5H1TA

Complex structure of trim24 phd-bromodomain and inhibitor 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
172
Chain Sequence
b'NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 50
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1tA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1tA01
4QB3A 5H85A 4WZ0A 1BORA 3UV4A 5CUBA 3HTKC 2E3KA 5FE2A 3MB4A 4Q0NA 5C87A 5COIA 5D0CA 4F52B 5LUUA 4UIYA 4O74A 4QSRA 5H9MA 4UP0A 4TYLA 5F5ZA 4TKPB 5DY7A 1F62A 3QZTA 4CA1A 4ZQLA 2G4AA 5DYXA 2E7NA 5FE9A 2C2LA 2LXHC 4A9OA 5CFWA 1MM2A 4UYFA 4HXSA 3U5PA 2K1JA 4J1PA 5HELA 2YEMA 4AYCA 5I40A 5C11A 3RTRB 4MEOA 2ECNA 2VJFB 2DWWA 4YADA 5TABA 4TU4A 4A9IA 4TU6A 5L98A 2G6QA 4R2YA 5F2PA 2YDWA 3VK6A 5EICA 2L5UA 3KV5A 4PY6A 3GV4A 2KIZA 4TS8A 5A5OA 4NQNA 4QR4A 5FFWA 5KTXA 5E9IA 2C2VS 2VPDA 4LRGA 5FH8A 3Q2FA 5D7XA 4WIVA 3SVGA 4UIUA 3I2DA 5EA1A 5FE7A 1XWHA 3P1EA 5TRBA 4A9NA 5DW1A 2KGIA 2L0BA 5EM3A 5D24A 2F42A 5G0FA 5B77A 4QYLA 4XYAA 2E6SA 2ECIA 2LGVA 4UI9B 4HBXA 5TBNA 1FBVA 1JM7A 3LXJA 5L99A 2I8NA 4A9FA 4YYMA 4GNDA 3DAIA 4L58A 5F62A 2YUCA 4NYWA 5EISA 4AKNA 4KCXA 4J0RA 4NRAA 5ENHA 2YYNA 2D82A 5KH3A 3V43A 5BT4A 5CUEA 5D3SA 4S3OB 4TTEA 5D3PA 4KV1A 1WGMA 3N9QA 1WEPA 4A4CA 4OGIA 5CQ3A 5A83A 1G25A 5B79A 1N72A 4GPJA 5DBMA 5CUDA 4A9MA 3C6WA 4Z6IA 5II1A 2OSSA 5FEYA 4LYIA 5DKHA 4V3LC 5EI4A 4YAXA 5F36A 3P1FA 4BW2A 5KU3A 4HXNA 4NR4A 2YHOA 3SHBA 5JWMA 3NG2A 5D1MB 3T7LA 1U6GB 4GNEA 1JSPB 4YATA 4N3WA 5L8TA 1VD4A 4KV4A 5A82A 5I83A 4C66A 4A9JA 2R0SA 5D3TA 5IGMA 5JI8A 4UYHA 3U5LA 4LYSA 5A5PA 5HLSA 5DFCA 1X0JA 5HQ5A 2ECVA 5LVQA 2DATA 4QC3A 2G45A 3ZPVE 3QZSA 4DONA 5LJ1A 2K4DA 4C9ZA 1ZS5A 2MNYA 5A5RA 5LKUA 5FFVA 4QSSA 4J3IA 4O7FA 2WP2A 5C13A 3S91A 5IBNA 3RCWA 4NXJA 3ONIA 5CQ8A 2KFTA 5G4RA 1LDKC 5D3RA 4YYHA 3LQHA 4O72A 5D1KB 4XUAA 4UITA 4I7BA 4YYNA 5TCMA 4NQMA 5B78A 2K16A 5E3DA 4ALGA 4QR3A 2OUOA 3JVJA 3SOXA 5CQ7A 4A9LA 4HXPA 4GNGA 4UYFB 2K17A 1WESA 3P1CA 5L97A 5I88A 4LC2A 4AYCB 4UIXA 5E9VA 5BT3A 3LRQA 3C5KA 4IR3A 1DVPA 5EP7A 4N4HA 5CZGA 5ENJA 3N9PA 2YSJA 5C8GA 4BW3A 5CQTA 5DFDA 4WHUA 4PTBA 2HYED 5A7CA 5HFQA 4QSQA 5ENCA 3HCSA 5FE0A 5CQ4A 3DWYA 4UIWA 2EGPA 2LXPC 1F68A 2VP7A 4YC9A 2MA6A 2QJ0A 4WA6A 4ZUXU 4UIZA 5D3NA 2YURA 2FUIA 5G04B 5ENGA 3U5OA 4YK0A 3ZYUA 2LGLA 3ZTGA 2LSPB 3HMHA 2YW8A 4A49A 5CQ6A 5AD2A 3MB3A 2LGKA 4QY4A 2BAYA 4PCIA 4LZRA 2VPBA 4YY4A 5K29A 3O33A 2N9GA 3IU6A 2E6RA 2EODA 4NRBA 2RI7A 5FB1A 4BJXA 4QSTA 5J0DA 4XY9A 3U5KA 4MVTA 5FG6A 2YYRA 2RS9B 2KWJA 2PUYA 1EQFA 4O76A 4CFLA 2MD8C 5ENBA 2PNXA 3EB5A 5IGKA 3ZYQA 4YYKA 4HXRA 3O70A 5CPEA 2RNYA 3UVWA 5I29A 5FE8A 5I7XA 5J3XA 2KU3A 3M99A 4L7XA 3O36A 3D7CA 4LKAA 5EWDA 5FERA 5F1HA 5D1LB 1FP0A 4IR6A 4IR4A 3L1XA 4YABA 4QEUA 5DFBA 1K2FA 4O75A 2L84A 2Y1MA 2NXBA 5I80A 3HCTA 3M62A 5IG6A 2R10A 5KHMA 4A0CD 5DINA 2YSMA 4I7CA 3GL6A 5FE5A 4O64A 3U5NA 5B76A 3UVXA 4C67A 4WZ2A 4W4UA 5HCLA 5EWCA 5CRMA 4QF3A 4S3OC 5DKAA 4P5OB 5H1TA 5EGUA 4NN2A 4UIVA 4AUQB 4O77A 1X4UA 4YYIA 3JVMA 5DYUA 1Z2QA 1E4UA 4MR4A 3U5MA 4YYDA 3SVFA 1T1HA 4PS5A 4GB0A 4I7DA 5EYAF 4AP4A 5FE1A 2CKLA 2L85A 2G43A 5CTLA 1HYJA 4QR5A 4ZW1A 4A4BA 3I3JA 4NUDA 2FUUA 4X3GA 4R8PK 5E7DA 5EPRA 4QSPA 3N9MA 4HXLA 5FG5A 5HM0A 5G05B 2ECGA 3KNVA 3Q2EA 5LKTA 4J0SA 2LDRA 5F61A 4QYDA 4XI1A 5DKDA 3N9LA 4YY6A 5KH7A 4TT6A 2H0DA 3ZVYA 2RNXA 4MR5A 3TLPA 2I7KA 2Y1NA 4FIPA 5AIUA 4TT2A 5DYCA 4F3IA 4OUFA 2YW5A 1RMDA 5E73A 3O37A 2HDPA 3L1ZB 4TZ8A 5CUAA 2MJVB 4MR3A 5AMFA 4MEPA 2KREA 2L75A 4ZDTA 5DW2A 2UZGA 2WP1A 4Z93A 5A5SA 1HYIA 5EVAA 3MHSA 4LYWA 4O70A 5FFYA 5DLZA 2MIQA 4CUTA 5ACYA 5A85A 2VJEA 4QSVA 4QNSA 1WILA 3G0LA 5B8DA 4Z1SA 4UYDA 5KTUA 4NR7A 3RPGC 5KTWA 5LJ0A 2M3HA 1MM3A 3HMEA 4PCEA 4YBMA 2MA5A 5H1VA 5HENA 2JMIA 4QF2A 5FDZA 4ZC9A 2YQMA 3L11A 2MD7B 5CUGA 2KTBB 2JRJA 5JG6A 4MSXA 2XEUA 4PPEA 1WEEA 4CLBA 5E9LA 4LZ2A 4TZ2A 3MQMA 4XUBA 5ENFA 4IC3A 5ENEA 4HBYA 5AMEA 4CUPA 5CS8A 4ALHA 3SOUA 2LV9A 5E0RA 3SVHA 3M63A 3O7AA 2CT2A 2F6NA 5II2A 3HCUA 5CU8A 4Z1QA 3O35A 5F1LA 3LQJA 3MULA 4QEWA 3DPLR 3MHHA 5LJ2A 4YH3A 5TDRA 4UYGA 2KWNA 1N87A 2E7OA 4O71A 5CGPA 5I1QA 3AQAA 4QC1A 5L8UA 2M1RA 3U5JA 2M85A 2KGGA 4MEQA 2YREA 3S92A 5DLXA 5G4SA 5CY9A 2AN6A 4HXMA 5C4QA 4QUTA 2QICA 5I7YA 5A81A 1WUMA 4YYGA 4Q6FA 3G0JA 3ZPV1 3FKMX 3UVYA 1JM7B 4N4FA 5D3LA 3GG3A 5E9MA 5I89A 5HQ6A 1WENA 2KWOA 5FE6A 2DKWA 1WEOA 4B7YC 5EWHA 5C85A 1CHCA 5FB0A 3O34A 4RVRA 