5H1TA

Complex structure of trim24 phd-bromodomain and inhibitor 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 50
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1tA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1tA01
5HFRA 5TRBA 4YATA 3DPLR 3SVFA 3RPGB 5FB1A 4WHWA 4DONA 5L98A 2C2VS 4WIVA 4BBQA 3IU5A 4UYHA 1WFKA 4A9EA 4AVXA 1MM3A 2VJEA 4IOOA 5ENHA 3O34A 4N4HA 3O36A 2ECJA 2RNWA 4NR8A 4A0CD 4MENA 4LJNA 2RO1A 4YYMA 4BW1A 5EVAA 5LCWB 4UYGA 3U5PA 2NXBA 2WP2A 5FE5A 1WEEA 4LYIA 2M3HA 2OUOA 2LGKA 2R0SA 4UIWA 3UVXA 5BT4A 5A5NA 3PUQA 4LDFA 4QSTA 5ENCA 4GNFA 5G05B 4B86C 5F61A 2RNXA 4O78A 5ETDA 5DYCA 5LJ2A 5B77A 4HXKA 5I88A 4HXNA 4N4FA 5HM0A 5TABA 5KH3A 5HRVA 2RSDA 2Y1NA 2KIZA 4NR7A 5H1VA 1N87A 5FFVA 3ZPVE 5COIA 4MEQA 3S92A 3LJWA 4O7CA 2KR4A 3NG2A 2MJVB 4LYSA 2YDWA 3O7AA 5L8TA 1VFYA 4Z1SA 3SHBA 4NRCA 4PY6A 4O7BA 2LGVA 2KWOA 2LQ6A 4ZW1A 4QYLA 3GL6A 4QSRA 4UYDA 4TS8A 1N72A 4TT6A 3Q2FA 5K29A 4FIPA 2OO1A 2KWKA 4BJXA 5ENEA 4AP4A 1K2FA 5I1QA 4KCXA 2L80A 4A4BA 4LZRA 3P5OA 2F42A 5CUCA 4YYIA 5H1TA 5CUDA 5HFQA 4OGIA 3K2JA 5DX4A 5AD2A 4I7CA 4BW3A 5LKTA 2VJFA 5D3NA 5A82A 4PTBA 4A9JA 3L1ZB 4OUFA 5TB6A 4CUSA 3P1FA 1X4UA 3O70A 4L7XA 5DLXA 3HCTA 4NQNA 4Q0OA 4J0RA 4QC1A 1WEVA 5DW1A 5L99A 2ECVA 5A83A 4J0SA 3N9QA 2AN6A 5DFBA 3ZTGA 4C9ZA 4WHUA 5EICA 5KTXA 2G4AA 4KV1A 2YSMA 1BORA 5FB0A 1JM7B 4UIXA 4YYHA 4O7EA 2ECWA 4UI9B 1F62A 3UV4A 3TLPA 5CRZA 5CQ4A 3N9NA 5KH7A 4IOQA 3I2DA 2DATA 4LLBA 4TYLA 5E9IA 5FFYA 4QSQA 5EWHA 2KGGA 5LVQA 5H85A 4N4GA 5EV9A 5I3LA 2EA6A 5I29A 3N9LA 4NR4A 2DWWA 4CUUA 2ECTA 5FH6A 5FE8A 5J3XA 4NS5A 2KYUA 3IHPA 4UYFA 2KE1A 4QF3A 2KREA 5JWMA 5C7NA 2PUYA 4HBVA 5G4RA 2XEUA 4NR9A 3KV5A 3C6WA 4N3WA 2MA5A 5I80A 1MM2A 5DKDA 2ZETC 4BHWA 4IC3A 5H9MA 3SOUA 5L97A 4R8PK 5CUBA 3LRQA 4Z6HA 2JMJA 2E6SA 3EB5A 4CFKA 3HMFA 4HBWA 1JM4B 5D24A 5BT3A 2D8SA 2L5EA 4QZSA 5HQ5A 4Y03A 3ZVZB 5EWVA 5FE4A 4V3LC 4UP0A 4GNEA 3UV2A 4HBXA 4QSXA 5FERA 2MNYA 1WEOA 2E7NA 5CQ6A 5E3DA 4KV4A 5EYAF 4XUBA 5D1KB 5A5RA 1ZBDB 3HCSA 5AITA 5CQ8A 4XUAA 4TTEA 3QZSA 2MUMA 3IU6A 1Z2QA 4YABA 3MB3A 4LR6A 4Q6FA 4LADB 2KWJA 5E74A 5CS8A 5I7XA 4LRGA 5C89A 4P5OB 5I7YA 3U5KA 4WZ0A 5E73A 2LXPC 5TBNA 1Z6UA 4QNSA 4Q0NA 4O72A 5D1LB 3G0JA 1X4JA 5IG6A 3MULA 1T1HA 3RPGC 5TCMA 5C4QA 3KNVA 4LK9A 5CTLA 4A9MA 4XY8A 5E9LA 4Z93A 4F3IA 2YHNA 3Q2EA 2YQMA 5EPSA 4F52B 2N9GA 5CQ5A 2XB1A 4NQMA 4A49A 4AUQB 5IIDA 5AD3A 1Z60A 4HXRA 3U5NA 4RVRA 4YY4A 2OSSA 1EQFA 2C2LA 5DLZA 2VJFB 5DKHA 2CSYA 1DVPA 5FE2A 5H1UA 4FK5A 2CSZA 2YSJA 2YUCA 5KTUA 4YADA 5E9VA 4J1PA 4UYFB 4CLBA 5L96A 5DFDA 4CA1A 2JMIA 5IGLA 2Y43A 4NYVA 5CY9A 2YW5A 5HQ7A 4TZ8A 4TU6A 4CCGX 2FUUA 4QBMA 4WZ3B 1X4IA 3KQIA 4O7FA 4A9FA 4IORA 3MHSA 3SVGA 4YYNA 5ENGA 5IGKA 2QJ0A 1LDKC 4YYDA 5C87A 1WEPA 4MSXA 5DYAA 3SOXA 2UZGA 5CUGA 4ALHA 5CQTA 4O7AA 3N9MA 4QEWA 2M1RA 3C5KA 5A5OA 4HXOA 5F2PA 1WENA 5B75A 5C11A 2FSAA 4XI1A 5ENBA 4A9HA 2YT5A 4X2IA 2VPEA 2YYRA 3MQMA 5D25A 4UIVA 4QF2A 1HYIA 5HRXA 3MB4A 5DY7A 2I50A 2LSPB 3U5JA 3P1CA 5EISA 5ENFA 2YHOA 1IYMA 2LRIC 5J0DA 3SOWA 3QZTA 3I3JA 1JSPB 1WEWA 4YBTA 2L5UA 5JG6A 2YREA 4QR4A 4BW2A 5II1A 5FG4A 2L84A 3T6RA 2DKWA 4O77A 4IR5A 4A9IA 2R0YA 5EK9A 4ALGA 2YYNA 4QR3A 4S3OC 5CQ7A 4W4UA 5ETBA 5E9MA 5CZGA 4QSPA 3O33A 2VP7A 5AMEA 4CUTA 1WESA 4WA6A 4ZC9A 4BW4A 2EGPA 4O64A 2LDRA 4NR5A 4YK0A 4PCIA 5CU8A 5D3HA 2IDAA 2KGIA 3DQVR 5KU3A 2LXHC 5CUAA 4GPJA 2WP1A 4QSUA 5HJCA 5EA1A 4QSVA 1WILA 5B78A 2YQLA 2E7OA 2R10A 4O70A 5D26A 3LQHA 4YAXA 5D3LA 3JVMA 5HLSA 1CHCA 2L75A 5F36A 2VPDA 2ECIA 4QR5A 3KV6A 3O37A 3UVYA 4A4CA 5DKAA 4A9NA 4QYDA 5C85A 3JVLA 5FDZA 2HDPA 4LKAA 2LGLA 4PCEA 5FE7A 2I8NA 4CUQA 3VK6A 2DX8A 5F1LA 5EPRA 4TU4A 3MUKA 4IC2A 3GV4A 3UVWA 4FO9A 2YU4A 5E7DA 4AYCA 2I7KA 3EB6A 1HYJA 4O74A 1WEUA 3HMEA 5FFWA 4UITA 5A85A 5DFCA 2RNYA 5EM3A 5G04B 2F6JA 3RTRB 4CFLA 5EWDA 5HENA 3JVKA 4YYGA 2JMDA 1WGMA 2RI7A 5EI4A 3SVHA 4O75A 4UIZA 1WIMA 3ASLA 5HCLA 4WZ2A 4CL9A 2R0VA 5I86A 5F3AA 3O35A 2BAYA 2YQDA 1E4UA 5FBXA 2MT5A 4NXJA 4CURA 4HXPA 4TZ2A 5HRWA 2VPGA 2H0DB 4PPEA 4YC9A 4L58A 5HEMA 2YELA 4A9KA 5CGPA 5CUEA 5DINA 3DWYA 5DKCA 5E9KA 2L0BA 1VD4A 2EODA 4QUUA 5D7XA 4MR3A 2K4DA 4IR6A 3PURA 4AYCB 1VYXA 3MXFA 4YBSA 3M99A 5D3RA 5ENJA 4A9LA 2E6RA 4XY9A 5B8DA 4TT4A 4OGJA 4O76A 2RS9B 4X3GA 3G0LA 2CKLB 4IR4A 5F5ZA 1WE9A 4NRBA 3ZPV1 3FL2A 5FG6A 4GB0A 2FUIA 3M63A 2VPBA 4UIYA 5EP7A 3M62A 5EQ1A 5FE1A 4QSSA 5D3PA 2ECNA 5D0CA 4LC2A 1V87A 3GG3A 4QB3A 4QY4A 4QEVA 5D3JA 2DVVA 2LN0A 1WEMA 5CQAA 5EU1A 2H60A 5DYUA 2Y1MA 5IGMA 3S91A 4Z1QA 4I7DA 2QICA 5G0FA 2KFTA 3N9OA 4ZDTA 4HXSA 2K1JA 3FKMX 5CP5A 2LGGA 5E9YA 4E96A 4B7YC 5E0RA 5FG5A 5KTWA 5LUUA 2F6NA 2MIQA 5CRMA 3LQIA 5A5SA 2CKLA 5F60A 5F62A 5KHMA 5IGNA 5KO4A 5I83A 4MEOA 2KTBB 4NUEA 4MR4A 1LDJB 3ZYQA 5FE6A 5B79A 4QSWA 3JVJA 3AQAA 2MD8C 4TKPB 5TDRA 4XYAA 5AIUA 4R7EA 1ZS5A 5FH8A 4YBMA 5C13A 1RMDA 3ZNIA 1JM7A 5FE3A 4C67A 2H0DA 4NYWA 5I40A 3HTKC 3ZVYA 4NRAA 5C8GA 3ONIA 2LV9A 1E6IA 4HXLA 3T7LA 4UIUA 4PS5A 3U5OA 5LVRA 5DYXA 2QIZA 2M6MA 4QUTA 3P1DA 5LKXA 4QEUA 5EWCA 1U6GB 4O71A 3HCUA 4V3KC 2KU3A 3AADA 2K16A 3U5LA 4A9OA 4TQNA 5KH9A 4PKLA 2E3KA 3ZYUA 5FEYA 2L85A 5ENIA 3LXJA 5JI8A 5TDWA 4YYJA 2OXQC 4MR6A 5D3TA 3V43A 2DVRA 3U5MA 3HMHA 4LZ2A 3NXBA 2D9EA 4MEPA 2L43A 4TT2A 3UVDA 5EWWA 4NN2A 3N9PA 4C66A 5D3SA 5HQ6A 5FH7A 3L1XA 2CT2A 3PHDA 2D82A 5ACYA 1FP0A 5A81A 4NUDA 2YEKA 4HBYA 4R2YA 4GNGA 2HYED 4J3IA 4Z6IA 2GRCA 2DVSA 2G45A 4MVTA 5FE9A 5CPEA 4NR6A 3QZVA 4YYKA 5HELA 4AKNA 5A5PA 4CUPA 1X0JA 2RFJA 4NUCA 4YH4A 5G4SA 1G25A 5LKUA 2G6QA 4NYXA 5L8UA 4LZSA 2MD7B 2M85A 2NAAA 2MNZA 3RCWA 5DBMA 4FLPA 3P1EA 5A7CA 2MA6A 5CQ3A 5LJ0A 4MR5A 3UV5A 3UW9A 4IR3A 5AMFA 1FBVA 1XWHA 2KWNA 2G43A 2VJEB 4UYEA 5I89A 5CFWA 4ZQLA 2YW8A 4GNDA 1WUGA 2PNXA 3DAIA 5EPBA 5IBNA 5FE0A 5E3GA 5LJ1A 2VNFA 2YEMA 5II2A 4LYWA 3MHHA 2K17A 1WUMA 1F68A 5DW2A 4YY6A 4ZUXU 3LQJA 2JRJA 4QC3A 5B76A 5EGUA 1JOCA 4N4IA 5F63A 4HXMA 2ECGA 5F25A 4UP5A 4S3OB 5D1MB 3L11A 4FJCA 4I7BA 5LKZA 2DVQA 5BT5A 4YH3A 2YURA 1WEQA 5A5QA 5F1HA 3D7CA
