJ B;  3DPL R;  4QSW A;  5FG4 A;  2HYE D;  4WHU A;  4GNG A;  2LQ6 A;  5CRM A;  3VK6 A;  1N72 A;  5AIT A;  2MA6 A;  2H0D A;  3ZYQ A;  3MUL A;  2KGG A;  4QB3 A;  2MNZ A;  5FG5 A;  5IGL A;  4FK5 A;  2P57 A;  3PLW A;  4A9N A;  5G05 B;  1Z2Q A;  1WEQ A;  5CQ7 A;  5E73 A;  4Q0O A;  4QR5 A;  5LVQ A;  4CUT A;  3P1D A;  1DVP A;  2RNW A;  4BHW A;  2CSV A;  3N9N A;  4LC2 A;  3S92 A;  4LLB A;  4KCX A;  5ENC A;  2G43 A;  2CRW A;  4C9Z A;  5I7X A;  2DX8 A;  2CON A;  5C87 A;  3ZPV E;  3SVF A;  5SVI B;  3ZNI A;  5CZG A;  3U5K A;  5CUA A;  5K29 A;  2XB1 A;  4O77 A;  3P1F A;  5G04 B;  5AMF A;  5I80 A;  5FE1 A;  4YH4 A;  5DFD A;  5ETD A;  2YT5 A;  4PPE A;  3ERR A;  4QEW A;  4A4B A;  4A9I A;  3GL6 A;  5DLZ A;  3UV2 A;  2YU4 A;  3FEH A;  3O47 A;  5HQ6 A;  2E3K A;  5A5R A;  4LZ2 A;  4UIT A;  5FH8 A;  2YW5 A;  4P5O B;  1IYM A;  3UVW A;  5JWM A;  4Z6I A;  5D7X A;  4W4U A;  5CGP A;  3LQJ A;  3M7K A;  4J0S A;  4AKI A;  2RNY A;  4O74 A;  2DWW A;  3SVG A;  3O35 A;  2WP1 A;  4J1P A;  4QEV A;  5A5O A;  2QJ0 A;  5H85 A;  1JM7 B;  3C5K A;  5LKX A;  3RCW A;  5HQ5 A;  2L43 A;  2CT2 A;  5DKH A;  1WIM A;  5F63 A;  4YH3 A;  5FBX A;  1JSP B;  2UZG A;  4QR3 A;  5DLX A;  3M63 A;  5I29 A;  3GV4 A;  4QUU A;  5COI A;  2OXQ C;  5B79 A;  5H1U A;  2EXU A;  5A85 A;  4E96 A;  3LVQ E;  2EJN A;  5EQ1 A;  4QC1 A;  4A9E A;  5BT4 A;  2MJV B;  2EA6 A;  1JOC A;  2E7N A;  1VD4 A;  4BW2 A;  5D24 A;  4UYE A;  2BAY A;  2MNY A;  4N4I A;  3LVR E;  2EGP A;  4MVT A;  4MEP A;  4QY4 A;  4XUA A;  4O7A A;  5HQ7 A;  4YC9 A;  5I88 A;  4LYW A;  2YQM A;  1X0J A;  5E9K A;  3M99 A;  4PS5 A;  4FO9 A;  4L58 A;  5D3L A;  1E4U A;  4A9H A;  4N4H A;  4N3W A;  5FEY A;  4NR8 A;  3UV4 A;  2VNF A;  2MIQ A;  5H1T A;  3NXB A;  5EV9 A;  4ZUX U;  4NYV A;  4AVX A;  5KHM A;  4QYL A;  2ECT A;  4PCE A;  1X4I A;  4YYM A;  5D1L B;  2D9E A;  1FP0 A;  1WEU A;  2IDA A;  5DKA A;  4O70 A;  3T9K A;  5CQ5 A;  2M3H A;  2QIC A;  5C4Q A;  2YRE A;  5FFV A;  4QSP A;  4YAB A;  2LV9 A;  2KE1 A;  3I3J A;  4HBX A;  4AYC A;  5ENF A;  4NQM A;  4BW3 A;  5CQT A;  4QSQ A;  2YYR A;  4QBM A;  4AKN A;  2ECJ A;  4UYF B;  4XY9 A;  1V87 A;  4BBQ A;  3O70 A;  3SOX A;  5FE3 A;  4KV1 A;  1HYJ A;  5E0R A;  5B78 A;  3U5N A;  4O7E A;  4YYI A;  1WEV A;  5B8D A;  3K2J A;  5E9L A;  4QNS A;  2VPG A;  2YQL A;  5LCW B;  4I7B A;  5CUD A;  5DBM A;  5KTX A;  5LVR A;  4N4G A;  