5AITA 5D3JA 2YHNA 2RO1A 4X2IA 5LKZA 4LR6A 4LADB 5EK9A 2YQDA 4QSXA 1LDJB 2FSAA 4B86C 3N9NA 4LDFA 5I3LA 5FG4A 2KR4A 2MNZA 2VPEA 2CKLB 2YQLA 4NYXA 3P1DA 3ZNIA 2EA6A 4O7CA 4LZSA 5C7NA 4CL9A 3MXFA 4TQNA 5A5QA 4LJNA 4NUEA 2LQ6A 2KYUA 4LK9A 1WEVA 5LKXA 2ZETC 4FJCA 3T6RA 4BW4A 2GRCA 3QZVA 3P5OA 4IORA 5IGNA 2H0DB 2MT5A 2OXQC 4Q0OA 3PURA 3JVLA 3FL2A 4PKLA 4QUUA 4CCGX 4BHWA 5CP5A 2RFJA 2YELA 4NR5A 5F63A 4QBMA 4A9EA 5I86A 1JOCA 4CURA 5ETDA 2VNFA 2R0YA 4MENA 4NR6A 3PUQA 5KH9A 5E3GA 1X4JA 5LVRA 3MUKA 5HRXA 4NR9A 3SOWA 2DVSA 1WEMA 4V3KC 4BW1A 4IOOA 2YU4A 3ASLA 3EB6A 4CUUA 1Z60A 2VJEB 5HFRA 5EQ1A 2LRIC 3IHPA 4OGJA 1WIMA 2D8SA 5KO4A 3ZVZB 3UW9A 5FH7A 2L80A 5DKCA 5DX4A 5TDWA 5HEMA 5CQAA 4CFKA 5ETBA 1VYXA 1WE9A 2VJFA 5LCWB 4BBQA 4QZSA 2I50A 5F25A 5CQ5A 5D26A 4FLPA 5D25A 4NRCA 2H60A 4FO9A 2R0VA 4HBVA 2XB1A 5TB6A 3KV6A 2L43A 4A9HA 5EWVA 1X4IA 2CSZA 1WFKA 3HMFA 5IIDA 4WZ3B 5HJCA 1V87A 5BT5A 3AADA 2L5EA 5EPBA 1WEWA 1ZBDB 2ECWA 4YYJA 5FH6A 4NYVA 2DVVA 5E9KA 3LJWA 3NXBA 5CRZA 5ENIA 4GNFA 2LN0A 2CSYA 2JMDA 2NAAA 5FE4A 1WUGA 2LGGA 4WHWA 2D9EA 3UV5A 4QSUA 2KWKA 4UP5A 2DVQA 2DX8A 4IR5A 1JM4B 1WEQA 4NUCA 5C89A 4NS5A 4LLBA 1WEUA 5F60A 4HXKA 1VFYA 4YBSA 3N9OA 4MR6A 5EU1A 2VPGA 4NR8A 2JMJA 4YBTA 5EWWA 1E6IA 2RNWA 5DYAA 4AVXA 5EV9A 3RPGB 5D3HA 5FE3A 2DVRA 4IC2A 4A9KA 4CUQA 4QSWA 2YT5A 5EPSA 3LQIA 5E9YA 5HRWA 2YEKA 5IGLA 4CUSA 2ECTA 4Y03A 5F3AA 1IYMA 3KQIA 1Z6UA 3IU5A 4N4IA 5CUCA 2M6MA 4R7EA 5HQ7A 4O7BA 4O78A 3UVDA 4N4GA 2IDAA 5E74A 2ECJA 4HXOA 5B75A 5A5NA 3DQVR 5FBXA 4QEVA 4IOQA 4Z6HA 4O7AA 5AD3A 2Y43A 3JVKA 4XY8A 4TT4A 4FK5A 5H1UA 2F6JA 3PHDA 5HRVA 4E96A 4O7EA 2KE1A 2OO1A 5L96A 4YH4A 3K2JA 3UV2A 4HBWA 2QIZA 2MUMA 2RSDA 4UYEA
chains in the Genus database with same CATH superfamily
4QB3A 5H85A 4AI6A 1BORA 3UV4A 4WZ0A 5CUBA 3VKGA 3HTKC 2E3KA 5FE2A 3MB4A 4Q0NA 5C87A 5COIA 5D0CA 4F52B 5LUUA 4UIYA 4O74A 4QSRA 5H9MA 4UP0A 4TYLA 5F5ZA 4TKPB 5DY7A 1F62A 3QZTA 4CA1A 4ZQLA 2G4AA 5DYXA 2E7NA 2DSMA 5FE9A 2C2LA 2LXHC 4A9OA 5CFWA 1MM2A 4UYFA 4HXSA 3U5PA 2K1JA 4J1PA 5HELA 4OGCA 2YEMA 4AYCA 5I40A 5C11A 2EJNA 3RTRB 4MEOA 2ECNA 2VJFB 2DWWA 4YADA 5TABA 4TU4A 4A9IA 4TU6A 5L98A 2G6QA 4R2YA 5F2PA 2YDWA 3VK6A 5EICA 2L5UA 3KV5A 4PY6A 3GV4A 2KIZA 4TS8A 5A5OA 4NQNA 4QR4A 5FFWA 5KTXA 5E9IA 2C2VS 2VPDA 4LRGA 5FH8A 3Q2FA 5D7XA 4WIVA 3SVGA 4UIUA 3I2DA 5EA1A 5FE7A 1XWHA 3P1EA 5TRBA 4A9NA 5DW1A 2KGIA 2L0BA 3LVQE 5EM3A 5D24A 2F42A 5G0FA 5B77A 4QYLA 4XYAA 2E6SA 2ECIA 2LGVA 4UI9B 5DKAA 4HBXA 5TBNA 1FBVA 1JM7A 3LXJA 5L99A 2I8NA 4A9FA 4YYMA 4GNDA 3DAIA 3FEHA 4L58A 5F62A 2YUCA 4NYWA 5EISA 4AKNA 4KCXA 4J0RA 4NRAA 5ENHA 2YYNA 2D82A 4AKIA 3V43A 5KH3A 2CONA 5BT4A 5CUEA 5D3SA 4S3OB 4TTEA 5D3PA 4KV1A 1WGMA 3N9QA 4H9DA 1WEPA 2MKEA 4A4CA 4OGIA 5CQ3A 5A83A 1G25A 5B79A 1N72A 4GPJA 5DBMA 5CUDA 4A9MA 3C6WA 4Z6IA 5II1A 4QQ4A 2OSSA 5FEYA 4LYIA 5DKHA 4V3LC 5EI4A 3E2DA 4YAXA 5F36A 3P1FA 2YVRA 4BW2A 5KU3A 4HXNA 4NR4A 2YHOA 3SHBA 5JWMA 3NG2A 3ERRA 5D1MB 3T7LA 1U6GB 4GNEA 1JSPB 4YATA 4N3WA 5L8TA 1VD4A 4KV4A 5A82A 5I83A 4C66A 4A9JA 5D3TA 2R0SA 5IGMA 5JI8A 4UYHA 3U5LA 4LYSA 5A5PA 5HLSA 5DFCA 1X0JA 5HQ5A 2ECVA 5LVQA 2DATA 4QC3A 2G45A 2KKYA 3QZSA 3ZPVE 4DONA 5LJ1A 2K4DA 4C9ZA 1ZS5A 2MNYA 5A5RA 5LKUA 5FFVA 4QSSA 4J3IA 4O7FA 2WP2A 5C13A 3S91A 5IBNA 3RCWA 4NXJA 3ONIA 5CQ8A 2KFTA 5G4RA 1LDKC 5D3RA 4YYHA 3LQHA 4O72A 2JUNA 3PLWA 5D1KB 4XUAA 4UITA 4I7BA 4YYNA 5TCMA 4NQMA 5B78A 2K16A 5E3DA 4ALGA 4QR3A 2OUOA 3JVJA 3DWDA 3SOXA 5CQ7A 4A9LA 4HXPA 4GNGA 4UYFB 2K17A 1WESA 3P1CA 5L97A 2EGMA 5I88A 4LC2A 4AYCB 4UIXA 5E9VA 5BT3A 3LRQA 3C5KA 4IR3A 1DVPA 2XOYA 5EP7A 4N4HA 5CZGA 5ENJA 3N9PA 2YSJA 5C8GA 4BW3A 5CQTA 5DFDA 4WHUA 4PTBA 2HYED 3LDYA 5A7CA 5HFQA 4QSQA 5ENCA 3HCSA 5FE0A 5CQ4A 3DWYA 4UIWA 2EXUA 2EGPA 2LXPC 1F68A 2VP7A 4YC9A 2JM3A 2MA6A 2QJ0A 4WA6A 4ZUXU 4UIZA 5D3NA 2YURA 2FUIA 5G04B 5ENGA 3U5OA 4YK0A 3ZYUA 2LGLA 3ZTGA 2LSPB 4F1PA 3HMHA 2YW8A 4A49A 5CQ6A 5AD2A 3MB3A 2LGKA 4QY4A 2BAYA 4PCIA 4LZRA 2VPBA 4YY4A 5K29A 3O33A 3M7KA 2N9GA 3IU6A 2E6RA 2EODA 4NRBA 2RI7A 5FB1A 4BJXA 4QSTA 5J0DA 4XY9A 3U5KA 4MVTA 5FG6A 2YYRA 2RS9B 2KWJA 2PUYA 2CSVA 1EQFA 4O76A 4CFLA 2MD8C 5ENBA 2PNXA 3EB5A 5IGKA 3Q1DA 3ZYQA 4YYKA 4HXRA 3O70A 5CPEA 2RNYA 3UVWA 5I29A 2RR4A 5FE8A 5I7XA 5J3XA 2KU3A 3M99A 4L7XA 3O36A 3D7CA 4LKAA 5EWDA 5FERA 5F1HA 5SVYA 5D1LB 1FP0A 4IR6A 4IR4A 3L1XA 4YABA 4QEUA 5DFBA 