chains in the Genus database with same CATH superfamily
3KDEC 5HFRA 5TRBA 4YATA 3DPLR 3SVFA 3RPGB 5FB1A 4WHWA 4DONA 5L98A 2C2VS 4WIVA 4BBQA 3IU5A 4UYHA 1WFKA 4A9EA 4AVXA 1MM3A 2VJEA 4IOOA 5ENHA 3O34A 4N4HA 3O36A 2ECJA 2RNWA 4NR8A 4A0CD 4MENA 3PLWA 4LJNA 2RO1A 4YYMA 4BW1A 5EVAA 5LCWB 4UYGA 3U5PA 2NXBA 2WP2A 5FE5A 1WEEA 4LYIA 2M3HA 2OUOA 2LGKA 2R0SA 4UIWA 3UVXA 5BT4A 5A5NA 3D1DA 3PUQA 4AKGA 4LDFA 4QSTA 5ENCA 4GNFA 5G05B 5SVYA 5F61A 4B86C 2RNXA 4O78A 5ETDA 5DYCA 3O47A 5LJ2A 5B77A 4HXKA 5I88A 4HXNA 4N4FA 5HM0A 5TABA 5KH3A 1PUOA 5HRVA 2RSDA 2Y1NA 2KIZA 4NR7A 5H1VA 1N87A 3DWDA 5FFVA 3ZPVE 5COIA 4MEQA 3S92A 3LJWA 4O7CA 2KR4A 3NG2A 2MJVB 4LYSA 2YDWA 3O7AA 5L8TA 1VFYA 4Z1SA 3SHBA 4NRCA 4PY6A 4O7BA 2LGVA 2KWOA 2LQ6A 4ZW1A 4QYLA 3GL6A 4QSRA 2P57A 2XOZA 4UYDA 4TS8A 1N72A 4TT6A 3Q2FA 5K29A 4FIPA 2OO1A 2KWKA 4BJXA 5ENEA 4AP4A 3Q1DA 1K2FA 5I1QA 4KCXA 2L80A 4A4BA 4LZRA 3P5OA 2F42A 5CUCA 4YYIA 5H1TA 5CUDA 5HFQA 4OGIA 3K2JA 5DX4A 5AD2A 3MDBC 4I7CA 4BW3A 5LKTA 2VJFA 5D3NA 5A82A 4Z0OA 4PTBA 4A9JA 3L1ZB 4OUFA 5TB6A 4CUSA 3P1FA 1X4UA 3O70A 4L7XA 5DLXA 3HCTA 4NQNA 4Q0OA 4J0RA 4QC1A 1WEVA 5DW1A 5L99A 2ECVA 5A83A 4J0SA 3N9QA 2AN6A 5DFBA 3ZTGA 4C9ZA 3VKHA 4WHUA 5EICA 5KTXA 2G4AA 4KV1A 2YSMA 1BORA 5FB0A 1JM7B 4UIXA 4YYHA 4O7EA 2ECWA 4UI9B 1F62A 3UV4A 3TLPA 3LDYA 5CRZA 5CQ4A 3N9NA 5KH7A 4IOQA 3I2DA 2DATA 4LLBA 4TYLA 5E9IA 5FFYA 4QSQA 5EWHA 2KGGA 5LVQA 5H85A 4N4GA 5EV9A 5I3LA 2EA6A 2YVRA 5I29A 3N9LA 4NR4A 2DWWA 4CUUA 2ECTA 5FH6A 5FE8A 5J3XA 4NS5A 2KYUA 3IHPA 4UYFA 2KE1A 4QF3A 2KREA 2EXUA 5JWMA 5C7NA 2PUYA 4HBVA 5G4RA 2M13A 4NR9A 2XEUA 3JUEA 3KV5A 3C6WA 4N3WA 2MA5A 5I80A 2CRRA 1MM2A 5DKDA 2ZETC 4BHWA 4IC3A 5H9MA 3SOUA 5L97A 4R8PK 5CUBA 3LRQA 4Z6HA 2JMJA 2E6SA 3EB5A 4CFKA 3HMFA 4HBWA 1JM4B 5D24A 5BT3A 2D8SA 5K3QA 2L5EA 4QZSA 5HQ5A 4Y03A 3ZVZB 5EWVA 5FE4A 4V3LC 4UP0A 4GNEA 3UV2A 4HBXA 4QSXA 5FERA 2MNYA 1WEOA 2E7NA 5CQ6A 5E3DA 2B0OE 4KV4A 5EYAF 4XUBA 5D1KB 5A5RA 1ZBDB 3HCSA 5AITA 5CQ8A 4XUAA 4TTEA 3QZSA 2MUMA 3IU6A 1Z2QA 4YABA 3MB3A 4LR6A 4Q6FA 4LADB 2KWJA 5E74A 5CS8A 5I7XA 4LRGA 5C89A 4P5OB 5I7YA 3U5KA 4WZ0A 5E73A 2LXPC 5TBNA 1Z6UA 4QNSA 4Q0NA 4O72A 5D1LB 3G0JA 1X4JA 5IG6A 3MULA 1T1HA 3RPGC 5TCMA 4AKHA 5C4QA 3KNVA 4LK9A 5CTLA 4A9MA 4XY8A 5E9LA 4Z93A 4F3IA 2YHNA 3Q2EA 2YQMA 5EPSA 4F52B 2N9GA 5CQ5A 2XB1A 4NQMA 4A49A 4AUQB 5IIDA 5AD3A 1Z60A 4HXRA 3U5NA 4RVRA 4YY4A 2OSSA 1EQFA 2C2LA 5DLZA 2VJFB 5DKHA 2CSYA 1DVPA 5FE2A 5H1UA 4FK5A 2CSZA 2YSJA 2YUCA 5KTUA 4YADA 5E9VA 4J1PA 4UYFB 4CLBA 5L96A 5DFDA 4CA1A 2JMIA 5IGLA 2Y43A 4NYVA 2FFWA 5CY9A 2YW5A 5HQ7A 4TZ8A 4TU6A 4CCGX 2FUUA 4QBMA 4WZ3B 1X4IA 3KQIA 4O7FA 4A9FA 4IORA 3MHSA 3SVGA 4YYNA 5ENGA 5IGKA 2DJAA 1LDKC 2QJ0A 4YYDA 2IQJA 5C87A 1WEPA 4MSXA 5DYAA 3SOXA 4H9DA 2UZGA 5CUGA 4ALHA 5CQTA 3SUBA 4O7AA 3N9MA 4QEWA 2M1RA 3C5KA 5A5OA 4HXOA 5F2PA 1WENA 5B75A 5C11A 2FSAA 4XI1A 5ENBA 4A9HA 2YT5A 4X2IA 2VPEA 2YYRA 3MQMA 5D25A 4UIVA 4QF2A 1HYIA 5HRXA 3MB4A 5DY7A 2I50A 2LSPB 3U5JA 3P1CA 5EISA 5ENFA 2YHOA 1IYMA 2LRIC 5J0DA 3SOWA 3QZTA 2LAUA 3I3JA 1JSPB 1WEWA 4YBTA 2L5UA 5JG6A 2YREA 4QR4A 4BW2A 5II1A 5FG4A 2L84A 3T6RA 2DKWA 2E61A 4O77A 4IR5A 4A9IA 2R0YA 5EK9A 4ALGA 2YYNA 4QR3A 4S3OC 5CQ7A 4W4UA 5ETBA 5E9MA 5CZGA 4QSPA 3O33A 2VP7A 5AMEA 4CUTA 1WESA 4WA6A 4ZC9A 4BW4A 2EGPA 4O64A 2LDRA 4NR5A 5SVIA 4YK0A 4PCIA 5CU8A 5D3HA 2IDAA 2KGIA 4QQ4A 3DQVR 5KU3A 2LXHC 5CUAA 4GPJA 2WP1A 4QSUA 5HJCA 5EA1A 4QSVA 1WILA 2FD4A 5B78A 2YQLA 2E7OA 2R10A 4O70A 5D26A 3LQHA 2RR4A 4YAXA 5D3LA 3JVMA 5HLSA 1CHCA 2L75A 5F36A 2VPDA 2ECIA 4QR5A 3KV6A 3O37A 3UVYA 4A4CA 2JUNA 4A9NA 4QYDA 5DKAA 5C85A 3JVLA 5FDZA 2HDPA 4LKAA 2LGLA 4PCEA 5FE7A 2I8NA 4CUQA 3VK6A 2XOCA 2DX8A 3M7KA 5F1LA 5EPRA 4TU4A 3MUKA 3T9KA 2L7PA 4IC2A 3GV4A 3UVWA 4FO9A 2YU4A 5E7DA 4AYCA 2I7KA 4AKIA 3EB6A 1HYJA 4O74A 1WEUA 3HMEA 3FM8C 5FFWA 4UITA 5A85A 5DFCA 2RNYA 5EM3A 5G04B 2F6JA 3RTRB 4CFLA 5EWDA 5HENA 3JVKA 4YYGA 2JMDA 1WGMA 2RI7A 5EI4A 3SVHA 4O75A 4UIZA 1WIMA 2KKXA 5HCLA 3ASLA 4CL9A 4WZ2A 2R0VA 5I86A 5F3AA 3O35A 2BAYA 2YQDA 1E4UA 5FBXA 2MT5A 4NXJA 4CURA 4HXPA 4TZ2A 5HRWA 4OGCA 2VPGA 2H0DB 4PPEA 4YC9A 4L58A 5HEMA 2YELA 4A9KA 5CGPA 5CUEA 5DINA 3DWYA 5DKCA 5E9KA 2DSMA 2L0BA 2XOYA 1VD4A 2EODA 4QUUA 4O62A 5D7XA 4MR3A 2K4DA 4IR6A 3PURA 4AYCB 1VYXA 3MXFA 4YBSA 3E2DA 3M99A 5D3RA 5ENJA 4A9LA 2E6RA 4XY9A 5B8DA 4TT4A 4OGJA 4O76A 2RS9B 4X3GA 3G0LA 2CKLB 4IR4A 5F5ZA 1WE9A 4NRBA 3ZPV1 3FL2A 5FG6A 4GB0A 2FUIA 3M63A 2VPBA 4UIYA 5EP7A 3M62A 5EQ1A 5FE1A 4QSSA 5D3PA 2ECNA 5D0CA 4LC2A 1V87A 3GG3A 4QB3A 3D1BA 4QY4A 4QEVA 5D3JA 3FAOA 2DVVA 2LN0A 4OGEA 1WEMA 5CQAA 5EU1A 2H60A 5DYUA 2XP0A 2Y1MA 5IGMA 2MKEA 3S91A 2CONA 4Z1QA 4I7DA 2QICA 5G0FA 2KFTA 2CSVA 3FANA 3N9OA 4ZDTA 4HXSA 2CRWA 3FKMX 5CP5A 2K1JA 5E9YA 4E96A 2LGGA 3DDTA 5E0RA 5FG5A 4B7YC 4F1PA 5KTWA 5LUUA 2F6NA 2MIQA 5CRMA 3LQIA 5A5SA 2CKLA 5F60A 5F62A 5KHMA 5IGNA 5KO4A 5I83A 4MEOA 2KTBB 4NUEA 4MR4A 2EGMA 1LDJB 4Z0RA 2D8UA 3ZYQA 5FE6A 5B79A 4QSWA 3JVJA 3AQAA 2MD8C 4TKPB 5TDRA 4XYAA 2OWAA 5AIUA 4R7EA 1ZS5A 5FH8A 4YBMA 5C13A 1RMDA 3ZNIA 1JM7A 5FE3A 4C67A 3FJUB 2H0DA 4NYWA 5I40A 3HTKC 3LJUX 3ZVYA 4NRAA 5C8GA 3ONIA 2LV9A 1E6IA 4HXLA 5SVIB 3T7LA 2KKYA 4UIUA 4PS5A 3U5OA 5LVRA 3FEHA 5DYXA 2QIZA 2M6MA 4QUTA 3P1DA 