5TDR A;  4CA1 A;  2B0O E;  1WEE A;  3HMH A;  3DWD A;  4QF2 A;  5ENE A;  4CFL A;  2LRI C;  5KTU A;  2KWJ A;  5CTL A;  1WEN A;  4MR5 A;  4A9M A;  4S3O B;  5ACY A;  3SUB A;  5C8G A;  5HLS A;  5FE0 A;  1WIL A;  2KR4 A;  5CU8 A;  2K17 A;  5SVY A;  2ECV A;  5FE6 A;  2L80 A;  4J3I A;  2C2L A;  1MM2 A;  4YYN A;  2KKX A;  3V43 A;  4HXR A;  2VP7 A;  5HEM A;  5AME A;  2R0V A;  4IR6 A;  2FD4 A;  2VPD A;  5HM0 A;  4J0R A;  5L8T A;  3JVL A;  4YYH A;  4N4F A;  3GG3 A;  3M62 A;  3SOW A;  4BW1 A;  3G0J A;  2ECN A;  2KRE A;  2DAT A;  3UW9 A;  5CUE A;  5E3D A;  1WUM A;  2KTB B;  4FIP A;  4Z0O A;  5EWH A;  5TRB A;  2XOC A;  2MA5 A;  4QYD A;  4YY6 A;  2JRJ A;  4A49 A;  4R7E A;  2Y1N A;  4QZS A;  2R0S A;  4UYH A;  4R2Y A;  4PKL A;  1RMD A;  1X4J A;  5ENG A;  2G4A A;  2RNX A;  4BJX A;  2CSY A;  3N9Q A;  5EIC A;  3RTR B;  2XOZ A;  5JG6 A;  2JMI A;  3UVD A;  2L5U A;  3O37 A; 
#chains in the Genus database with same CATH homology
 4ZW1 A;  4C66 A;  1WGM A;  3ZVZ B;  4IR5 A;  5FH6 A;  4UIW A;  3U5P A;  4B86 C;  5AD2 A;  3LXJ A;  5HEN A;  1ZS5 A;  3HCU A;  5II1 A;  4UI9 B;  1Z60 A;  5FER A;  5CQ3 A;  2HDP A;  4LJN A;  2LGL A;  5BT3 A;  5EI4 A;  5B77 A;  4S3O C;  2I8N A;  1VFY A;  4GNE A;  4LDF A;  5FDZ A;  4NYX A;  2WP2 A;  3EB5 A;  2YYN A;  4I7C A;  5CFW A;  5EPR A;  3C6W A;  2M1R A;  2FSA A;  2JMD A;  4HXO A;  4LKA A;  5H1V A;  5EWC A;  4X3G A;  4LAD B;  4MR6 A;  4MEO A;  5KU3 A;  2KU3 A;  5D1K B;  2R0Y A;  3P1E A;  1MM3 A;  4CCG X;  4Z1S A;  1WE9 A;  4MEN A;  5HRX A;  4GPJ A;  4QEU A;  2CKL B;  5EP7 A;  2ECW A;  4YAT A;  3N9L A;  4WZ3 B;  3IU6 A;  2LDR A;  4QSU A;  5I40 A;  4A0C D;  5F3A A;  4QUT A;  5HRV A;  5L98 A;  4XYA A;  3G0L A;  5J0D A;  2L5E A;  1WFK A;  2MD7 B;  1JM4 B;  2KWK A;  3QZT A;  2G45 A;  2K4D A;  2I7K A;  4CUQ A;  5KO4 A;  3KV6 A;  4LZR A;  4QSR A;  3T6R A;  1EQF A;  2I50 A;  4NQN A;  2LXP C;  4A9F A;  5HCL A;  1Z6U A;  3T7L A;  5CPE A;  5IBN A;  4IC2 A;  3SHB A;  1WEP A;  4YYK A;  3LQI A;  2VPB A;  3MUK A;  4OUF A;  4XY8 A;  5IGK A;  2YW8 A;  4CUU A;  3L11 A;  3MB3 A;  4LR6 A;  4YBT A;  3MQM A;  4O7F A;  3N9P A;  2VJE B;  4O78 A;  2RO1 A;  3N9M A;  1HYI A;  5E74 A;  5I86 A;  2N9G A;  5DKD A;  4LRG A;  2NXB A;  5A81 A;  5G4R A;  5L96 A;  5LJ0 A;  5CS8 A;  5CY9 A;  5KH7 A;  3Q2F A;  3MHH A;  5CUB A;  2PUY A;  2G6Q A;  1FBV A;  1BOR A;  3FL2 A;  3KV5 