1K2FA 4O75A 2L84A 2Y1MA 2NXBA 5I80A 3LJUX 3HCTA 3M62A 5IG6A 2R10A 5SVIA 5KHMA 4A0CD 5DINA 2YSMA 4I7CA 3GL6A 5FE5A 4O64A 3U5NA 5B76A 3UVXA 4C67A 4WZ2A 4W4UA 5HCLA 5EWCA 5CRMA 3JUEA 4QF3A 4S3OC 4P5OB 5H1TA 5EGUA 4NN2A 4UIVA 4AUQB 4O77A 1X4UA 4YYIA 3JVMA 5DYUA 1Z2QA 1E4UA 4MR4A 3U5MA 4YYDA 3SVFA 1T1HA 4PS5A 4GB0A 4I7DA 5EYAF 4AP4A 5FE1A 2CKLA 2L85A 2G43A 5CTLA 1HYJA 4QR5A 4ZW1A 2P57A 4A4BA 3I3JA 4NUDA 2FUUA 4X3GA 4R8PK 5E7DA 5EPRA 3VKHA 4QSPA 3N9MA 4HXLA 5FG5A 5HM0A 5G05B 2ECGA 3KNVA 3Q2EA 5LKTA 4J0SA 2LDRA 5F61A 4QYDA 4XI1A 5DKDA 3N9LA 4YY6A 5KH7A 4TT6A 2H0DA 3ZVYA 2RNXA 4MR5A 3TLPA 2I7KA 2Y1NA 4FIPA 5AIUA 4TT2A 5DYCA 4F3IA 4OUFA 2YW5A 1RMDA 5E73A 3O37A 2HDPA 3L1ZB 4TZ8A 5CUAA 2MJVB 4MR3A 5AMFA 4MEPA 2KREA 2L75A 3DDTA 5DW2A 2UZGA 4O62A 4ZDTA 2WP1A 4Z93A 5A5SA 1HYIA 5EVAA 3MHSA 4LYWA 4O70A 5FFYA 5DLZA 2MIQA 4CUTA 3MDBC 5ACYA 5A85A 2VJEA 4QSVA 4QNSA 1WILA 3G0LA 2KKXA 4Z1SA 5B8DA 4UYDA 5KTUA 4NR7A 3RPGC 5KTWA 5LJ0A 2M3HA 1MM3A 3HMEA 4PCEA 4YBMA 2MA5A 5H1VA 5HENA 2JMIA 4QF2A 5FDZA 4ZC9A 2YQMA 3L11A 2MD7B 5CUGA 2KTBB 2JRJA 5JG6A 4MSXA 2XEUA 4PPEA 1WEEA 4CLBA 5E9LA 2XOCA 4LZ2A 4TZ2A 3MQMA 4XUBA 5ENFA 4IC3A 5ENEA 4HBYA 5AMEA 1PUOA 4CUPA 5CS8A 4ALHA 3SOUA 2LV9A 5E0RA 3SVHA 3M63A 3O7AA 2CT2A 2F6NA 5II2A 3FAOA 5CU8A 4Z1QA 3HCUA 3O35A 5F1LA 3LQJA 3MULA 4QEWA 3DPLR 3MHHA 5LJ2A 4YH3A 5TDRA 4UYGA 2KWNA 1N87A 2E7OA 4O71A 5CGPA 5I1QA 3AQAA 4QC1A 5L8UA 2M1RA 3U5JA 2M85A 2KGGA 4MEQA 2YREA 3S92A 5DLXA 5G4SA 5CY9A 2AN6A 1MBMA 4HXMA 5C4QA 4QUTA 2QICA 5I7YA 5A81A 1WUMA 4YYGA 4Q6FA 3G0JA 3ZPV1 3FKMX 3UVYA 1JM7B 4N4FA 5D3LA 3GG3A 5E9MA 5I89A 5HQ6A 1WENA 3FM8C 2KWOA 5FE6A 3LVRE 5SVXA 2DKWA 1WEOA 4B7YC 5EWHA 2CRRA 5C85A 1CHCA 5FB0A 3O34A 4RVRA 5AITA 5D3JA 2YHNA 2RO1A 4X2IA 3O47A 5LKZA 4LR6A 4LADB 5EK9A 2YQDA 4QSXA 1LDJB 2FSAA 4B86C 3N9NA 4LDFA 5I3LA 5FG4A 2KR4A 2MNZA 2VPEA 2CKLB 2YQLA 4NYXA 3P1DA 3ZNIA 2EA6A 4O7CA 3FJUB 4LZSA 5C7NA 4CL9A 3MXFA 4TQNA 5A5QA 4LJNA 4NUEA 2LQ6A 2FFWA 2KYUA 4LK9A 1WEVA 5LKXA 2ZETC 4FJCA 3T6RA 3KDEC 4BW4A 2GRCA 3QZVA 3P5OA 4AKGA 4IORA 3D1DA 5IGNA 2E61A 2H0DB 4Q0OA 2MT5A 2OXQC 3PURA 3JVLA 3FL2A 4PKLA 4QUUA 5K3QA 4CCGX 2XOZA 4BHWA 5CP5A 2RFJA 2YELA 2M13A 4NR5A 5F63A 4QBMA 4A9EA 5I86A 1JOCA 3FANA 4CURA 5ETDA 2VNFA 2R0YA 4MENA 4NR6A 3PUQA 5KH9A 5E3GA 1X4JA 5LVRA 3MUKA 5HRXA 4NR9A 3SOWA 2DVSA 1WEMA 4V3KC 4BW1A 4IOOA 2YU4A 3ASLA 3EB6A 4CUUA 1Z60A 2VJEB 5HFRA 5EQ1A 2LRIC 3IHPA 2LAUA 4AKHA 4OGJA 1WIMA 2D8SA 5KO4A 2L7PA 3ZVZB 3UW9A 5FH7A 2L80A 5DKCA 5DX4A 5TDWA 5HEMA 5CQAA 4CFKA 5ETBA 1VYXA 1WE9A 2VJFA 5LCWB 4BBQA 4QZSA 2I50A 5F25A 5CQ5A 5D26A 4FLPA 5D25A 4NRCA 2H60A 4FO9A 2CRWA 2R0VA 4HBVA 3D1BA 2XB1A 5TB6A 3KV6A 3SUBA 2L43A 4A9HA 5EWVA 1X4IA 2CSZA 1WFKA 3HMFA 5IIDA 4WZ3B 5HJCA 1V87A 5BT5A 3AADA 2L5EA 5EPBA 1WEWA 1ZBDB 2ECWA 4Z0RA 4YYJA 5FH6A 4NYVA 2DVVA 5E9KA 2DJAA 3LJWA 3NXBA 5CRZA 5ENIA 4GNFA 2LN0A 2CSYA 2JMDA 2NAAA 5FE4A 1WUGA 2LGGA 4WHWA 2D9EA 2B0OE 3UV5A 4QSUA 2KWKA 4UP5A 2DVQA 2DX8A 4IR5A 1JM4B 1WEQA 4NUCA 5C89A 2IQJA 4NS5A 4LLBA 1WEUA 4Z0OA 5F60A 2OWAA 4HXKA 1VFYA 4YBSA 3N9OA 3H7HA 4MR6A 5EU1A 2D8UA 2VPGA 4NR8A 2JMJA 4YBTA 5EWWA 1E6IA 2RNWA 5DYAA 4AVXA 5EV9A 3RPGB 5D3HA 5FE3A 2DVRA 4IC2A 4A9KA 4CUQA 4QSWA 2YT5A 5EPSA 3LQIA 5E9YA 5HRWA 2YEKA 5IGLA 4CUSA 2ECTA 4Y03A 5F3AA 1IYMA 3KQIA 1Z6UA 3IU5A 4N4IA 5CUCA 2M6MA 4R7EA 5HQ7A 1DCQA 1ZKRA 4O7BA 4O78A 3UVDA 4N4GA 2IDAA 5E74A 2ECJA 2XP0A 4HXOA 5B75A 5A5NA 3DQVR 5FBXA 4QEVA 4IOQA 4Z6HA 4O7AA 5AD3A 2FD4A 2Y43A 3JVKA 4XY8A 4TT4A 4FK5A 5H1UA 2F6JA 4OGEA 3PHDA 5HRVA 3T9KA 4E96A 4O7EA 2KE1A 5SVIB 2OO1A 5L96A 4YH4A 3K2JA 3UV2A 4HBWA 2QIZA 2MUMA 2RSDA 4UYEA
chains in the Genus database with same CATH topology
4QB3A 5H85A 4WZ0A 1BORA 3UV4A 5CUBA 3HTKC 2E3KA 5FE2A 3MB4A 4Q0NA 5C87A 5COIA 5D0CA 4F52B 5LUUA 4UIYA 4O74A 4QSRA 5H9MA 4UP0A 4TYLA 5F5ZA 4TKPB 5DY7A 1F62A 3QZTA 4CA1A 4ZQLA 2G4AA 5DYXA 2E7NA 5FE9A 2C2LA 2LXHC 4A9OA 5CFWA 1MM2A 4UYFA 4HXSA 3U5PA 2K1JA 4J1PA 5HELA 2YEMA 4AYCA 5I40A 5C11A 3RTRB 4MEOA 2ECNA 2VJFB 2DWWA 4YADA 5TABA 4TU4A 4A9IA 4TU6A 5L98A 2G6QA 4R2YA 5F2PA 2YDWA 3VK6A 5EICA 2L5UA 3KV5A 4PY6A 3GV4A 2KIZA 4TS8A 5A5OA 4NQNA 4QR4A 5FFWA 5KTXA 5E9IA 2C2VS 2VPDA 4LRGA 5FH8A 3Q2FA 5D7XA 4WIVA 3SVGA 4UIUA 3I2DA 5EA1A 5FE7A 1XWHA 3P1EA 5TRBA 4A9NA 5DW1A 2KGIA 2L0BA 5EM3A 5D24A 2F42A 5G0FA 5B77A 4QYLA 4XYAA 2E6SA 2ECIA 