5LKXA 4QEUA 5EWCA 1U6GB 4O71A 3HCUA 4V3KC 2KU3A 3AADA 2K16A 3U5LA 4A9OA 4TQNA 5KH9A 4PKLA 2E3KA 3ZYUA 5FEYA 2L85A 5ENIA 3LXJA 5JI8A 3H7HA 5TDWA 4YYJA 2OXQC 4MR6A 5D3TA 3V43A 2DVRA 3U5MA 3HMHA 4LZ2A 3NXBA 2D9EA 4MEPA 2L43A 4TT2A 3UVDA 5EWWA 4NN2A 3N9PA 4C66A 5D3SA 5HQ6A 3VKGA 5FH7A 2JM3A 1MBMA 3L1XA 2CT2A 3PHDA 2D82A 5ACYA 1FP0A 3LVRE 5A81A 4NUDA 2YEKA 4HBYA 4R2YA 4GNGA 2HYED 4J3IA 4Z6IA 2GRCA 2DVSA 2G45A 4MVTA 5FE9A 5CPEA 4NR6A 4AI6A 3QZVA 4YYKA 5HELA 4AKNA 5A5PA 4CUPA 1X0JA 2RFJA 4NUCA 4YH4A 5G4SA 1G25A 5LKUA 2G6QA 4NYXA 5L8UA 4LZSA 2MD7B 2M85A 2NAAA 2MNZA 3RCWA 5DBMA 3ERRA 3P1EA 4FLPA 5A7CA 1DCQA 2MA6A 5CQ3A 5LJ0A 4MR5A 1ZKRA 3UV5A 3UW9A 4IR3A 5AMFA 1FBVA 1XWHA 2EJNA 2G43A 2KWNA 2VJEB 4UYEA 5I89A 5CFWA 4ZQLA 2YW8A 4GNDA 1WUGA 2PNXA 3DAIA 5EPBA 5IBNA 3LVQE 5FE0A 5E3GA 5LJ1A 2VNFA 2YEMA 5II2A 4LYWA 3MHHA 2K17A 1WUMA 1F68A 5DW2A 4YY6A 5SVXA 4ZUXU 3LQJA 2JRJA 4QC3A 5B76A 5EGUA 1JOCA 4N4IA 5F63A 4HXMA 2ECGA 5F25A 4UP5A 4S3OB 5D1MB 3L11A 4FJCA 4I7BA 5LKZA 2DVQA 5BT5A 4YH3A 2YURA 1WEQA 5A5QA 5F1HA 3D7CA
chains in the Genus database with same CATH topology
5HFRA 5TRBA 4YATA 3DPLR 3SVFA 3RPGB 5FB1A 4WHWA 4DONA 5L98A 2C2VS 4WIVA 4BBQA 3IU5A 4UYHA 1WFKA 4A9EA 4AVXA 1MM3A 2VJEA 4IOOA 5ENHA 3O34A 4N4HA 3O36A 2ECJA 2RNWA 4NR8A 4A0CD 4MENA 4LJNA 2RO1A 4YYMA 4BW1A 5EVAA 5LCWB 4UYGA 3U5PA 2NXBA 2WP2A 5FE5A 1WEEA 4LYIA 2M3HA 2OUOA 2LGKA 2R0SA 4UIWA 3UVXA 5BT4A 5A5NA 3PUQA 4LDFA 4QSTA 5ENCA 4GNFA 5G05B 4B86C 5F61A 2RNXA 4O78A 5ETDA 5DYCA 5LJ2A 5B77A 4HXKA 5I88A 4HXNA 4N4FA 5HM0A 5TABA 5KH3A 5HRVA 2RSDA 2Y1NA 2KIZA 4NR7A 5H1VA 1N87A 5FFVA 3ZPVE 5COIA 4MEQA 3S92A 3LJWA 4O7CA 2KR4A 3NG2A 2MJVB 4LYSA 2YDWA 3O7AA 5L8TA 1VFYA 4Z1SA 3SHBA 4NRCA 4PY6A 4O7BA 2LGVA 2KWOA 2LQ6A 4ZW1A 4QYLA 3GL6A 4QSRA 4UYDA 4TS8A 1N72A 4TT6A 3Q2FA 5K29A 4FIPA 2OO1A 2KWKA 4BJXA 5ENEA 4AP4A 1K2FA 5I1QA 4KCXA 2L80A 4A4BA 4LZRA 3P5OA 2F42A 5CUCA 4YYIA 5H1TA 5CUDA 5HFQA 4OGIA 3K2JA 5DX4A 5AD2A 4I7CA 4BW3A 5LKTA 2VJFA 5D3NA 5A82A 4PTBA 4A9JA 3L1ZB 4OUFA 5TB6A 4CUSA 3P1FA 1X4UA 3O70A 4L7XA 5DLXA 3HCTA 4NQNA 4Q0OA 4J0RA 4QC1A 1WEVA 5DW1A 5L99A 2ECVA 5A83A 4J0SA 3N9QA 2AN6A 5DFBA 3ZTGA 4C9ZA 4WHUA 5EICA 5KTXA 2G4AA 4KV1A 2YSMA 1BORA 5FB0A 1JM7B 4UIXA 4YYHA 4O7EA 2ECWA 4UI9B 1F62A 3UV4A 3TLPA 5CRZA 5CQ4A 3N9NA 5KH7A 4IOQA 3I2DA 2DATA 4LLBA 4TYLA 5E9IA 5FFYA 4QSQA 5EWHA 2KGGA 5LVQA 5H85A 4N4GA 5EV9A 5I3LA 2EA6A 5I29A 3N9LA 4NR4A 2DWWA 4CUUA 2ECTA 5FH6A 5FE8A 5J3XA 4NS5A 2KYUA 3IHPA 4UYFA 2KE1A 4QF3A 2KREA 5JWMA 5C7NA 2PUYA 4HBVA 5G4RA 2XEUA 4NR9A 3KV5A 3C6WA 4N3WA 2MA5A 5I80A 1MM2A 5DKDA 2ZETC 4BHWA 4IC3A 5H9MA 3SOUA 5L97A 4R8PK 5CUBA 3LRQA 4Z6HA 2JMJA 2E6SA 3EB5A 4CFKA 3HMFA 4HBWA 1JM4B 5D24A 5BT3A 2D8SA 2L5EA 4QZSA 5HQ5A 4Y03A 3ZVZB 5EWVA 5FE4A 4V3LC 4UP0A 4GNEA 3UV2A 4HBXA 4QSXA 5FERA 2MNYA 1WEOA 2E7NA 5CQ6A 5E3DA 4KV4A 5EYAF 4XUBA 5D1KB 5A5RA 1ZBDB 3HCSA 5AITA 5CQ8A 4XUAA 4TTEA 3QZSA 2MUMA 3IU6A 1Z2QA 4YABA 3MB3A 4LR6A 4Q6FA 4LADB 2KWJA 5E74A 5CS8A 5I7XA 4LRGA 5C89A 4P5OB 5I7YA 3U5KA 4WZ0A 5E73A 2LXPC 5TBNA 1Z6UA 4QNSA 4Q0NA 4O72A 5D1LB 3G0JA 1X4JA 5IG6A 3MULA 1T1HA 3RPGC 5TCMA 5C4QA 3KNVA 4LK9A 5CTLA 4A9MA 4XY8A 5E9LA 4Z93A 4F3IA 2YHNA 3Q2EA 2YQMA 5EPSA 4F52B 2N9GA 5CQ5A 2XB1A 4NQMA 4A49A 4AUQB 5IIDA 5AD3A 1Z60A 4HXRA 3U5NA 4RVRA 4YY4A 2OSSA 1EQFA 2C2LA 5DLZA 2VJFB 5DKHA 2CSYA 1DVPA 5FE2A 5H1UA 4FK5A 2CSZA 2YSJA 2YUCA 5KTUA 4YADA 5E9VA 4J1PA 4UYFB 4CLBA 5L96A 5DFDA 4CA1A 2JMIA 5IGLA 2Y43A 4NYVA 5CY9A 2YW5A 5HQ7A 4TZ8A 4TU6A 4CCGX 2FUUA 4QBMA 4WZ3B 1X4IA 3KQIA 4O7FA 4A9FA 4IORA 3MHSA 3SVGA 4YYNA 5ENGA 5IGKA 2QJ0A 1LDKC 4YYDA 5C87A 1WEPA 4MSXA 5DYAA 3SOXA 2UZGA 5CUGA 4ALHA 5CQTA 4O7AA 3N9MA 4QEWA 2M1RA 3C5KA 5A5OA 4HXOA 5F2PA 1WENA 5B75A 5C11A 2FSAA 4XI1A 5ENBA 4A9HA 2YT5A 4X2IA 2VPEA 2YYRA 3MQMA 5D25A 4UIVA 4QF2A 1HYIA 5HRXA 3MB4A 5DY7A 2I50A 2LSPB 3U5JA 3P1CA 5EISA 5ENFA 2YHOA 1IYMA 2LRIC 5J0DA 3SOWA 3QZTA 3I3JA 1JSPB 1WEWA 4YBTA 2L5UA 5JG6A 2YREA 4QR4A 4BW2A 5II1A 5FG4A 2L84A 3T6RA 2DKWA 4O77A 4IR5A 4A9IA 2R0YA 5EK9A 4ALGA 2YYNA 4QR3A 4S3OC 5CQ7A 4W4UA 5ETBA 5E9MA 5CZGA 4QSPA 3O33A 2VP7A 5AMEA 4CUTA 1WESA 4WA6A 4ZC9A 4BW4A 2EGPA 4O64A 2LDRA 4NR5A 4YK0A 4PCIA 5CU8A 5D3HA 2IDAA 2KGIA 3DQVR 5KU3A 2LXHC 5CUAA 4GPJA 2WP1A 4QSUA 5HJCA 5EA1A 4QSVA 1WILA 5B78A 2YQLA 2E7OA 2R10A 4O70A 5D26A 3LQHA 4YAXA 5D3LA 3JVMA 5HLSA 1CHCA 2L75A 5F36A 2VPDA 2ECIA 4QR5A 3KV6A 3O37A 3UVYA 4A4CA 5DKAA 4A9NA 4QYDA 5C85A 3JVLA 5FDZA 2HDPA 4LKAA 2LGLA 4PCEA 5FE7A 2I8NA 4CUQA 3VK6A 2DX8A 5F1LA 5EPRA 4TU4A 3MUKA 4IC2A 3GV4A 3UVWA 4FO9A 2YU4A 5E7DA 4AYCA 2I7KA 3EB6A 1HYJA 4O74A 1WEUA 3HMEA 5FFWA 4UITA 5A85A 5DFCA 2RNYA 5EM3A 5G04B 2F6JA 3RTRB 4CFLA 5EWDA 5HENA 3JVKA 4YYGA 2JMDA 1WGMA 2RI7A 5EI4A 3SVHA 4O75A 4UIZA 1WIMA 3ASLA 5HCLA 4WZ2A 4CL9A 2R0VA 5I86A 5F3AA 3O35A 2BAYA 2YQDA 1E4UA 5FBXA 2MT5A 4NXJA 4CURA 4HXPA 4TZ2A 5HRWA 2VPGA 2H0DB 4PPEA 4YC9A 4L58A 5HEMA 2YELA 4A9KA 5CGPA 5CUEA 5DINA 3DWYA 5DKCA 5E9KA 2L0BA 1VD4A 2EODA 4QUUA 5D7XA 4MR3A 2K4DA 4IR6A 3PURA 4AYCB 1VYXA 3MXFA 4YBSA 3M99A 5D3RA 5ENJA 4A9LA 2E6RA 4XY9A 5B8DA 4TT4A 4OGJA 4O76A 2RS9B 4X3GA 3G0LA 2CKLB 4IR4A 5F5ZA 1WE9A 4NRBA 3ZPV1 3FL2A 5FG6A 4GB0A 2FUIA 3M63A 2VPBA 4UIYA 5EP7A 3M62A 5EQ1A 5FE1A 4QSSA 5D3PA 2ECNA 5D0CA 4LC2A 1V87A 3GG3A 4QB3A 4QY4A 4QEVA 5D3JA 2DVVA 2LN0A 1WEMA 5CQAA 5EU1A 2H60A 5DYUA 2Y1MA 5IGMA 3S91A 4Z1QA 4I7DA 2QICA 5G0FA 2KFTA 3N9OA 4ZDTA 4HXSA 2K1JA 3FKMX 5CP5A 2LGGA 5E9YA 4E96A 4B7YC 5E0RA 5FG5A 5KTWA 5LUUA 2F6NA 2MIQA 5CRMA 3LQIA 5A5SA 2CKLA 5F60A 5F62A 5KHMA 5IGNA 5KO4A 5I83A 4MEOA 2KTBB 4NUEA 4MR4A 1LDJB 3ZYQA 