A;  5LKT A;  3MXF A;  5EWW A;  2LN0 A;  4RVR A;  5CUG A;  4CUP A;  2H0D B;  5A5P A;  3D7C A;  2LGV A;  5B76 A;  2YHO A;  2QIZ A;  3JVJ A;  2YQD A;  5F62 A;  2VJF A;  5I83 A;  3SVH A;  4NUE A;  1WEO A;  3L1X A;  3P5O A;  2NAA A;  4V3K C;  5LKZ A;  2RS9 B;  4YBM A;  4ZC9 A;  5TCM A;  5ENB A;  4IC3 A;  5EPS A;  3DQV R;  4NR6 A;  5D3S A;  3FKM X;  4O71 A;  5CQ6 A;  4I7D A;  4CL9 A;  5I1Q A;  4ZQL A;  5F60 A;  5LJ2 A;  2KFT A;  3I2D A;  4GNF A;  3RPG B;  3LRQ A;  2PNX A;  5F36 A;  1WUG A;  4MR3 A;  4YYD A;  3LQH A;  3Q2E A;  5E9M A;  5KTW A;  4O64 A;  4A4C A;  5EM3 A;  4QSV A;  1U6G B;  3IHP A;  3MHS A;  2YDW A;  5E9Y A;  5L99 A;  5FFW A;  4HXP A;  4TT6 A;  4TU4 A;  4NN2 A;  1T1H A;  5D3T A;  5FE4 A;  2YHN A;  2E6S A;  1JM7 A;  2MT5 A;  4OGI A;  1F68 A;  3QZS A;  3DAI A;  5D3N A;  3PUQ A;  2K1J A;  4MSX A;  2M6M A;  1CHC A;  5D3R A;  4IOO A;  3U5O A;  4MR4 A;  5EWV A;  4QF3 A;  3HME A;  2D82 A;  3ZPV 1;  5D26 A;  4NR9 A;  3TLP A;  3ONI A;  4NR5 A;  5I89 A;  3O7A A;  3DWY A;  4IR3 A;  4FLP A;  5HRW A;  5FE8 A;  5E7D A;  5HFR A;  4F52 B;  2LXH C;  4A9K A;  4HXM A;  5EGU A;  2DVV A;  2E6R A;  3O33 A;  4O76 A;  2LGK A;  4CFK A;  4YBS A;  3HCS A;  3NG2 A;  5I7Y A;  5TDW A;  5DYA A;  3AQA A;  5FE7 A;  4TKP B;  5EK9 A;  4DON A;  2KWN A;  4R8P K;  4Y03 A;  5H9M A;  2L75 A;  4UYD A;  2GRC A;  5DX4 A;  4AP4 A;  5FB0 A;  2YEK A;  5LJ1 A;  4HXS A;  4QC3 A;  5D3J A;  3RPG C;  5TB6 A;  2MUM A;  4YYJ A;  2RFJ A;  4UIY A;  4NRA A;  2RSD A;  2OUO A;  4IOQ A;  4UIU A;  5HJC A;  2F42 A;  1E6I A;  4UIZ A;  4HXN A;  2R10 A;  4HBW A;  4O75 A;  4CUR A;  4YYG A;  5AIU A;  5ENH A;  5ENJ A;  4GB0 A;  2LSP B;  2YUC A;  4Z93 A;  2ECI A;  5DFC A;  4TYL A;  3QZV A;  5EA1 A;  3UVY A;  5KH3 A;  2YEL A;  3EB6 A;  4TT2 A;  5F1L A;  5DY7 A;  2L0B A;  4UYF A;  2H60 A;  4A9J A;  5LKU A;  3HTK C;  4CUS A;  5DFB A;  4O7B A;  4HXL A;  4YAX A;  5IGN A;  2JMJ A;  5A5Q A;  4AYC B;  1K2F A;  2EOD A;  4UP5 A;  3O36 A;  4TQN A;  4LYS A;  5EVA A;  2FUI A;  5I3L A;  4A9L A;  5D3H A;  5EU1 A;  1LDK C;  2YSJ A;  3JVK A;  4HBV A;  2F6J A;  4WIV A;  5L97 A;  4A9O A;  5HEL A;  3KNV A;  4LK9 A;  5II2 A;  4X2I A;  5C85 A;  5L8U A;  3LJW A;  5EWD A;  3U5J A;  1F62 A;  4CLB A;  1VYX A;  3JVM A;  2E7O A;  3U5M A;  5D3P A;  5J3X A;  3S91 A;  4Z1Q A;  4TTE A;  4TU6 A;  4LYI A;  4LZS A;  4UYG A;  5IGM A;  4NR4 