2LGVA 4UI9B 4HBXA 5TBNA 1FBVA 1JM7A 3LXJA 5L99A 2I8NA 4A9FA 4YYMA 4GNDA 3DAIA 4L58A 5F62A 2YUCA 4NYWA 5EISA 4AKNA 4KCXA 4J0RA 4NRAA 5ENHA 2YYNA 2D82A 5KH3A 3V43A 5BT4A 5CUEA 5D3SA 4S3OB 4TTEA 5D3PA 4KV1A 1WGMA 3N9QA 1WEPA 4A4CA 4OGIA 5CQ3A 5A83A 1G25A 5B79A 1N72A 4GPJA 5DBMA 5CUDA 4A9MA 3C6WA 4Z6IA 5II1A 2OSSA 5FEYA 4LYIA 5DKHA 4V3LC 5EI4A 4YAXA 5F36A 3P1FA 4BW2A 5KU3A 4HXNA 4NR4A 2YHOA 3SHBA 5JWMA 3NG2A 5D1MB 3T7LA 1U6GB 4GNEA 1JSPB 4YATA 4N3WA 5L8TA 1VD4A 4KV4A 5A82A 5I83A 4C66A 4A9JA 2R0SA 5D3TA 5IGMA 5JI8A 4UYHA 3U5LA 4LYSA 5A5PA 5HLSA 5DFCA 1X0JA 5HQ5A 2ECVA 5LVQA 2DATA 4QC3A 2G45A 3ZPVE 3QZSA 4DONA 5LJ1A 2K4DA 4C9ZA 1ZS5A 2MNYA 5A5RA 5LKUA 5FFVA 4QSSA 4J3IA 4O7FA 2WP2A 5C13A 3S91A 5IBNA 3RCWA 4NXJA 3ONIA 5CQ8A 2KFTA 5G4RA 1LDKC 5D3RA 4YYHA 3LQHA 4O72A 5D1KB 4XUAA 4UITA 4I7BA 4YYNA 5TCMA 4NQMA 5B78A 2K16A 5E3DA 4ALGA 4QR3A 2OUOA 3JVJA 3SOXA 5CQ7A 4A9LA 4HXPA 4GNGA 4UYFB 2K17A 1WESA 3P1CA 5L97A 5I88A 4LC2A 4AYCB 4UIXA 5E9VA 5BT3A 3LRQA 3C5KA 4IR3A 1DVPA 5EP7A 4N4HA 5CZGA 5ENJA 3N9PA 2YSJA 5C8GA 4BW3A 5CQTA 5DFDA 4WHUA 4PTBA 2HYED 5A7CA 5HFQA 4QSQA 5ENCA 3HCSA 5FE0A 5CQ4A 3DWYA 4UIWA 2EGPA 2LXPC 1F68A 2VP7A 4YC9A 2MA6A 2QJ0A 4WA6A 4ZUXU 4UIZA 5D3NA 2YURA 2FUIA 5G04B 5ENGA 3U5OA 4YK0A 3ZYUA 2LGLA 3ZTGA 2LSPB 3HMHA 2YW8A 4A49A 5CQ6A 5AD2A 3MB3A 2LGKA 4QY4A 2BAYA 4PCIA 4LZRA 2VPBA 4YY4A 5K29A 3O33A 2N9GA 3IU6A 2E6RA 2EODA 4NRBA 2RI7A 5FB1A 4BJXA 4QSTA 5J0DA 4XY9A 3U5KA 4MVTA 5FG6A 2YYRA 2RS9B 2KWJA 2PUYA 1EQFA 4O76A 4CFLA 2MD8C 5ENBA 2PNXA 3EB5A 5IGKA 3ZYQA 4YYKA 4HXRA 3O70A 5CPEA 2RNYA 3UVWA 5I29A 5FE8A 5I7XA 5J3XA 2KU3A 3M99A 4L7XA 3O36A 3D7CA 4LKAA 5EWDA 5FERA 5F1HA 5D1LB 1FP0A 4IR6A 4IR4A 3L1XA 4YABA 4QEUA 5DFBA 1K2FA 4O75A 2L84A 2Y1MA 2NXBA 5I80A 3HCTA 3M62A 5IG6A 2R10A 5KHMA 4A0CD 5DINA 2YSMA 4I7CA 3GL6A 5FE5A 4O64A 3U5NA 5B76A 3UVXA 4C67A 4WZ2A 4W4UA 5HCLA 5EWCA 5CRMA 4QF3A 4S3OC 5DKAA 4P5OB 5H1TA 5EGUA 4NN2A 4UIVA 4AUQB 4O77A 1X4UA 4YYIA 3JVMA 5DYUA 1Z2QA 1E4UA 4MR4A 3U5MA 4YYDA 3SVFA 1T1HA 4PS5A 4GB0A 4I7DA 5EYAF 4AP4A 5FE1A 2CKLA 2L85A 2G43A 5CTLA 1HYJA 4QR5A 4ZW1A 4A4BA 3I3JA 4NUDA 2FUUA 4X3GA 4R8PK 5E7DA 5EPRA 4QSPA 3N9MA 4HXLA 5FG5A 5HM0A 5G05B 2ECGA 3KNVA 3Q2EA 5LKTA 4J0SA 2LDRA 5F61A 4QYDA 4XI1A 5DKDA 3N9LA 4YY6A 5KH7A 4TT6A 2H0DA 3ZVYA 2RNXA 4MR5A 3TLPA 2I7KA 2Y1NA 4FIPA 5AIUA 4TT2A 5DYCA 4F3IA 4OUFA 2YW5A 1RMDA 5E73A 3O37A 2HDPA 3L1ZB 4TZ8A 5CUAA 2MJVB 4MR3A 5AMFA 4MEPA 2KREA 2L75A 4ZDTA 5DW2A 2UZGA 2WP1A 4Z93A 5A5SA 1HYIA 5EVAA 3MHSA 4LYWA 4O70A 5FFYA 5DLZA 2MIQA 4CUTA 5ACYA 5A85A 2VJEA 4QSVA 4QNSA 1WILA 3G0LA 5B8DA 4Z1SA 4UYDA 5KTUA 4NR7A 3RPGC 5KTWA 5LJ0A 2M3HA 1MM3A 3HMEA 4PCEA 4YBMA 2MA5A 5H1VA 5HENA 2JMIA 4QF2A 5FDZA 4ZC9A 2YQMA 3L11A 2MD7B 5CUGA 2KTBB 2JRJA 5JG6A 4MSXA 2XEUA 4PPEA 1WEEA 4CLBA 5E9LA 4LZ2A 4TZ2A 3MQMA 4XUBA 5ENFA 4IC3A 5ENEA 4HBYA 5AMEA 4CUPA 5CS8A 4ALHA 3SOUA 2LV9A 5E0RA 3SVHA 3M63A 3O7AA 2CT2A 2F6NA 5II2A 3HCUA 5CU8A 4Z1QA 3O35A 5F1LA 3LQJA 3MULA 4QEWA 3DPLR 3MHHA 5LJ2A 4YH3A 5TDRA 4UYGA 2KWNA 1N87A 2E7OA 4O71A 5CGPA 5I1QA 3AQAA 4QC1A 5L8UA 2M1RA 3U5JA 2M85A 2KGGA 4MEQA 2YREA 3S92A 5DLXA 5G4SA 5CY9A 2AN6A 4HXMA 5C4QA 4QUTA 2QICA 5I7YA 5A81A 1WUMA 4YYGA 4Q6FA 3G0JA 3ZPV1 3FKMX 3UVYA 1JM7B 4N4FA 5D3LA 3GG3A 5E9MA 5I89A 5HQ6A 1WENA 2KWOA 5FE6A 2DKWA 1WEOA 4B7YC 5EWHA 5C85A 1CHCA 5FB0A 3O34A 4RVRA 5AITA 5D3JA 2YHNA 2RO1A 4X2IA 5LKZA 4LR6A 4LADB 5EK9A 2YQDA 4QSXA 1LDJB 2FSAA 4B86C 3N9NA 4LDFA 5I3LA 5FG4A 2KR4A 2MNZA 2VPEA 2CKLB 2YQLA 4NYXA 3P1DA 3ZNIA 2EA6A 4O7CA 4LZSA 5C7NA 4CL9A 3MXFA 4TQNA 5A5QA 4LJNA 4NUEA 2LQ6A 2KYUA 4LK9A 1WEVA 5LKXA 2ZETC 4FJCA 3T6RA 4BW4A 2GRCA 3QZVA 3P5OA 4IORA 5IGNA 2H0DB 2MT5A 2OXQC 4Q0OA 3PURA 3JVLA 3FL2A 4PKLA 4QUUA 4CCGX 4BHWA 5CP5A 2RFJA 2YELA 4NR5A 5F63A 4QBMA 4A9EA 5I86A 1JOCA 4CURA 5ETDA 2VNFA 2R0YA 4MENA 4NR6A 3PUQA 5KH9A 5E3GA 1X4JA 5LVRA 3MUKA 5HRXA 4NR9A 3SOWA 2DVSA 1WEMA 4V3KC 4BW1A 4IOOA 2YU4A 3ASLA 3EB6A 4CUUA 1Z60A 2VJEB 5HFRA 5EQ1A 2LRIC 3IHPA 4OGJA 1WIMA 2D8SA 5KO4A 3ZVZB 3UW9A 5FH7A 2L80A 5DKCA 5DX4A 5TDWA 5HEMA 5CQAA 4CFKA 5ETBA 1VYXA 1WE9A 2VJFA 5LCWB 4BBQA 4QZSA 2I50A 5F25A 5CQ5A 5D26A 4FLPA 5D25A 4NRCA 2H60A 4FO9A 2R0VA 4HBVA 2XB1A 5TB6A 3KV6A 2L43A 4A9HA 5EWVA 1X4IA 2CSZA 1WFKA 3HMFA 5IIDA 4WZ3B 5HJCA 1V87A 5BT5A 3AADA 2L5EA 5EPBA 1WEWA 1ZBDB 2ECWA 4YYJA 5FH6A 4NYVA 2DVVA 