5FE6A 5B79A 4QSWA 3JVJA 3AQAA 2MD8C 4TKPB 5TDRA 4XYAA 5AIUA 4R7EA 1ZS5A 5FH8A 4YBMA 5C13A 1RMDA 3ZNIA 1JM7A 5FE3A 4C67A 2H0DA 4NYWA 5I40A 3HTKC 3ZVYA 4NRAA 5C8GA 3ONIA 2LV9A 1E6IA 4HXLA 3T7LA 4UIUA 4PS5A 3U5OA 5LVRA 5DYXA 2QIZA 2M6MA 4QUTA 3P1DA 5LKXA 4QEUA 5EWCA 1U6GB 4O71A 3HCUA 4V3KC 2KU3A 3AADA 2K16A 3U5LA 4A9OA 4TQNA 5KH9A 4PKLA 2E3KA 3ZYUA 5FEYA 2L85A 5ENIA 3LXJA 5JI8A 5TDWA 4YYJA 2OXQC 4MR6A 5D3TA 3V43A 2DVRA 3U5MA 3HMHA 4LZ2A 3NXBA 2D9EA 4MEPA 2L43A 4TT2A 3UVDA 5EWWA 4NN2A 3N9PA 4C66A 5D3SA 5HQ6A 5FH7A 3L1XA 2CT2A 3PHDA 2D82A 5ACYA 1FP0A 5A81A 4NUDA 2YEKA 4HBYA 4R2YA 4GNGA 2HYED 4J3IA 4Z6IA 2GRCA 2DVSA 2G45A 4MVTA 5FE9A 5CPEA 4NR6A 3QZVA 4YYKA 5HELA 4AKNA 5A5PA 4CUPA 1X0JA 2RFJA 4NUCA 4YH4A 5G4SA 1G25A 5LKUA 2G6QA 4NYXA 5L8UA 4LZSA 2MD7B 2M85A 2NAAA 2MNZA 3RCWA 5DBMA 4FLPA 3P1EA 5A7CA 2MA6A 5CQ3A 5LJ0A 4MR5A 3UV5A 3UW9A 4IR3A 5AMFA 1FBVA 1XWHA 2KWNA 2G43A 2VJEB 4UYEA 5I89A 5CFWA 4ZQLA 2YW8A 4GNDA 1WUGA 2PNXA 3DAIA 5EPBA 5IBNA 5FE0A 5E3GA 5LJ1A 2VNFA 2YEMA 5II2A 4LYWA 3MHHA 2K17A 1WUMA 1F68A 5DW2A 4YY6A 4ZUXU 3LQJA 2JRJA 4QC3A 5B76A 5EGUA 1JOCA 4N4IA 5F63A 4HXMA 2ECGA 5F25A 4UP5A 4S3OB 5D1MB 3L11A 4FJCA 4I7BA 5LKZA 2DVQA 5BT5A 4YH3A 2YURA 1WEQA 5A5QA 5F1HA 3D7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFR A;  5TRB A;  4YAT A;  3DPL R;  3SVF A;  3RPG B;  5FB1 A;  4WHW A;  4DON A;  5L98 A;  2C2V S;  4WIV A;  4BBQ A;  3IU5 A;  4UYH A;  1WFK A;  4A9E A;  4AVX A;  1MM3 A;  2VJE A;  4IOO A;  5ENH A;  3O34 A;  4N4H A;  3O36 A;  2ECJ A;  2RNW A;  4NR8 A;  4A0C D;  4MEN A;  4LJN A;  2RO1 A;  4YYM A;  4BW1 A;  5EVA A;  5LCW B;  4UYG A;  3U5P A;  2NXB A;  2WP2 A;  5FE5 A;  1WEE A;  4LYI A;  2M3H A;  2OUO A;  2LGK A;  2R0S A;  4UIW A;  3UVX A;  5BT4 A;  5A5N A;  3PUQ A;  4LDF A;  4QST A;  5ENC A;  4GNF A;  5G05 B;  4B86 C;  5F61 A;  2RNX A;  4O78 A;  5ETD A;  5DYC A;  5LJ2 A;  5B77 A;  4HXK A;  5I88 A;  4HXN A;  4N4F A;  5HM0 A;  5TAB A;  5KH3 A;  5HRV A;  2RSD A;  2Y1N A;  2KIZ A;  4NR7 A;  5H1V A;  1N87 A;  5FFV A;  3ZPV E;  5COI A;  4MEQ A;  3S92 A;  3LJW A;  4O7C A;  2KR4 A;  3NG2 A;  2MJV B;  4LYS A;  2YDW A;  3O7A A;  5L8T A;  1VFY A;  4Z1S A;  3SHB A;  4NRC A;  4PY6 A;  4O7B A;  2LGV A;  2KWO A;  2LQ6 A;  4ZW1 A;  4QYL A;  3GL6 A;  4QSR A;  4UYD A;  4TS8 A;  1N72 A;  4TT6 A;  3Q2F A;  5K29 A;  4FIP A;  2OO1 A;  2KWK A;  4BJX A;  5ENE A;  4AP4 A;  1K2F A;  5I1Q A;  4KCX A;  2L80 A;  4A4B A;  4LZR A;  3P5O A;  2F42 A;  5CUC A;  4YYI A;  5H1T A;  5CUD A;  5HFQ A;  4OGI A;  3K2J A;  5DX4 A;  5AD2 A;  4I7C A;  4BW3 A;  5LKT A;  2VJF A;  5D3N A;  5A82 A;  4PTB A;  4A9J A;  3L1Z B;  4OUF A;  5TB6 A;  4CUS A;  3P1F A;  1X4U A;  3O70 A;  4L7X A;  5DLX A;  3HCT A;  4NQN A;  4Q0O A;  4J0R A;  4QC1 A;  1WEV A;  5DW1 A;  5L99 A;  2ECV A;  5A83 A;  4J0S A;  3N9Q A;  2AN6 A;  5DFB A;  3ZTG A;  4C9Z A;  4WHU A;  5EIC A;  5KTX A;  2G4A A;  4KV1 A;  2YSM A;  1BOR A;  5FB0 A;  1JM7 B;  4UIX A;  4YYH A;  4O7E A;  2ECW A;  4UI9 B;  1F62 A;  3UV4 A;  3TLP A;  5CRZ A;  5CQ4 A;  3N9N A;  5KH7 A;  4IOQ A;  3I2D A;  2DAT A;  4LLB A;  4TYL A;  5E9I A;  5FFY A;  4QSQ A;  5EWH A;  2KGG A;  5LVQ A;  5H85 A;  4N4G A;  5EV9 A;  5I3L A;  2EA6 A;  5I29 A;  3N9L A;  4NR4 A;  2DWW A;  4CUU A;  2ECT A;  5FH6 A;  5FE8 A;  5J3X A;  4NS5 A;  2KYU A;  3IHP A;  4UYF A;  2KE1 A;  4QF3 A;  2KRE A;  5JWM A;  5C7N A;  2PUY A;  4HBV A;  5G4R A;  2XEU A;  4NR9 A;  3KV5 A;  3C6W A;  4N3W A;  2MA5 A;  5I80 A;  1MM2 A;  5DKD A;  2ZET C;  4BHW A;  4IC3 A;  5H9M A;  3SOU A;  5L97 A;  4R8P K;  5CUB A;  3LRQ A;  4Z6H A;  2JMJ A;  2E6S A;  3EB5 A;  4CFK A;  3HMF A;  4HBW A;  1JM4 B;  5D24 A;  5BT3 A;  2D8S A;  2L5E A;  4QZS A;  5HQ5 A;  4Y03 A;  3ZVZ B;  5EWV A;  5FE4 A;  4V3L C;  4UP0 A;  4GNE A;  3UV2 A;  4HBX A;  4QSX A;  5FER A;  2MNY A;  1WEO A;  2E7N A;  5CQ6 A;  5E3D A;  4KV4 A;  5EYA F;  4XUB A;  5D1K B;  5A5R A;  1ZBD B;  3HCS A;  5AIT A;  5CQ8 A;  4XUA A;  4TTE A;  3QZS A;  2MUM A;  3IU6 A;  1Z2Q A;  4YAB A;  3MB3 A;  4LR6 A;  4Q6F A;  4LAD B;  2KWJ A;  5E74 A;  5CS8 A;  5I7X A;  4LRG A;  5C89 A;  4P5O B;  5I7Y A;  3U5K A;  4WZ0 A;  5E73 A;  2LXP C;  5TBN A;  1Z6U A;  4QNS A;  4Q0N A;  4O72 A;  5D1L B;  3G0J A;  1X4J A;  5IG6 A;  3MUL A;  1T1H A;  3RPG C;  5TCM A;  5C4Q A;  3KNV A;  4LK9 A;  5CTL A;  4A9M A;  4XY8 A;  5E9L A;  4Z93 A;  4F3I A;  2YHN A;  3Q2E A;  2YQM A;  5EPS A;  4F52 B;  2N9G A;  5CQ5 A;  2XB1 A;  4NQM A;  4A49 A;  4AUQ B;  5IID A;  5AD3 A;  1Z60 A;  4HXR A;  3U5N A;  4RVR A;  4YY4 A;  2OSS A;  1EQF A;  2C2L A;  5DLZ A;  2VJF B;  5DKH A;  2CSY A;  1DVP A;  5FE2 A;  5H1U A;  4FK5 A;  2CSZ A;  2YSJ A;  2YUC A;  5KTU A;  4YAD A;  5E9V A;  4J1P A;  4UYF B;  4CLB A;  5L96 A;  5DFD A;  4CA1 A;  2JMI A;  5IGL A;  2Y43 A;  4NYV A;  5CY9 A;  2YW5 A;  5HQ7 A;  4TZ8 A;  4TU6 A;  4CCG X;  2FUU A;  4QBM A;  4WZ3 B;  1X4I A;  3KQI A;  4O7F A;  4A9F A;  4IOR A;  3MHS A;  3SVG A;  4YYN A;  5ENG A;  5IGK A;  2QJ0 A;  1LDK C;  4YYD A;  5C87 A;  1WEP A;  4MSX A;  5DYA A;  3SOX A;  2UZG A;  5CUG A;  4ALH A;  5CQT A;  4O7A A;  3N9M A;  4QEW A;  2M1R A;  3C5K A;  5A5O A;  4HXO A;  5F2P A;  1WEN A;  5B75 A;  5C11 A;  2FSA A;  4XI1 A;  5ENB A;  4A9H A;  2YT5 A;  4X2I A;  2VPE A;  2YYR A;  3MQM A;  5D25 A;  4UIV A;  4QF2 A;  1HYI A;  5HRX A;  3MB4 A;  5DY7 A;  2I50 A;  2LSP B;  3U5J A;  3P1C A;  5EIS A;  5ENF A;  2YHO A;  1IYM A;  2LRI C;  5J0D A;  3SOW A;  3QZT A;  3I3J A;  1JSP B;  1WEW A;  4YBT A;  2L5U A;  5JG6 A;  2YRE A;  4QR4 A;  4BW2 A;  5II1 A;  5FG4 