A;  4C67 A;  2CSZ A;  2VPE A;  5DYC A;  2DKW A;  3ASL A;  3HCT A;  3SOU A;  5JI8 A;  4XI1 A;  4QSS A;  2KYU A;  4OGJ A;  4V3L C;  2L85 A;  5FB1 A;  4FJC A;  4Q0N A;  3L1Z B;  3AAD A;  4NRC A;  5F61 A;  4KV4 A;  1WEM A;  3ZYU A;  2DVQ A;  2RI7 A;  3U5L A;  4PY6 A;  4NS5 A;  4NR7 A;  5C13 A;  4BW4 A;  5ETB A;  2LGG A;  4MEQ A;  5A7C A;  5AD3 A;  2OO1 A;  2DVR A;  5F1H A;  4QR4 A;  5CP5 A;  4UP0 A;  4NUC A;  5FFY A;  2YUR A;  4PTB A;  5KH9 A;  5FE2 A;  1N87 A;  5CRZ A;  4B7Y C;  4TZ8 A;  2M85 A;  4UIV A;  5A82 A;  4WZ0 A;  4WHW A;  5EYA F;  5HFQ A;  5IG6 A;  5TAB A;  4WZ2 A;  5G0F A;  3ZTG A;  2VJF B;  2AN6 A;  2Y1M A;  2KGI A;  1XWH A;  3UV5 A;  4F3I A;  5A5S A;  2F6N A;  3P1C A;  4NXJ A;  4UIX A;  5E3G A;  5C7N A;  4YY4 A;  1X4U A;  5DKC A;  4AUQ B;  4GND A;  5CQA A;  4HBY A;  5C89 A;  1WEW A;  4Q6F A;  5EIS A;  3MB4 A;  5DIN A;  4TS8 A;  4NYW A;  2Y43 A;  4Z6H A;  3N9O A;  4NRB A;  2KIZ A;  4ZDT A;  2C2V S;  4ALH A;  1WES A;  4TT4 A;  5CUC A;  4IOR A;  5G4S A;  2CKL A;  5FE5 A;  5EPB A;  4L7X A;  3IU5 A;  3HMF A;  5ENI A;  3KQI A;  5B75 A;  1ZBD B;  1G25 A;  4NUD A;  3UVX A;  5F2P A;  5A83 A;  5BT5 A;  5CQ4 A;  4O72 A;  2YSM A;  5E9I A;  4WA6 A;  3PUR A;  3ZVY A;  2DVS A;  5TBN A;  5E9V A;  4YAD A;  5DW1 A;  4TZ2 A;  5F25 A;  5FE9 A;  4PCI A;  2OSS A;  3O34 A;  5CQ8 A;  5F5Z A;  4XUB A;  3PHD A;  2YEM A;  5IID A;  2KWO A;  4QSX A;  4QST A;  4IR4 A;  2ZET C;  5C11 A;  5DYU A;  5D25 A;  5LUU A;  2K16 A;  5D1M B;  5DW2 A;  2VJE A;  2D8S A;  4YK0 A;  4ALG A;  5FG6 A;  5FH7 A;  2XEU A;  4O7C A;  5DYX A;  2L84 A;  2FUU A;  2MD8 C;  2ECG A;  4HXK A;  5A5N A;  5D0C A;  1LDJ B;  3DPL R;  4QSW A;  5FG4 A;  2HYE D;  4WHU A;  4GNG A;  2LQ6 A;  5CRM A;  3VK6 A;  1N72 A;  5AIT A;  2MA6 A;  2H0D A;  3ZYQ A;  3MUL A;  2KGG A;  4QB3 A;  2MNZ A;  5FG5 A;  5IGL A;  4FK5 A;  4A9N A;  5G05 B;  1Z2Q A;  1WEQ A;  5CQ7 A;  5E73 A;  4Q0O A;  4QR5 A;  5LVQ A;  4CUT A;  3P1D A;  1DVP A;  2RNW A;  4BHW A;  3N9N A;  4LC2 A;  3S92 A;  4LLB A;  4KCX A;  5ENC A;  2G43 A;  4C9Z A;  5I7X A;  2DX8 A;  5C87 A;  3ZPV E;  3SVF A;  3ZNI A;  5CZG A;  3U5K A;  5CUA A;  5K29 A;  2XB1 A;  4O77 A;  3P1F A;  5G04 B;  5AMF A;  5I80 A;  5FE1 A;  4YH4 A;  5DFD A;  5ETD A;  2YT5 A;  4PPE A;  4QEW A;  4A4B A;  4A9I A;  3GL6 A;  5DLZ A;  3UV2 A;  2YU4 A;  5HQ6 A;  2E3K A;  5A5R A;  4LZ2 A;  