5E9KA 3LJWA 3NXBA 5CRZA 5ENIA 4GNFA 2LN0A 2CSYA 2JMDA 2NAAA 5FE4A 1WUGA 2LGGA 4WHWA 2D9EA 3UV5A 4QSUA 2KWKA 4UP5A 2DVQA 2DX8A 4IR5A 1JM4B 1WEQA 4NUCA 5C89A 4NS5A 4LLBA 1WEUA 5F60A 4HXKA 1VFYA 4YBSA 3N9OA 4MR6A 5EU1A 2VPGA 4NR8A 2JMJA 4YBTA 5EWWA 1E6IA 2RNWA 5DYAA 4AVXA 5EV9A 3RPGB 5D3HA 5FE3A 2DVRA 4IC2A 4A9KA 4CUQA 4QSWA 2YT5A 5EPSA 3LQIA 5E9YA 5HRWA 2YEKA 5IGLA 4CUSA 2ECTA 4Y03A 5F3AA 1IYMA 3KQIA 1Z6UA 3IU5A 4N4IA 5CUCA 2M6MA 4R7EA 5HQ7A 4O7BA 4O78A 3UVDA 4N4GA 2IDAA 5E74A 2ECJA 4HXOA 5B75A 5A5NA 3DQVR 5FBXA 4QEVA 4IOQA 4Z6HA 4O7AA 5AD3A 2Y43A 3JVKA 4XY8A 4TT4A 4FK5A 5H1UA 2F6JA 3PHDA 5HRVA 4E96A 4O7EA 2KE1A 2OO1A 5L96A 4YH4A 3K2JA 3UV2A 4HBWA 2QIZA 2MUMA 2RSDA 4UYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QB3 A;  5H85 A;  4WZ0 A;  1BOR A;  3UV4 A;  5CUB A;  3HTK C;  2E3K A;  5FE2 A;  3MB4 A;  4Q0N A;  5C87 A;  5COI A;  5D0C A;  4F52 B;  5LUU A;  4UIY A;  4O74 A;  4QSR A;  5H9M A;  4UP0 A;  4TYL A;  5F5Z A;  4TKP B;  5DY7 A;  1F62 A;  3QZT A;  4CA1 A;  4ZQL A;  2G4A A;  5DYX A;  2E7N A;  5FE9 A;  2C2L A;  2LXH C;  4A9O A;  5CFW A;  1MM2 A;  4UYF A;  4HXS A;  3U5P A;  2K1J A;  4J1P A;  5HEL A;  2YEM A;  4AYC A;  5I40 A;  5C11 A;  3RTR B;  4MEO A;  2ECN A;  2VJF B;  2DWW A;  4YAD A;  5TAB A;  4TU4 A;  4A9I A;  4TU6 A;  5L98 A;  2G6Q A;  4R2Y A;  5F2P A;  2YDW A;  3VK6 A;  5EIC A;  2L5U A;  3KV5 A;  4PY6 A;  3GV4 A;  2KIZ A;  4TS8 A;  5A5O A;  4NQN A;  4QR4 A;  5FFW A;  5KTX A;  5E9I A;  2C2V S;  2VPD A;  4LRG A;  5FH8 A;  3Q2F A;  5D7X A;  4WIV A;  3SVG A;  4UIU A;  3I2D A;  5EA1 A;  5FE7 A;  1XWH A;  3P1E A;  5TRB A;  4A9N A;  5DW1 A;  2KGI A;  2L0B A;  5EM3 A;  5D24 A;  2F42 A;  5G0F A;  5B77 A;  4QYL A;  4XYA A;  2E6S A;  2ECI A;  2LGV A;  4UI9 B;  4HBX A;  5TBN A;  1FBV A;  1JM7 A;  3LXJ A;  5L99 A;  2I8N A;  4A9F A;  4YYM A;  4GND A;  3DAI A;  4L58 A;  5F62 A;  2YUC A;  4NYW A;  5EIS A;  4AKN A;  4KCX A;  4J0R A;  4NRA A;  5ENH A;  2YYN A;  2D82 A;  5KH3 A;  3V43 A;  5BT4 A;  5CUE A;  5D3S A;  4S3O B;  4TTE A;  5D3P A;  4KV1 A;  1WGM A;  3N9Q A;  1WEP A;  4A4C A;  4OGI A;  5CQ3 A;  5A83 A;  1G25 A;  5B79 A;  1N72 A;  4GPJ A;  5DBM A;  5CUD A;  4A9M A;  3C6W A;  4Z6I A;  5II1 A;  2OSS A;  5FEY A;  4LYI A;  5DKH A;  4V3L C;  5EI4 A;  4YAX A;  5F36 A;  3P1F A;  4BW2 A;  5KU3 A;  4HXN A;  4NR4 A;  2YHO A;  3SHB A;  5JWM A;  3NG2 A;  5D1M B;  3T7L A;  1U6G B;  4GNE A;  1JSP B;  4YAT A;  4N3W A;  5L8T A;  1VD4 A;  4KV4 A;  5A82 A;  5I83 A;  4C66 A;  4A9J A;  2R0S A;  5D3T A;  5IGM A;  5JI8 A;  4UYH A;  3U5L A;  4LYS A;  5A5P A;  5HLS A;  5DFC A;  1X0J A;  5HQ5 A;  2ECV A;  5LVQ A;  2DAT A;  4QC3 A;  2G45 A;  3ZPV E;  3QZS A;  4DON A;  5LJ1 A;  2K4D A;  4C9Z A;  1ZS5 A;  2MNY A;  5A5R A;  5LKU A;  5FFV A;  4QSS A;  4J3I A;  4O7F A;  2WP2 A;  5C13 A;  3S91 A;  5IBN A;  3RCW A;  4NXJ A;  3ONI A;  5CQ8 A;  2KFT A;  5G4R A;  1LDK C;  5D3R A;  4YYH A;  3LQH A;  4O72 A;  5D1K B;  4XUA A;  4UIT A;  4I7B A;  4YYN A;  5TCM A;  4NQM A;  5B78 A;  2K16 A;  5E3D A;  4ALG A;  4QR3 A;  2OUO A;  3JVJ A;  3SOX A;  5CQ7 A;  4A9L A;  4HXP A;  4GNG A;  4UYF B;  2K17 A;  1WES A;  3P1C A;  5L97 A;  5I88 A;  4LC2 A;  4AYC B;  4UIX A;  5E9V A;  5BT3 A;  3LRQ A;  3C5K A;  4IR3 A;  1DVP A;  5EP7 A;  4N4H A;  5CZG A;  5ENJ A;  3N9P A;  2YSJ A;  5C8G A;  4BW3 A;  5CQT A;  5DFD A;  4WHU A;  4PTB A;  2HYE D;  5A7C A;  5HFQ A;  4QSQ A;  5ENC A;  3HCS A;  5FE0 A;  5CQ4 A;  3DWY A;  4UIW A;  2EGP A;  2LXP C;  1F68 A;  2VP7 A;  4YC9 A;  2MA6 A;  2QJ0 A;  4WA6 A;  4ZUX U;  4UIZ A;  5D3N A;  2YUR A;  2FUI A;  5G04 B;  5ENG A;  3U5O A;  4YK0 A;  3ZYU A;  2LGL A;  3ZTG A;  2LSP B;  3HMH A;  2YW8 A;  4A49 A;  5CQ6 A;  5AD2 A;  3MB3 A;  2LGK A;  4QY4 A;  2BAY A;  4PCI A;  4LZR A;  2VPB A;  4YY4 A;  5K29 A;  3O33 A;  2N9G A;  3IU6 A;  2E6R A;  2EOD A;  4NRB A;  2RI7 A;  5FB1 A;  4BJX A;  4QST A;  5J0D A;  4XY9 A;  3U5K A;  4MVT A;  5FG6 A;  2YYR A;  2RS9 B;  2KWJ A;  2PUY A;  1EQF A;  4O76 A;  4CFL A;  2MD8 C;  5ENB A;  2PNX A;  3EB5 A;  5IGK A;  3ZYQ A;  4YYK A;  4HXR A;  3O70 A;  5CPE A;  2RNY A;  3UVW A;  5I29 A;  5FE8 A;  5I7X A;  5J3X A;  2KU3 A;  3M99 A;  4L7X A;  3O36 A;  3D7C A;  4LKA A;  5EWD A;  5FER A;  5F1H A;  5D1L B;  1FP0 A;  4IR6 A;  4IR4 A;  3L1X A;  4YAB A;  4QEU A;  5DFB A;  