A;  2L84 A;  3T6R A;  2DKW A;  4O77 A;  4IR5 A;  4A9I A;  2R0Y A;  5EK9 A;  4ALG A;  2YYN A;  4QR3 A;  4S3O C;  5CQ7 A;  4W4U A;  5ETB A;  5E9M A;  5CZG A;  4QSP A;  3O33 A;  2VP7 A;  5AME A;  4CUT A;  1WES A;  4WA6 A;  4ZC9 A;  4BW4 A;  2EGP A;  4O64 A;  2LDR A;  4NR5 A;  4YK0 A;  4PCI A;  5CU8 A;  5D3H A;  2IDA A;  2KGI A;  3DQV R;  5KU3 A;  2LXH C;  5CUA A;  4GPJ A;  2WP1 A;  4QSU A;  5HJC A;  5EA1 A;  4QSV A;  1WIL A;  5B78 A;  2YQL A;  2E7O A;  2R10 A;  4O70 A;  5D26 A;  3LQH A;  4YAX A;  5D3L A;  3JVM A;  5HLS A;  1CHC A;  2L75 A;  5F36 A;  2VPD A;  2ECI A;  4QR5 A;  3KV6 A;  3O37 A;  3UVY A;  4A4C A;  5DKA A;  4A9N A;  4QYD A;  5C85 A;  3JVL A;  5FDZ A;  2HDP A;  4LKA A;  2LGL A;  4PCE A;  5FE7 A;  2I8N A;  4CUQ A;  3VK6 A;  2DX8 A;  5F1L A;  5EPR A;  4TU4 A;  3MUK A;  4IC2 A;  3GV4 A;  3UVW A;  4FO9 A;  2YU4 A;  5E7D A;  4AYC A;  2I7K A;  3EB6 A;  1HYJ A;  4O74 A;  1WEU A;  3HME A;  5FFW A;  4UIT A;  5A85 A;  5DFC A;  2RNY A;  5EM3 A;  5G04 B;  2F6J A;  3RTR B;  4CFL A;  5EWD A;  5HEN A;  3JVK A;  4YYG A;  2JMD A;  1WGM A;  2RI7 A;  5EI4 A;  3SVH A;  4O75 A;  4UIZ A;  1WIM A;  3ASL A;  5HCL A;  4WZ2 A;  4CL9 A;  2R0V A;  5I86 A;  5F3A A;  3O35 A;  2BAY A;  2YQD A;  1E4U A;  5FBX A;  2MT5 A;  4NXJ A;  4CUR A;  4HXP A;  4TZ2 A;  5HRW A;  2VPG A;  2H0D B;  4PPE A;  4YC9 A;  4L58 A;  5HEM A;  2YEL A;  4A9K A;  5CGP A;  5CUE A;  5DIN A;  3DWY A;  5DKC A;  5E9K A;  2L0B A;  1VD4 A;  2EOD A;  4QUU A;  5D7X A;  4MR3 A;  2K4D A;  4IR6 A;  3PUR A;  4AYC B;  1VYX A;  3MXF A;  4YBS A;  3M99 A;  5D3R A;  5ENJ A;  4A9L A;  2E6R A;  4XY9 A;  5B8D A;  4TT4 A;  4OGJ A;  4O76 A;  2RS9 B;  4X3G A;  3G0L A;  2CKL B;  4IR4 A;  5F5Z A;  1WE9 A;  4NRB A;  3ZPV 1;  3FL2 A;  5FG6 A;  4GB0 A;  2FUI A;  3M63 A;  2VPB A;  4UIY A;  5EP7 A;  3M62 A;  5EQ1 A;  5FE1 A;  4QSS A;  5D3P A;  2ECN A;  5D0C A;  4LC2 A;  1V87 A;  3GG3 A;  4QB3 A;  4QY4 A;  4QEV A;  5D3J A;  2DVV A;  2LN0 A;  1WEM A;  5CQA A;  5EU1 A;  2H60 A;  5DYU A;  2Y1M A;  5IGM A;  3S91 A;  4Z1Q A;  4I7D A;  2QIC A;  5G0F A;  2KFT A;  3N9O A;  4ZDT A;  4HXS A;  2K1J A;  3FKM X;  5CP5 A;  2LGG A;  5E9Y A;  4E96 A;  4B7Y C;  5E0R A;  5FG5 A;  5KTW A;  5LUU A;  2F6N A;  2MIQ A;  5CRM A;  3LQI A;  5A5S A;  2CKL A;  5F60 A;  5F62 A;  5KHM A;  5IGN A;  5KO4 A;  5I83 A;  4MEO A;  2KTB B;  4NUE A;  4MR4 A;  1LDJ B;  3ZYQ A;  5FE6 A;  5B79 A;  4QSW A;  3JVJ A;  3AQA A;  2MD8 C;  4TKP B;  5TDR A;  4XYA A;  5AIU A;  4R7E A;  1ZS5 A;  5FH8 A;  4YBM A;  5C13 A;  1RMD A;  3ZNI A;  1JM7 A;  5FE3 A;  4C67 A;  2H0D A;  4NYW A;  5I40 A;  3HTK C;  3ZVY A;  4NRA A;  5C8G A;  3ONI A;  2LV9 A;  1E6I A;  4HXL A;  3T7L A;  4UIU A;  4PS5 A;  3U5O A;  5LVR A;  5DYX A;  2QIZ A;  2M6M A;  4QUT A;  3P1D A;  5LKX A;  4QEU A;  5EWC A;  1U6G B;  4O71 A;  3HCU A;  4V3K C;  2KU3 A;  3AAD A;  2K16 A;  3U5L A;  4A9O A;  4TQN A;  5KH9 A;  4PKL A;  2E3K A;  3ZYU A;  5FEY A;  2L85 A;  5ENI A;  3LXJ A;  5JI8 A;  5TDW A;  4YYJ A;  2OXQ C;  4MR6 A;  5D3T A;  3V43 A;  2DVR A;  3U5M A;  3HMH A;  4LZ2 A;  3NXB A;  2D9E A;  4MEP A;  2L43 A;  4TT2 A;  3UVD A;  5EWW A;  4NN2 A;  3N9P A;  4C66 A;  5D3S A;  5HQ6 A;  5FH7 A;  3L1X A;  2CT2 A;  3PHD A;  2D82 A;  5ACY A;  1FP0 A;  5A81 A;  4NUD A;  2YEK A;  4HBY A;  4R2Y A;  4GNG A;  2HYE D;  4J3I A;  4Z6I A;  2GRC A;  2DVS A;  2G45 A;  4MVT A;  5FE9 A;  5CPE A;  4NR6 A;  3QZV A;  4YYK A;  5HEL A;  4AKN A;  5A5P A;  4CUP A;  1X0J A;  2RFJ A;  4NUC A;  4YH4 A;  5G4S A;  1G25 A;  5LKU A;  2G6Q A;  4NYX A;  5L8U A;  4LZS A;  2MD7 B;  2M85 A;  2NAA A;  2MNZ A;  3RCW A;  5DBM A;  4FLP A;  3P1E A;  5A7C A;  2MA6 A;  5CQ3 A;  5LJ0 A;  4MR5 A;  3UV5 A;  3UW9 A;  4IR3 A;  5AMF A;  1FBV A;  1XWH A;  2KWN A;  2G43 A;  2VJE B;  4UYE A;  5I89 A;  5CFW A;  4ZQL A;  2YW8 A;  4GND A;  1WUG A;  2PNX A;  3DAI A;  5EPB A;  5IBN A;  5FE0 A;  5E3G A;  5LJ1 A;  2VNF A;  2YEM A;  5II2 A;  4LYW A;  3MHH A;  2K17 A;  1WUM A;  1F68 A;  5DW2 A;  4YY6 A;  4ZUX U;  3LQJ A;  2JRJ A;  4QC3 A;  5B76 A;  5EGU A;  1JOC A;  4N4I A;  5F63 A;  4HXM A;  2ECG A;  5F25 A;  4UP5 A;  4S3O B;  5D1M B;  3L11 A;  4FJC A;  4I7B A;  5LKZ A;  2DVQ A;  5BT5 A;  4YH3 A;  2YUR A;  1WEQ A;  5A5Q A;  5F1H A;  3D7C A; 
#chains in the Genus database with same CATH topology
 3KDE C;  5HFR A;  5TRB A;  4YAT A;  3DPL R;  3SVF A;  3RPG B;  5FB1 A;  4WHW A;  4DON A;  5L98 A;  2C2V S;  4WIV A;  4BBQ A;  3IU5 A;  4UYH A;  1WFK A;  4A9E A;  4AVX A;  1MM3 A;  2VJE A;  4IOO A;  5ENH A;  3O34 A;  4N4H A;  3O36 A;  2ECJ A;  2RNW A;  4NR8 A;  4A0C D;  4MEN A;  3PLW A;  4LJN A;  2RO1 A;  4YYM A;  4BW1 A;  5EVA A;  5LCW B;  4UYG A;  3U5P A;  2NXB A;  2WP2 A;  5FE5 A;  1WEE A;  4LYI A;  2M3H A;  2OUO A;  2LGK A;  2R0S A;  4UIW A;  3UVX A;  5BT4 A;  5A5N A;  3D1D A;  3PUQ A;  4AKG A;  4LDF A;  4QST A;  5ENC A;  4GNF A;  5G05 B;  5SVY A;  5F61 A;  4B86 C;  2RNX A;  4O78 A;  5ETD A;  5DYC A;  3O47 A;  5LJ2 A;  5B77 A;  4HXK A;  5I88 A;  4HXN A;  4N4F A;  5HM0 A;  5TAB A;  5KH3 A;  1PUO A;  5HRV A;  2RSD A;  2Y1N A;  2KIZ A;  4NR7 A;  5H1V A;  1N87 A;  3DWD A;  5FFV A;  3ZPV E;  5COI A;  4MEQ A;  3S92 A;  3LJW A;  4O7C A;  2KR4 A;  3NG2 A;  2MJV B;  4LYS A;  2YDW A;  3O7A A;  5L8T A;  1VFY A;  4Z1S A;  3SHB A;  4NRC A;  4PY6 A;  4O7B A;  2LGV A;  2KWO A;  2LQ6 A;  4ZW1 A;  4QYL A;  3GL6 A;  4QSR A;  2P57 A;  2XOZ A;  4UYD A;  4TS8 A;  1N72 A;  4TT6 A;  3Q2F A;  5K29 A;  4FIP A;  2OO1 A;  2KWK A;  4BJX A;  5ENE A;  4AP4 A;  3Q1D A;  1K2F A;  5I1Q A;  4KCX