4UIT A;  5FH8 A;  2YW5 A;  4P5O B;  1IYM A;  3UVW A;  5JWM A;  4Z6I A;  5D7X A;  4W4U A;  5CGP A;  3LQJ A;  4J0S A;  2RNY A;  4O74 A;  2DWW A;  3SVG A;  3O35 A;  2WP1 A;  4J1P A;  4QEV A;  5A5O A;  2QJ0 A;  5H85 A;  1JM7 B;  3C5K A;  5LKX A;  3RCW A;  5HQ5 A;  2L43 A;  2CT2 A;  5DKH A;  1WIM A;  5F63 A;  4YH3 A;  5FBX A;  1JSP B;  2UZG A;  4QR3 A;  5DLX A;  3M63 A;  5I29 A;  3GV4 A;  4QUU A;  5COI A;  2OXQ C;  5B79 A;  5H1U A;  5A85 A;  4E96 A;  5EQ1 A;  4QC1 A;  4A9E A;  5BT4 A;  2MJV B;  2EA6 A;  1JOC A;  2E7N A;  1VD4 A;  4BW2 A;  5D24 A;  4UYE A;  2BAY A;  2MNY A;  4N4I A;  2EGP A;  4MVT A;  4MEP A;  4QY4 A;  4XUA A;  4O7A A;  5HQ7 A;  4YC9 A;  5I88 A;  4LYW A;  2YQM A;  1X0J A;  5E9K A;  3M99 A;  4PS5 A;  4FO9 A;  4L58 A;  5D3L A;  1E4U A;  4A9H A;  4N4H A;  4N3W A;  5FEY A;  4NR8 A;  3UV4 A;  2VNF A;  2MIQ A;  5H1T A;  3NXB A;  5EV9 A;  4ZUX U;  4NYV A;  4AVX A;  5KHM A;  4QYL A;  2ECT A;  4PCE A;  1X4I A;  4YYM A;  5D1L B;  2D9E A;  1FP0 A;  1WEU A;  2IDA A;  5DKA A;  4O70 A;  5CQ5 A;  2M3H A;  2QIC A;  5C4Q A;  2YRE A;  5FFV A;  4QSP A;  4YAB A;  2LV9 A;  2KE1 A;  3I3J A;  4HBX A;  4AYC A;  5ENF A;  4NQM A;  4BW3 A;  5CQT A;  4QSQ A;  2YYR A;  4QBM A;  4AKN A;  2ECJ A;  4UYF B;  4XY9 A;  1V87 A;  4BBQ A;  3O70 A;  3SOX A;  5FE3 A;  4KV1 A;  1HYJ A;  5E0R A;  5B78 A;  3U5N A;  4O7E A;  4YYI A;  1WEV A;  5B8D A;  3K2J A;  5E9L A;  4QNS A;  2VPG A;  2YQL A;  5LCW B;  4I7B A;  5CUD A;  5DBM A;  5KTX A;  5LVR A;  4N4G A;  5TDR A;  4CA1 A;  1WEE A;  3HMH A;  4QF2 A;  5ENE A;  4CFL A;  2LRI C;  5KTU A;  2KWJ A;  5CTL A;  1WEN A;  4MR5 A;  4A9M A;  4S3O B;  5ACY A;  5C8G A;  5HLS A;  5FE0 A;  1WIL A;  2KR4 A;  5CU8 A;  2K17 A;  2ECV A;  5FE6 A;  2L80 A;  4J3I A;  2C2L A;  1MM2 A;  4YYN A;  3V43 A;  4HXR A;  2VP7 A;  5HEM A;  5AME A;  2R0V A;  4IR6 A;  2VPD A;  5HM0 A;  4J0R A;  5L8T A;  3JVL A;  4YYH A;  4N4F A;  3GG3 A;  3M62 A;  3SOW A;  4BW1 A;  3G0J A;  2ECN A;  2KRE A;  2DAT A;  3UW9 A;  5CUE A;  5E3D A;  1WUM A;  2KTB B;  4FIP A;  5EWH A;  5TRB A;  2MA5 A;  4QYD A;  4YY6 A;  2JRJ A;  4A49 A;  4R7E A;  2Y1N A;  4QZS A;  2R0S A;  4UYH A;  4R2Y A;  4PKL A;  1RMD A;  1X4J A;  5ENG A;  2G4A A;  2RNX A;  4BJX A;  2CSY A;  3N9Q A;  5EIC A;  3RTR B;  5JG6 A;  2JMI A;  3UVD A;  2L5U A;  3O37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...