1K2F A;  4O75 A;  2L84 A;  2Y1M A;  2NXB A;  5I80 A;  3HCT A;  3M62 A;  5IG6 A;  2R10 A;  5KHM A;  4A0C D;  5DIN A;  2YSM A;  4I7C A;  3GL6 A;  5FE5 A;  4O64 A;  3U5N A;  5B76 A;  3UVX A;  4C67 A;  4WZ2 A;  4W4U A;  5HCL A;  5EWC A;  5CRM A;  4QF3 A;  4S3O C;  5DKA A;  4P5O B;  5H1T A;  5EGU A;  4NN2 A;  4UIV A;  4AUQ B;  4O77 A;  1X4U A;  4YYI A;  3JVM A;  5DYU A;  1Z2Q A;  1E4U A;  4MR4 A;  3U5M A;  4YYD A;  3SVF A;  1T1H A;  4PS5 A;  4GB0 A;  4I7D A;  5EYA F;  4AP4 A;  5FE1 A;  2CKL A;  2L85 A;  2G43 A;  5CTL A;  1HYJ A;  4QR5 A;  4ZW1 A;  4A4B A;  3I3J A;  4NUD A;  2FUU A;  4X3G A;  4R8P K;  5E7D A;  5EPR A;  4QSP A;  3N9M A;  4HXL A;  5FG5 A;  5HM0 A;  5G05 B;  2ECG A;  3KNV A;  3Q2E A;  5LKT A;  4J0S A;  2LDR A;  5F61 A;  4QYD A;  4XI1 A;  5DKD A;  3N9L A;  4YY6 A;  5KH7 A;  4TT6 A;  2H0D A;  3ZVY A;  2RNX A;  4MR5 A;  3TLP A;  2I7K A;  2Y1N A;  4FIP A;  5AIU A;  4TT2 A;  5DYC A;  4F3I A;  4OUF A;  2YW5 A;  1RMD A;  5E73 A;  3O37 A;  2HDP A;  3L1Z B;  4TZ8 A;  5CUA A;  2MJV B;  4MR3 A;  5AMF A;  4MEP A;  2KRE A;  2L75 A;  4ZDT A;  5DW2 A;  2UZG A;  2WP1 A;  4Z93 A;  5A5S A;  1HYI A;  5EVA A;  3MHS A;  4LYW A;  4O70 A;  5FFY A;  5DLZ A;  2MIQ A;  4CUT A;  5ACY A;  5A85 A;  2VJE A;  4QSV A;  4QNS A;  1WIL A;  3G0L A;  5B8D A;  4Z1S A;  4UYD A;  5KTU A;  4NR7 A;  3RPG C;  5KTW A;  5LJ0 A;  2M3H A;  1MM3 A;  3HME A;  4PCE A;  4YBM A;  2MA5 A;  5H1V A;  5HEN A;  2JMI A;  4QF2 A;  5FDZ A;  4ZC9 A;  2YQM A;  3L11 A;  2MD7 B;  5CUG A;  2KTB B;  2JRJ A;  5JG6 A;  4MSX A;  2XEU A;  4PPE A;  1WEE A;  4CLB A;  5E9L A;  4LZ2 A;  4TZ2 A;  3MQM A;  4XUB A;  5ENF A;  4IC3 A;  5ENE A;  4HBY A;  5AME A;  4CUP A;  5CS8 A;  4ALH A;  3SOU A;  2LV9 A;  5E0R A;  3SVH A;  3M63 A;  3O7A A;  2CT2 A;  2F6N A;  5II2 A;  3HCU A;  5CU8 A;  4Z1Q A;  3O35 A;  5F1L A;  3LQJ A;  3MUL A;  4QEW A;  3DPL R;  3MHH A;  5LJ2 A;  4YH3 A;  5TDR A;  4UYG A;  2KWN A;  1N87 A;  2E7O A;  4O71 A;  5CGP A;  5I1Q A;  3AQA A;  4QC1 A;  5L8U A;  2M1R A;  3U5J A;  2M85 A;  2KGG A;  4MEQ A;  2YRE A;  3S92 A;  5DLX A;  5G4S A;  5CY9 A;  2AN6 A;  4HXM A;  5C4Q A;  4QUT A;  2QIC A;  5I7Y A;  5A81 A;  1WUM A;  4YYG A;  4Q6F A;  3G0J A;  3ZPV 1;  3FKM X;  3UVY A;  1JM7 B;  4N4F A;  5D3L A;  3GG3 A;  5E9M A;  5I89 A;  5HQ6 A;  1WEN A;  2KWO A;  5FE6 A;  2DKW A;  1WEO A;  4B7Y C;  5EWH A;  5C85 A;  1CHC A;  5FB0 A;  3O34 A;  4RVR A;  5AIT A;  5D3J A;  2YHN A;  2RO1 A;  4X2I A;  5LKZ A;  4LR6 A;  4LAD B;  5EK9 A;  2YQD A;  4QSX A;  1LDJ B;  2FSA A;  4B86 C;  3N9N A;  4LDF A;  5I3L A;  5FG4 A;  2KR4 A;  2MNZ A;  2VPE A;  2CKL B;  2YQL A;  4NYX A;  3P1D A;  3ZNI A;  2EA6 A;  4O7C A;  4LZS A;  5C7N A;  4CL9 A;  3MXF A;  4TQN A;  5A5Q A;  4LJN A;  4NUE A;  2LQ6 A;  2KYU A;  4LK9 A;  1WEV A;  5LKX A;  2ZET C;  4FJC A;  3T6R A;  4BW4 A;  2GRC A;  3QZV A;  3P5O A;  4IOR A;  5IGN A;  2H0D B;  2MT5 A;  2OXQ C;  4Q0O A;  3PUR A;  3JVL A;  3FL2 A;  4PKL A;  4QUU A;  4CCG X;  4BHW A;  5CP5 A;  2RFJ A;  2YEL A;  4NR5 A;  5F63 A;  4QBM A;  4A9E A;  5I86 A;  1JOC A;  4CUR A;  5ETD A;  2VNF A;  2R0Y A;  4MEN A;  4NR6 A;  3PUQ A;  5KH9 A;  5E3G A;  1X4J A;  5LVR A;  3MUK A;  5HRX A;  4NR9 A;  3SOW A;  2DVS A;  1WEM A;  4V3K C;  4BW1 A;  4IOO A;  2YU4 A;  3ASL A;  3EB6 A;  4CUU A;  1Z60 A;  2VJE B;  5HFR A;  5EQ1 A;  2LRI C;  3IHP A;  4OGJ A;  1WIM A;  2D8S A;  5KO4 A;  3ZVZ B;  3UW9 A;  5FH7 A;  2L80 A;  5DKC A;  5DX4 A;  5TDW A;  5HEM A;  5CQA A;  4CFK A;  5ETB A;  1VYX A;  1WE9 A;  2VJF A;  5LCW B;  4BBQ A;  4QZS A;  2I50 A;  5F25 A;  5CQ5 A;  5D26 A;  4FLP A;  5D25 A;  4NRC A;  2H60 A;  4FO9 A;  2R0V A;  4HBV A;  2XB1 A;  5TB6 A;  3KV6 A;  2L43 A;  4A9H A;  5EWV A;  1X4I A;  2CSZ A;  1WFK A;  3HMF A;  5IID A;  4WZ3 B;  5HJC A;  1V87 A;  5BT5 A;  3AAD A;  2L5E A;  5EPB A;  1WEW A;  1ZBD B;  2ECW A;  4YYJ A;  5FH6 A;  4NYV A;  2DVV A;  5E9K A;  3LJW A;  3NXB A;  5CRZ A;  5ENI A;  4GNF A;  2LN0 A;  2CSY A;  2JMD A;  2NAA A;  5FE4 A;  1WUG A;  2LGG A;  4WHW A;  2D9E A;  3UV5 A;  4QSU A;  2KWK A;  4UP5 A;  2DVQ A;  2DX8 A;  4IR5 A;  1JM4 B;  1WEQ A;  4NUC A;  5C89 A;  4NS5 A;  4LLB A;  1WEU A;  5F60 A;  4HXK A;  1VFY A;  4YBS A;  3N9O A;  4MR6 A;  5EU1 A;  2VPG A;  4NR8 A;  2JMJ A;  4YBT A;  5EWW A;  1E6I A;  2RNW A;  5DYA A;  4AVX A;  5EV9 A;  3RPG B;  5D3H A;  5FE3 A;  2DVR A;  4IC2 A;  4A9K A;  4CUQ A;  4QSW A;  2YT5 A;  5EPS A;  3LQI A;  5E9Y A;  5HRW A;  2YEK A;  5IGL A;  4CUS A;  2ECT A;  4Y03 A;  5F3A A;  1IYM A;  3KQI A;  1Z6U A;  3IU5 A;  4N4I A;  5CUC A;  2M6M A;  4R7E A;  5HQ7 A;  4O7B A;  4O78 A;  3UVD A;  4N4G A;  2IDA A;  5E74 A;  2ECJ A;  4HXO A;  5B75 A;  5A5N A;  3DQV R;  5FBX A;  4QEV A;  4IOQ A;  4Z6H A;  4O7A A;  5AD3 A;  2Y43 A;  3JVK A;  4XY8 A;  4TT4 A;  4FK5 A;  5H1U A;  2F6J A;  3PHD A;  5HRV A;  4E96 A;  4O7E A;  2KE1 A;  2OO1 A;  5L96 A;  4YH4 A;  3K2J A;  3UV2 A;  4HBW A;  2QIZ A;  2MUM A;  2RSD A;  4UYE A; 