A;  2L80 A;  4A4B A;  4LZR A;  3P5O A;  2F42 A;  5CUC A;  4YYI A;  5H1T A;  5CUD A;  5HFQ A;  4OGI A;  3K2J A;  5DX4 A;  5AD2 A;  3MDB C;  4I7C A;  4BW3 A;  5LKT A;  2VJF A;  5D3N A;  5A82 A;  4Z0O A;  4PTB A;  4A9J A;  3L1Z B;  4OUF A;  5TB6 A;  4CUS A;  3P1F A;  1X4U A;  3O70 A;  4L7X A;  5DLX A;  3HCT A;  4NQN A;  4Q0O A;  4J0R A;  4QC1 A;  1WEV A;  5DW1 A;  5L99 A;  2ECV A;  5A83 A;  4J0S A;  3N9Q A;  2AN6 A;  5DFB A;  3ZTG A;  4C9Z A;  3VKH A;  4WHU A;  5EIC A;  5KTX A;  2G4A A;  4KV1 A;  2YSM A;  1BOR A;  5FB0 A;  1JM7 B;  4UIX A;  4YYH A;  4O7E A;  2ECW A;  4UI9 B;  1F62 A;  3UV4 A;  3TLP A;  3LDY A;  5CRZ A;  5CQ4 A;  3N9N A;  5KH7 A;  4IOQ A;  3I2D A;  2DAT A;  4LLB A;  4TYL A;  5E9I A;  5FFY A;  4QSQ A;  5EWH A;  2KGG A;  5LVQ A;  5H85 A;  4N4G A;  5EV9 A;  5I3L A;  2EA6 A;  2YVR A;  5I29 A;  3N9L A;  4NR4 A;  2DWW A;  4CUU A;  2ECT A;  5FH6 A;  5FE8 A;  5J3X A;  4NS5 A;  2KYU A;  3IHP A;  4UYF A;  2KE1 A;  4QF3 A;  2KRE A;  2EXU A;  5JWM A;  5C7N A;  2PUY A;  4HBV A;  5G4R A;  2M13 A;  4NR9 A;  2XEU A;  3JUE A;  3KV5 A;  3C6W A;  4N3W A;  2MA5 A;  5I80 A;  2CRR A;  1MM2 A;  5DKD A;  2ZET C;  4BHW A;  4IC3 A;  5H9M A;  3SOU A;  5L97 A;  4R8P K;  5CUB A;  3LRQ A;  4Z6H A;  2JMJ A;  2E6S A;  3EB5 A;  4CFK A;  3HMF A;  4HBW A;  1JM4 B;  5D24 A;  5BT3 A;  2D8S A;  5K3Q A;  2L5E A;  4QZS A;  5HQ5 A;  4Y03 A;  3ZVZ B;  5EWV A;  5FE4 A;  4V3L C;  4UP0 A;  4GNE A;  3UV2 A;  4HBX A;  4QSX A;  5FER A;  2MNY A;  1WEO A;  2E7N A;  5CQ6 A;  5E3D A;  2B0O E;  4KV4 A;  5EYA F;  4XUB A;  5D1K B;  5A5R A;  1ZBD B;  3HCS A;  5AIT A;  5CQ8 A;  4XUA A;  4TTE A;  3QZS A;  2MUM A;  3IU6 A;  1Z2Q A;  4YAB A;  3MB3 A;  4LR6 A;  4Q6F A;  4LAD B;  2KWJ A;  5E74 A;  5CS8 A;  5I7X A;  4LRG A;  5C89 A;  4P5O B;  5I7Y A;  3U5K A;  4WZ0 A;  5E73 A;  2LXP C;  5TBN A;  1Z6U A;  4QNS A;  4Q0N A;  4O72 A;  5D1L B;  3G0J A;  1X4J A;  5IG6 A;  3MUL A;  1T1H A;  3RPG C;  5TCM A;  4AKH A;  5C4Q A;  3KNV A;  4LK9 A;  5CTL A;  4A9M A;  4XY8 A;  5E9L A;  4Z93 A;  4F3I A;  2YHN A;  3Q2E A;  2YQM A;  5EPS A;  4F52 B;  2N9G A;  5CQ5 A;  2XB1 A;  4NQM A;  4A49 A;  4AUQ B;  5IID A;  5AD3 A;  1Z60 A;  4HXR A;  3U5N A;  4RVR A;  4YY4 A;  2OSS A;  1EQF A;  2C2L A;  5DLZ A;  2VJF B;  5DKH A;  2CSY A;  1DVP A;  5FE2 A;  5H1U A;  4FK5 A;  2CSZ A;  2YSJ A;  2YUC A;  5KTU A;  4YAD A;  5E9V A;  4J1P A;  4UYF B;  4CLB A;  5L96 A;  5DFD A;  4CA1 A;  2JMI A;  5IGL A;  2Y43 A;  4NYV A;  2FFW A;  5CY9 A;  2YW5 A;  5HQ7 A;  4TZ8 A;  4TU6 A;  4CCG X;  2FUU A;  4QBM A;  4WZ3 B;  1X4I A;  3KQI A;  4O7F A;  4A9F A;  4IOR A;  3MHS A;  3SVG A;  4YYN A;  5ENG A;  5IGK A;  2DJA A;  1LDK C;  2QJ0 A;  4YYD A;  2IQJ A;  5C87 A;  1WEP A;  4MSX A;  5DYA A;  3SOX A;  4H9D A;  2UZG A;  5CUG A;  4ALH A;  5CQT A;  3SUB A;  4O7A A;  3N9M A;  4QEW A;  2M1R A;  3C5K A;  5A5O A;  4HXO A;  5F2P A;  1WEN A;  5B75 A;  5C11 A;  2FSA A;  4XI1 A;  5ENB A;  4A9H A;  2YT5 A;  4X2I A;  2VPE A;  2YYR A;  3MQM A;  5D25 A;  4UIV A;  4QF2 A;  1HYI A;  5HRX A;  3MB4 A;  5DY7 A;  2I50 A;  2LSP B;  3U5J A;  3P1C A;  5EIS A;  5ENF A;  2YHO A;  1IYM A;  2LRI C;  5J0D A;  3SOW A;  3QZT A;  2LAU A;  3I3J A;  1JSP B;  1WEW A;  4YBT A;  2L5U A;  5JG6 A;  2YRE A;  4QR4 A;  4BW2 A;  5II1 A;  5FG4 A;  2L84 A;  3T6R A;  2DKW A;  2E61 A;  4O77 A;  4IR5 A;  4A9I A;  2R0Y A;  5EK9 A;  4ALG A;  2YYN A;  4QR3 A;  4S3O C;  5CQ7 A;  4W4U A;  5ETB A;  5E9M A;  5CZG A;  4QSP A;  3O33 A;  2VP7 A;  5AME A;  4CUT A;  1WES A;  4WA6 A;  4ZC9 A;  4BW4 A;  2EGP A;  4O64 A;  2LDR A;  4NR5 A;  5SVI A;  4YK0 A;  4PCI A;  5CU8 A;  5D3H A;  2IDA A;  2KGI A;  4QQ4 A;  3DQV R;  5KU3 A;  2LXH C;  5CUA A;  4GPJ A;  2WP1 A;  4QSU A;  5HJC A;  5EA1 A;  4QSV A;  1WIL A;  2FD4 A;  5B78 A;  2YQL A;  2E7O A;  2R10 A;  4O70 A;  5D26 A;  3LQH A;  2RR4 A;  4YAX A;  5D3L A;  3JVM A;  5HLS A;  1CHC A;  2L75 A;  5F36 A;  2VPD A;  2ECI A;  4QR5 A;  3KV6 A;  3O37 A;  3UVY A;  4A4C A;  2JUN A;  4A9N A;  4QYD A;  5DKA A;  5C85 A;  3JVL A;  5FDZ A;  2HDP A;  4LKA A;  2LGL A;  4PCE A;  5FE7 A;  2I8N A;  4CUQ A;  3VK6 A;  2XOC A;  2DX8 A;  3M7K A;  5F1L A;  5EPR A;  4TU4 A;  3MUK A;  3T9K A;  2L7P A;  4IC2 A;  3GV4 A;  3UVW A;  4FO9 A;  2YU4 A;  5E7D A;  4AYC A;  2I7K A;  4AKI A;  3EB6 A;  1HYJ A;  4O74 A;  1WEU A;  3HME A;  3FM8 C;  5FFW A;  4UIT A;  5A85 A;  5DFC A;  2RNY A;  5EM3 A;  5G04 B;  2F6J A;  3RTR B;  4CFL A;  5EWD A;  5HEN A;  3JVK A;  4YYG A;  2JMD A;  1WGM A;  2RI7 A;  5EI4 A;  3SVH A;  4O75 A;  4UIZ A;  1WIM A;  2KKX A;  5HCL A;  3ASL A;  4CL9 A;  4WZ2 A;  2R0V A;  5I86 A;  5F3A A;  3O35 A;  2BAY A;  2YQD A;  1E4U A;  5FBX A;  2MT5 A;  4NXJ A;  4CUR A;  4HXP A;  4TZ2 A;  5HRW A;  4OGC A;  2VPG A;  2H0D B;  4PPE A;  4YC9 A;  4L58 A;  5HEM A;  2YEL A;  4A9K A;  5CGP A;  5CUE A;  5DIN A;  3DWY A;  5DKC A;  5E9K A;  2DSM A;  2L0B A;  2XOY A;  1VD4 A;  2EOD A;  4QUU A;  4O62 A;  5D7X A;  4MR3 A;  2K4D A;  4IR6 A;  3PUR A;  4AYC B;  1VYX A;  3MXF A;  4YBS A;  3E2D A;  3M99 A;  5D3R A;  5ENJ A;  4A9L A;  2E6R A;  4XY9 A;  5B8D A;  4TT4 A;  4OGJ A;  4O76 A;  2RS9 B;  4X3G A;  3G0L A;  2CKL B;  4IR4 A;  5F5Z A;  1WE9 A;  4NRB A;  3ZPV 1;  3FL2 A;  5FG6 A;  4GB0 A;  2FUI A;  3M63 A;  2VPB A;  4UIY A;  5EP7 A;  3M62 A;  5EQ1 A;  5FE1 A;  4QSS A;  5D3P A;  2ECN A;  5D0C A;  4LC2 A;  1V87 A;  3GG3 A;  4QB3 A;  3D1B A;  4QY4 A;  4QEV A;  5D3J A;  3FAO A;  2DVV A;  2LN0 A;  4OGE A;  1WEM A;  5CQA A;  5EU1 A;  2H60 A;  5DYU A;  2XP0 A;  2Y1M A;  5IGM A;  2MKE A;  3S91 A;  2CON A;  4Z1Q A;  4I7D A;  2QIC A;  5G0F A;  2KFT A;  2CSV A;  3FAN A;  3N9O A;  4ZDT A;  4HXS A;  2CRW A;  3FKM X;  5CP5 A;  2K1J A;  5E9Y A;  4E96 A;  2LGG A;  3DDT A;  5E0R A;  5FG5 A;  4B7Y C;  4F1P A;  5KTW A;  5LUU A;  2F6N A;  2MIQ A;  5CRM A;  3LQI A;  5A5S A;  2CKL A;  5F60 A;  5F62 A;  5KHM A;  5IGN A;  5KO4 A;  5I83 A;  4MEO A;  2KTB B;  4NUE A;  4MR4 A;  2EGM A;  1LDJ B;  4Z0R A;  2D8U A;  3ZYQ A;  5FE6 A;  5B79 A;  4QSW A;  3JVJ A;  3AQA A;  2MD8 C;  4TKP B;  5TDR A;  4XYA A;  2OWA A;  5AIU A;  4R7E A;  1ZS5 A;  5FH8 A;  4YBM A;  5C13 A;  1RMD A;  3ZNI A;  1JM7 A;  5FE3 A;  4C67 A;  3FJU B;  2H0D A;  4NYW A;  5I40 A;  3HTK C;  3LJU X;  3ZVY A;  4NRA A;  5C8G A;  3ONI A;  2LV9 A;  1E6I A;  4HXL A;  5SVI B;  3T7L A;  2KKY A;  4UIU A;  4PS5 A;  3U5O A;  5LVR A;  3FEH A;  5DYX A;  2QIZ A;  2M6M A;  4QUT A;  3P1D A;  5LKX A;  4QEU A;  5EWC A;  1U6G B;  4O71 A;  3HCU A;  4V3K C;  2KU3 A;  3AAD A;  2K16 A;  3U5L A;  4A9O A;  4TQN A;  5KH9 A;  4PKL A;  2E3K A;  3ZYU A;  5FEY A;  2L85 A;  5ENI A;  3LXJ A;  5JI8 A;  3H7H A;  5TDW A;  4YYJ A;  2OXQ C;  4MR6 A;  5D3T A;  3V43 A;  2DVR A;  3U5M A;  3HMH A;  4LZ2 A;  3NXB A;  2D9E A;  4MEP A;  2L43 A;  4TT2 A;  3UVD A;  5EWW A;  4NN2 A;  3N9P A;  4C66 A;  5D3S A;  5HQ6 A;  3VKG A;  5FH7 A;  2JM3 A;  1MBM A;  3L1X A;  2CT2 A;  3PHD A;  2D82 A;  5ACY A;  1FP0 A;  3LVR E;  5A81 A;  4NUD A;  2YEK A;  4HBY A;  4R2Y A;  4GNG A;  2HYE D;  4J3I A;  4Z6I A;  2GRC A;  2DVS A;  2G45 A;  4MVT A;  5FE9 A;  5CPE A;  4NR6 A;  4AI6 A;  3QZV A;  4YYK A;  5HEL A;  4AKN A;  5A5P A;  4CUP A;  1X0J A;  2RFJ A;  4NUC A;  4YH4 A;  5G4S A;  1G25 A;  5LKU A;  2G6Q A;  4NYX A;  5L8U A;  4LZS A;  2MD7 B;  2M85 A;  2NAA A;  2MNZ A;  3RCW A;  5DBM A;  3ERR A;  3P1E A;  4FLP A;  5A7C A;  1DCQ A;  2MA6 A;  5CQ3 A;  5LJ0 A;  4MR5 A;  1ZKR A;  3UV5 A;  3UW9 A;  4IR3 A;  5AMF A;  1FBV A;  1XWH A;  2EJN A;  2G43 A;  2KWN A;  2VJE B;  4UYE A;  5I89 A;  5CFW A;  4ZQL A;  2YW8 A;  4GND A;  1WUG A;  2PNX A;  3DAI A;  5EPB A;  5IBN A;  3LVQ E;  5FE0 A;  5E3G A;  5LJ1 A;  2VNF A;  2YEM A;  5II2 A;  4LYW A;  3MHH A;  2K17 A;  1WUM A;  1F68 A;  5DW2 A;  4YY6 A;  5SVX A;  4ZUX U;  3LQJ A;  2JRJ A;  4QC3 A;  5B76 A;  5EGU A;  1JOC A;  4N4I A;  5F63 A;  4HXM A;  2ECG A;  5F25 A;  4UP5 A;  4S3O B;  5D1M B;  3L11 A;  4FJC A;  4I7B A;  5LKZ A;  2DVQ A;  5BT5 A;  4YH3 A;  2YUR A;  1WEQ A;  5A5Q A;  5F1H A;  3D7C A; 
#chains in the Genus database with same CATH homology
 5HFR A;  5TRB A;  4YAT A;  3DPL R;  3SVF A;  3RPG B;  5FB1 A;  4WHW A;  4DON A;  5L98 A;  2C2V S;  4WIV A;  4BBQ A;  3IU5 A;  4UYH A;  1WFK A;  4A9E A;  4AVX A;  1MM3 A;  2VJE A;  4IOO A;  5ENH A;  3O34 A;  4N4H A;  3O36 A;  2ECJ A;  2RNW A;  4NR8 A;  4A0C D;  4MEN A;  4LJN A;  2RO1 A;  4YYM A;  4BW1 A;  5EVA A;  5LCW B;  4UYG A;  3U5P A;  2NXB A;  2WP2 A;  5FE5 A;  1WEE A;  4LYI A;  2M3H A;  2OUO A;  2LGK A;  2R0S A;  4UIW A;  3UVX A;  5BT4 A;  5A5N A;  3PUQ A;  4LDF A;  4QST A;  5ENC A;  4GNF A;  5G05 B;  4B86 C;  5F61 A;  2RNX A;  4O78 A;  5ETD A;  5DYC A;  5LJ2 A;  5B77 A;  4HXK A;  5I88 A;  4HXN A;  4N4F A;  5HM0 A;  5TAB A;  5KH3 A;  5HRV A;  2RSD A;  2Y1N A;  2KIZ A;  4NR7 A;  5H1V A;  1N87 A;  5FFV A;  3ZPV E;  5COI A;  4MEQ A;  3S92 A;  3LJW A;  4O7C A;  2KR4 A;  3NG2 A;  2MJV B;  4LYS A;  2YDW A;  3O7A A;  5L8T A;  1VFY A;  4Z1S A;  3SHB A;  4NRC A;  4PY6 A;  4O7B A;  2LGV A;  2KWO A;  2LQ6 A;  4ZW1 A;  4QYL A;  3GL6 A;  4QSR A;  4UYD A;  4TS8 A;  1N72 A;  4TT6 A;  3Q2F A;  5K29 A;  4FIP A;  2OO1 A;  2KWK A;  4BJX A;  5ENE A;  4AP4 A;  1K2F A;  5I1Q A;  4KCX A;  2L80 A;  4A4B A;  4LZR A;  3P5O A;  2F42 A;  5CUC A;  4YYI A;  5H1T A;  5CUD A;  5HFQ A;  4OGI A;  3K2J A;  5DX4 A;  5AD2 A;  4I7C A;  4BW3 A;  5LKT A;  2VJF A;  5D3N A;  5A82 A;  4PTB A;  4A9J A;  3L1Z B;  4OUF A;  5TB6 A;  4CUS A;  3P1F A;  1X4U A;  3O70 A;  4L7X A;  5DLX A;  3HCT A;  4NQN A;  4Q0O A;  4J0R A;  4QC1 A;  1WEV A;  5DW1 A;  5L99 A;  2ECV A;  5A83 A;  4J0S A;  3N9Q A;  2AN6 A;  5DFB A;  3ZTG A;  4C9Z A;  4WHU A;  5EIC A;  5KTX A;  2G4A A;  4KV1 A;  2YSM A;  1BOR A;  5FB0 A;  1JM7 B;  4UIX A;  4YYH A;  4O7E A;  2ECW A;  4UI9 B;  1F62 A;  3UV4 A;  3TLP A;  5CRZ A;  5CQ4 A;  3N9N A;  5KH7 A;  4IOQ A;  3I2D A;  2DAT A;  4LLB A;  4TYL A;  5E9I A;  5FFY A;  4QSQ A;  5EWH A;  2KGG A;  5LVQ A;  5H85 A;  4N4G A;  5EV9 A;  5I3L A;  2EA6 A;  5I29 A;  3N9L A;  4NR4 A;  2DWW A;  4CUU A;  2ECT A;  5FH6 A;  5FE8 A;  5J3X A;  4NS5 A;  2KYU A;  3IHP A;  4UYF A;  2KE1 A;  4QF3 A;  2KRE A;  5JWM A;  5C7N A;  2PUY A;  4HBV A;  5G4R A;  2XEU A;  4NR9 A;  3KV5 A;  3C6W A;  4N3W A;  2MA5 A;  5I80 A;  1MM2 A;  5DKD A;  2ZET C;  4BHW A;  4IC3 A;  5H9M A;  3SOU A;  5L97 A;  4R8P K;  5CUB A;  3LRQ A;  4Z6H A;  2JMJ A;  2E6S A;  3EB5 A;  4CFK A;  3HMF A;  4HBW A;  1JM4 B;  5D24 A;  5BT3 A;  2D8S A;  2L5E A;  4QZS A;  5HQ5 A;  4Y03 A;  3ZVZ B;  5EWV A;  5FE4 A;  4V3L C;  4UP0 A;  4GNE A;  3UV2 A;  4HBX A;  4QSX A;  5FER A;  2MNY A;  1WEO A;  2E7N A;  5CQ6 A;  5E3D A;  4KV4 A;  5EYA F;  4XUB A;  5D1K B;  5A5R A;  1ZBD B;  3HCS A;  5AIT A;  5CQ8 A;  4XUA A;  4TTE A;  3QZS A;  2MUM A;  3IU6 A;  1Z2Q A;  4YAB A;  3MB3 A;  4LR6 A;  4Q6F A;  4LAD B;  2KWJ A;  5E74 A;  5CS8 A;  5I7X A;  4LRG A;  5C89 A;  4P5O B;  5I7Y A;  3U5K A;  4WZ0 A;  5E73 A;  2LXP C;  5TBN A;  1Z6U A;  4QNS A;  4Q0N A;  4O72 A;  5D1L B;  3G0J A;  1X4J A;  5IG6 A;  3MUL A;  1T1H A;  3RPG C;  5TCM A;  5C4Q A;  3KNV A;  4LK9 