#chains in the Genus database with same CATH topology
 4QB3 A;  5H85 A;  4AI6 A;  1BOR A;  3UV4 A;  4WZ0 A;  5CUB A;  3VKG A;  3HTK C;  2E3K A;  5FE2 A;  3MB4 A;  4Q0N A;  5C87 A;  5COI A;  5D0C A;  4F52 B;  5LUU A;  4UIY A;  4O74 A;  4QSR A;  5H9M A;  4UP0 A;  4TYL A;  5F5Z A;  4TKP B;  5DY7 A;  1F62 A;  3QZT A;  4CA1 A;  4ZQL A;  2G4A A;  5DYX A;  2E7N A;  2DSM A;  5FE9 A;  2C2L A;  2LXH C;  4A9O A;  5CFW A;  1MM2 A;  4UYF A;  4HXS A;  3U5P A;  2K1J A;  4J1P A;  5HEL A;  4OGC A;  2YEM A;  4AYC A;  5I40 A;  5C11 A;  2EJN A;  3RTR B;  4MEO A;  2ECN A;  2VJF B;  2DWW A;  4YAD A;  5TAB A;  4TU4 A;  4A9I A;  4TU6 A;  5L98 A;  2G6Q A;  4R2Y A;  5F2P A;  2YDW A;  3VK6 A;  5EIC A;  2L5U A;  3KV5 A;  4PY6 A;  3GV4 A;  2KIZ A;  4TS8 A;  5A5O A;  4NQN A;  4QR4 A;  5FFW A;  5KTX A;  5E9I A;  2C2V S;  2VPD A;  4LRG A;  5FH8 A;  3Q2F A;  5D7X A;  4WIV A;  3SVG A;  4UIU A;  3I2D A;  5EA1 A;  5FE7 A;  1XWH A;  3P1E A;  5TRB A;  4A9N A;  5DW1 A;  2KGI A;  2L0B A;  3LVQ E;  5EM3 A;  5D24 A;  2F42 A;  5G0F A;  5B77 A;  4QYL A;  4XYA A;  2E6S A;  2ECI A;  2LGV A;  4UI9 B;  5DKA A;  4HBX A;  5TBN A;  1FBV A;  1JM7 A;  3LXJ A;  5L99 A;  2I8N A;  4A9F A;  4YYM A;  4GND A;  3DAI A;  3FEH A;  4L58 A;  5F62 A;  2YUC A;  4NYW A;  5EIS A;  4AKN A;  4KCX A;  4J0R A;  4NRA A;  5ENH A;  2YYN A;  2D82 A;  4AKI A;  3V43 A;  5KH3 A;  2CON A;  5BT4 A;  5CUE A;  5D3S A;  4S3O B;  4TTE A;  5D3P A;  4KV1 A;  1WGM A;  3N9Q A;  4H9D A;  1WEP A;  2MKE A;  4A4C A;  4OGI A;  5CQ3 A;  5A83 A;  1G25 A;  5B79 A;  1N72 A;  4GPJ A;  5DBM A;  5CUD A;  4A9M A;  3C6W A;  4Z6I A;  5II1 A;  4QQ4 A;  2OSS A;  5FEY A;  4LYI A;  5DKH A;  4V3L C;  5EI4 A;  3E2D A;  4YAX A;  5F36 A;  3P1F A;  2YVR A;  4BW2 A;  5KU3 A;  4HXN A;  4NR4 A;  2YHO A;  3SHB A;  5JWM A;  3NG2 A;  3ERR A;  5D1M B;  3T7L A;  1U6G B;  4GNE A;  1JSP B;  4YAT A;  4N3W A;  5L8T A;  1VD4 A;  4KV4 A;  5A82 A;  5I83 A;  4C66 A;  4A9J A;  5D3T A;  2R0S A;  5IGM A;  5JI8 A;  4UYH A;  3U5L A;  4LYS A;  5A5P A;  5HLS A;  5DFC A;  1X0J A;  5HQ5 A;  2ECV A;  5LVQ A;  2DAT A;  4QC3 A;  2G45 A;  2KKY A;  3QZS A;  3ZPV E;  4DON A;  5LJ1 A;  2K4D A;  4C9Z A;  1ZS5 A;  2MNY A;  5A5R A;  5LKU A;  5FFV A;  4QSS A;  4J3I A;  4O7F A;  2WP2 A;  5C13 A;  3S91 A;  5IBN A;  3RCW A;  4NXJ A;  3ONI A;  5CQ8 A;  2KFT A;  5G4R A;  1LDK C;  5D3R A;  4YYH A;  3LQH A;  4O72 A;  2JUN A;  3PLW A;  5D1K B;  4XUA A;  4UIT A;  4I7B A;  4YYN A;  5TCM A;  4NQM A;  5B78 A;  2K16 A;  5E3D A;  4ALG A;  4QR3 A;  2OUO A;  3JVJ A;  3DWD A;  3SOX A;  5CQ7 A;  4A9L A;  4HXP A;  4GNG A;  4UYF B;  2K17 A;  1WES A;  3P1C A;  5L97 A;  2EGM A;  5I88 A;  4LC2 A;  4AYC B;  4UIX A;  5E9V A;  5BT3 A;  3LRQ A;  3C5K A;  4IR3 A;  1DVP A;  2XOY A;  5EP7 A;  4N4H A;  5CZG A;  5ENJ A;  3N9P A;  2YSJ A;  5C8G A;  4BW3 A;  5CQT A;  5DFD A;  4WHU A;  4PTB A;  2HYE D;  3LDY A;  5A7C A;  5HFQ A;  4QSQ A;  5ENC A;  3HCS A;  5FE0 A;  5CQ4 A;  3DWY A;  4UIW A;  2EXU A;  2EGP A;  2LXP C;  1F68 A;  2VP7 A;  4YC9 A;  2JM3 A;  2MA6 A;  2QJ0 A;  4WA6 A;  4ZUX U;  4UIZ A;  5D3N A;  2YUR A;  2FUI A;  5G04 B;  5ENG A;  3U5O A;  4YK0 A;  3ZYU A;  2LGL A;  3ZTG A;  2LSP B;  4F1P A;  3HMH A;  2YW8 A;  4A49 A;  5CQ6 A;  5AD2 A;  3MB3 A;  2LGK A;  4QY4 A;  2BAY A;  4PCI A;  4LZR A;  2VPB A;  4YY4 A;  5K29 A;  3O33 A;  3M7K A;  2N9G A;  3IU6 A;  2E6R A;  2EOD A;  4NRB A;  2RI7 A;  5FB1 A;  4BJX A;  4QST A;  5J0D A;  4XY9 A;  3U5K A;  4MVT A;  5FG6 A;  2YYR A;  2RS9 B;  2KWJ A;  2PUY A;  2CSV A;  1EQF A;  4O76 A;  4CFL A;  2MD8 C;  5ENB A;  2PNX A;  3EB5 A;  5IGK A;  3Q1D A;  3ZYQ A;  4YYK A;  4HXR A;  3O70 A;  5CPE A;  2RNY