A;  5CTL A;  4A9M A;  4XY8 A;  5E9L A;  4Z93 A;  4F3I A;  2YHN A;  3Q2E A;  2YQM A;  5EPS A;  4F52 B;  2N9G A;  5CQ5 A;  2XB1 A;  4NQM A;  4A49 A;  4AUQ B;  5IID A;  5AD3 A;  1Z60 A;  4HXR A;  3U5N A;  4RVR A;  4YY4 A;  2OSS A;  1EQF A;  2C2L A;  5DLZ A;  2VJF B;  5DKH A;  2CSY A;  1DVP A;  5FE2 A;  5H1U A;  4FK5 A;  2CSZ A;  2YSJ A;  2YUC A;  5KTU A;  4YAD A;  5E9V A;  4J1P A;  4UYF B;  4CLB A;  5L96 A;  5DFD A;  4CA1 A;  2JMI A;  5IGL A;  2Y43 A;  4NYV A;  5CY9 A;  2YW5 A;  5HQ7 A;  4TZ8 A;  4TU6 A;  4CCG X;  2FUU A;  4QBM A;  4WZ3 B;  1X4I A;  3KQI A;  4O7F A;  4A9F A;  4IOR A;  3MHS A;  3SVG A;  4YYN A;  5ENG A;  5IGK A;  2QJ0 A;  1LDK C;  4YYD A;  5C87 A;  1WEP A;  4MSX A;  5DYA A;  3SOX A;  2UZG A;  5CUG A;  4ALH A;  5CQT A;  4O7A A;  3N9M A;  4QEW A;  2M1R A;  3C5K A;  5A5O A;  4HXO A;  5F2P A;  1WEN A;  5B75 A;  5C11 A;  2FSA A;  4XI1 A;  5ENB A;  4A9H A;  2YT5 A;  4X2I A;  2VPE A;  2YYR A;  3MQM A;  5D25 A;  4UIV A;  4QF2 A;  1HYI A;  5HRX A;  3MB4 A;  5DY7 A;  2I50 A;  2LSP B;  3U5J A;  3P1C A;  5EIS A;  5ENF A;  2YHO A;  1IYM A;  2LRI C;  5J0D A;  3SOW A;  3QZT A;  3I3J A;  1JSP B;  1WEW A;  4YBT A;  2L5U A;  5JG6 A;  2YRE A;  4QR4 A;  4BW2 A;  5II1 A;  5FG4 A;  2L84 A;  3T6R A;  2DKW A;  4O77 A;  4IR5 A;  4A9I A;  2R0Y A;  5EK9 A;  4ALG A;  2YYN A;  4QR3 A;  4S3O C;  5CQ7 A;  4W4U A;  5ETB A;  5E9M A;  5CZG A;  4QSP A;  3O33 A;  2VP7 A;  5AME A;  4CUT A;  1WES A;  4WA6 A;  4ZC9 A;  4BW4 A;  2EGP A;  4O64 A;  2LDR A;  4NR5 A;  4YK0 A;  4PCI A;  5CU8 A;  5D3H A;  2IDA A;  2KGI A;  3DQV R;  5KU3 A;  2LXH C;  5CUA A;  4GPJ A;  2WP1 A;  4QSU A;  5HJC A;  5EA1 A;  4QSV A;  1WIL A;  5B78 A;  2YQL A;  2E7O A;  2R10 A;  4O70 A;  5D26 A;  3LQH A;  4YAX A;  5D3L A;  3JVM A;  5HLS A;  1CHC A;  2L75 A;  5F36 A;  2VPD A;  2ECI A;  4QR5 A;  3KV6 A;  3O37 A;  3UVY A;  4A4C A;  5DKA A;  4A9N A;  4QYD A;  5C85 A;  3JVL A;  5FDZ A;  2HDP A;  4LKA A;  2LGL A;  4PCE A;  5FE7 A;  2I8N A;  4CUQ A;  3VK6 A;  2DX8 A;  5F1L A;  5EPR A;  4TU4 A;  3MUK A;  4IC2 A;  3GV4 A;  3UVW A;  4FO9 A;  2YU4 A;  5E7D A;  4AYC A;  2I7K A;  3EB6 A;  1HYJ A;  4O74 A;  1WEU A;  3HME A;  5FFW A;  4UIT A;  5A85 A;  5DFC A;  2RNY A;  5EM3 A;  5G04 B;  2F6J A;  3RTR B;  4CFL A;  5EWD A;  5HEN A;  3JVK A;  4YYG A;  2JMD A;  1WGM A;  2RI7 A;  5EI4 A;  3SVH A;  4O75 A;  4UIZ A;  1WIM A;  3ASL A;  5HCL A;  4WZ2 A;  4CL9 A;  2R0V A;  5I86 A;  5F3A A;  3O35 A;  2BAY A;  2YQD A;  1E4U A;  5FBX A;  2MT5 A;  4NXJ A;  4CUR A;  4HXP A;  4TZ2 A;  5HRW A;  2VPG A;  2H0D B;  4PPE A;  4YC9 A;  4L58 A;  5HEM A;  2YEL A;  4A9K A;  5CGP A;  5CUE A;  5DIN A;  3DWY A;  5DKC A;  5E9K A;  2L0B A;  1VD4 A;  2EOD A;  4QUU A;  5D7X A;  4MR3 A;  2K4D A;  4IR6 A;  3PUR A;  4AYC B;  1VYX A;  3MXF A;  4YBS A;  3M99 A;  5D3R A;  5ENJ A;  4A9L A;  2E6R A;  4XY9 A;  5B8D A;  4TT4 A;  4OGJ A;  4O76 A;  2RS9 B;  4X3G A;  3G0L A;  2CKL B;  4IR4 A;  5F5Z A;  1WE9 A;  4NRB A;  3ZPV 1;  3FL2 A;  5FG6 A;  4GB0 A;  2FUI A;  3M63 A;  2VPB A;  4UIY A;  5EP7 A;  3M62 A;  5EQ1 A;  5FE1 A;  4QSS A;  5D3P A;  2ECN A;  5D0C A;  4LC2 A;  1V87 A;  3GG3 A;  4QB3 A;  4QY4 A;  4QEV A;  5D3J A;  2DVV A;  2LN0 A;  1WEM A;  5CQA A;  5EU1 A;  2H60 A;  5DYU A;  2Y1M A;  5IGM A;  3S91 A;  4Z1Q A;  4I7D A;  2QIC A;  5G0F A;  2KFT A;  3N9O A;  4ZDT A;  4HXS A;  2K1J A;  3FKM X;  5CP5 A;  2LGG A;  5E9Y A;  4E96 A;  4B7Y C;  5E0R A;  5FG5 A;  5KTW A;  5LUU A;  2F6N A;  2MIQ A;  5CRM A;  3LQI A;  5A5S A;  2CKL A;  5F60 A;  5F62 A;  5KHM A;  5IGN A;  5KO4 A;  5I83 A;  4MEO A;  2KTB B;  4NUE A;  4MR4 A;  1LDJ B;  3ZYQ A;  5FE6 A;  5B79 A;  4QSW A;  3JVJ A;  3AQA A;  2MD8 C;  4TKP B;  5TDR A;  4XYA A;  5AIU A;  4R7E A;  1ZS5 A;  5FH8 A;  4YBM A;  5C13 A;  1RMD A;  3ZNI A;  1JM7 A;  5FE3 A;  4C67 A;  2H0D A;  4NYW A;  5I40 A;  3HTK C;  3ZVY A;  4NRA A;  5C8G A;  3ONI A;  2LV9 A;  1E6I A;  4HXL A;  3T7L A;  4UIU A;  4PS5 A;  3U5O A;  5LVR A;  5DYX A;  2QIZ A;  2M6M A;  4QUT A;  3P1D A;  5LKX A;  4QEU A;  5EWC A;  1U6G B;  4O71 A;  3HCU A;  4V3K C;  2KU3 A;  3AAD A;  2K16 A;  3U5L A;  4A9O A;  4TQN A;  5KH9 A;  4PKL A;  2E3K A;  3ZYU A;  5FEY A;  2L85 A;  5ENI A;  3LXJ A;  5JI8 A;  5TDW A;  4YYJ A;  2OXQ C;  4MR6 A;  5D3T A;  3V43 A;  2DVR A;  3U5M A;  3HMH A;  4LZ2 A;  3NXB A;  2D9E A;  4MEP A;  2L43 A;  4TT2 A;  3UVD A;  5EWW A;  4NN2 A;  3N9P A;  4C66 A;  5D3S A;  5HQ6 A;  5FH7 A;  3L1X A;  2CT2 A;  3PHD A;  2D82 A;  5ACY A;  1FP0 A;  5A81 A;  4NUD A;  2YEK A;  4HBY A;  4R2Y A;  4GNG A;  2HYE D;  4J3I A;  4Z6I A;  2GRC A;  2DVS A;  2G45 A;  4MVT A;  5FE9 A;  5CPE A;  4NR6 A;  3QZV A;  4YYK A;  5HEL A;  4AKN A;  5A5P A;  4CUP A;  1X0J A;  2RFJ A;  4NUC A;  4YH4 A;  5G4S A;  1G25 A;  5LKU A;  2G6Q A;  4NYX A;  5L8U A;  4LZS A;  2MD7 B;  2M85 A;  2NAA A;  2MNZ A;  3RCW A;  5DBM A;  4FLP A;  3P1E A;  5A7C A;  2MA6 A;  5CQ3 A;  5LJ0 A;  4MR5 A;  3UV5 A;  3UW9 A;  4IR3 A;  5AMF A;  1FBV A;  1XWH A;  2KWN A;  2G43 A;  2VJE B;  4UYE A;  5I89 A;  5CFW A;  4ZQL A;  2YW8 A;  4GND A;  1WUG A;  2PNX A;  3DAI A;  5EPB A;  5IBN A;  5FE0 A;  5E3G A;  5LJ1 A;  2VNF A;  2YEM A;  5II2 A;  4LYW A;  3MHH A;  2K17 A;  1WUM A;  1F68 A;  5DW2 A;  4YY6 A;  4ZUX U;  3LQJ A;  2JRJ A;  4QC3 A;  5B76 A;  5EGU A;  1JOC A;  4N4I A;  5F63 A;  4HXM A;  2ECG A;  5F25 A;  4UP5 A;  4S3O B;  5D1M B;  3L11 A;  4FJC A;  4I7B A;  5LKZ A;  2DVQ A;  5BT5 A;  4YH3 A;  2YUR A;  1WEQ A;  5A5Q A;  5F1H A;  3D7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...