A;  3UVW A;  5I29 A;  2RR4 A;  5FE8 A;  5I7X A;  5J3X A;  2KU3 A;  3M99 A;  4L7X A;  3O36 A;  3D7C A;  4LKA A;  5EWD A;  5FER A;  5F1H A;  5SVY A;  5D1L B;  1FP0 A;  4IR6 A;  4IR4 A;  3L1X A;  4YAB A;  4QEU A;  5DFB A;  1K2F A;  4O75 A;  2L84 A;  2Y1M A;  2NXB A;  5I80 A;  3LJU X;  3HCT A;  3M62 A;  5IG6 A;  2R10 A;  5SVI A;  5KHM A;  4A0C D;  5DIN A;  2YSM A;  4I7C A;  3GL6 A;  5FE5 A;  4O64 A;  3U5N A;  5B76 A;  3UVX A;  4C67 A;  4WZ2 A;  4W4U A;  5HCL A;  5EWC A;  5CRM A;  3JUE A;  4QF3 A;  4S3O C;  4P5O B;  5H1T A;  5EGU A;  4NN2 A;  4UIV A;  4AUQ B;  4O77 A;  1X4U A;  4YYI A;  3JVM A;  5DYU A;  1Z2Q A;  1E4U A;  4MR4 A;  3U5M A;  4YYD A;  3SVF A;  1T1H A;  4PS5 A;  4GB0 A;  4I7D A;  5EYA F;  4AP4 A;  5FE1 A;  2CKL A;  2L85 A;  2G43 A;  5CTL A;  1HYJ A;  4QR5 A;  4ZW1 A;  2P57 A;  4A4B A;  3I3J A;  4NUD A;  2FUU A;  4X3G A;  4R8P K;  5E7D A;  5EPR A;  3VKH A;  4QSP A;  3N9M A;  4HXL A;  5FG5 A;  5HM0 A;  5G05 B;  2ECG A;  3KNV A;  3Q2E A;  5LKT A;  4J0S A;  2LDR A;  5F61 A;  4QYD A;  4XI1 A;  5DKD A;  3N9L A;  4YY6 A;  5KH7 A;  4TT6 A;  2H0D A;  3ZVY A;  2RNX A;  4MR5 A;  3TLP A;  2I7K A;  2Y1N A;  4FIP A;  5AIU A;  4TT2 A;  5DYC A;  4F3I A;  4OUF A;  2YW5 A;  1RMD A;  5E73 A;  3O37 A;  2HDP A;  3L1Z B;  4TZ8 A;  5CUA A;  2MJV B;  4MR3 A;  5AMF A;  4MEP A;  2KRE A;  2L75 A;  3DDT A;  5DW2 A;  2UZG A;  4O62 A;  4ZDT A;  2WP1 A;  4Z93 A;  5A5S A;  1HYI A;  5EVA A;  3MHS A;  4LYW A;  4O70 A;  5FFY A;  5DLZ A;  2MIQ A;  4CUT A;  3MDB C;  5ACY A;  5A85 A;  2VJE A;  4QSV A;  4QNS A;  1WIL A;  3G0L A;  2KKX A;  4Z1S A;  5B8D A;  4UYD A;  5KTU A;  4NR7 A;  3RPG C;  5KTW A;  5LJ0 A;  2M3H A;  1MM3 A;  3HME A;  4PCE A;  4YBM A;  2MA5 A;  5H1V A;  5HEN A;  2JMI A;  4QF2 A;  5FDZ A;  4ZC9 A;  2YQM A;  3L11 A;  2MD7 B;  5CUG A;  2KTB B;  2JRJ A;  5JG6 A;  4MSX A;  2XEU A;  4PPE A;  1WEE A;  4CLB A;  5E9L A;  2XOC A;  4LZ2 A;  4TZ2 A;  3MQM A;  4XUB A;  5ENF A;  4IC3 A;  5ENE A;  4HBY A;  5AME A;  1PUO A;  4CUP A;  5CS8 A;  4ALH A;  3SOU A;  2LV9 A;  5E0R A;  3SVH A;  3M63 A;  3O7A A;  2CT2 A;  2F6N A;  5II2 A;  3FAO A;  5CU8 A;  4Z1Q A;  3HCU A;  3O35 A;  5F1L A;  3LQJ A;  3MUL A;  4QEW A;  3DPL R;  3MHH A;  5LJ2 A;  4YH3 A;  5TDR A;  4UYG A;  2KWN A;  1N87 A;  2E7O A;  4O71 A;  5CGP A;  5I1Q A;  3AQA A;  4QC1 A;  5L8U A;  2M1R A;  3U5J A;  2M85 A;  2KGG A;  4MEQ A;  2YRE A;  3S92 A;  5DLX A;  5G4S A;  5CY9 A;  2AN6 A;  1MBM A;  4HXM A;  5C4Q A;  4QUT A;  2QIC A;  5I7Y A;  5A81 A;  1WUM A;  4YYG A;  4Q6F A;  3G0J A;  3ZPV 1;  3FKM X;  3UVY A;  1JM7 B;  4N4F A;  5D3L A;  3GG3 A;  5E9M A;  5I89 A;  5HQ6 A;  1WEN A;  3FM8 C;  2KWO A;  5FE6 A;  3LVR E;  5SVX A;  2DKW A;  1WEO A;  4B7Y C;  5EWH A;  2CRR A;  5C85 A;  1CHC A;  5FB0 A;  3O34 A;  4RVR A;  5AIT A;  5D3J A;  2YHN A;  2RO1 A;  4X2I A;  3O47 A;  5LKZ A;  4LR6 A;  4LAD B;  5EK9 A;  2YQD A;  4QSX A;  1LDJ B;  2FSA A;  4B86 C;  3N9N A;  4LDF A;  5I3L A;  5FG4 A;  2KR4 A;  2MNZ A;  2VPE A;  2CKL B;  2YQL A;  4NYX A;  3P1D A;  3ZNI A;  2EA6 A;  4O7C A;  3FJU B;  4LZS A;  5C7N A;  4CL9 A;  3MXF A;  4TQN A;  5A5Q A;  4LJN A;  4NUE A;  2LQ6 A;  2FFW A;  2KYU A;  4LK9 A;  1WEV A;  5LKX A;  2ZET C;  4FJC A;  3T6R A;  3KDE C;  4BW4 A;  2GRC A;  3QZV A;  3P5O A;  4AKG A;  4IOR A;  3D1D A;  5IGN A;  2E61 A;  2H0D B;  4Q0O A;  2MT5 A;  2OXQ C;  3PUR A;  3JVL A;  3FL2 A;  4PKL A;  4QUU A;  5K3Q A;  4CCG X;  2XOZ A;  4BHW A;  5CP5 A;  2RFJ A;  2YEL A;  2M13 A;  4NR5 A;  5F63 A;  4QBM A;  4A9E A;  5I86 A;  1JOC A;  3FAN A;  4CUR A;  5ETD A;  2VNF A;  2R0Y A;  4MEN A;  4NR6 A;  3PUQ A;  5KH9 A;  5E3G A;  1X4J A;  5LVR A;  3MUK A;  5HRX A;  4NR9 A;  3SOW A;  2DVS A;  1WEM A;  4V3K C;  4BW1 A;  4IOO A;  2YU4 A;  3ASL A;  3EB6 A;  4CUU A;  1Z60 A;  2VJE B;  5HFR A;  5EQ1 A;  2LRI C;  3IHP A;  2LAU A;  4AKH A;  4OGJ A;  1WIM A;  2D8S A;  5KO4 A;  2L7P A;  3ZVZ B;  3UW9 A;  5FH7 A;  2L80 A;  5DKC A;  5DX4 A;  5TDW A;  5HEM A;  5CQA A;  4CFK A;  5ETB A;  1VYX A;  1WE9 A;  2VJF A;  5LCW B;  4BBQ A;  4QZS A;  2I50 A;  5F25 A;  5CQ5 A;  5D26 A;  4FLP A;  5D25 A;  4NRC A;  2H60 A;  4FO9 A;  2CRW A;  2R0V A;  4HBV A;  3D1B A;  2XB1 A;  5TB6 A;  3KV6 A;  3SUB A;  2L43 A;  4A9H A;  5EWV A;  1X4I A;  2CSZ A;  1WFK A;  3HMF A;  5IID A;  4WZ3 B;  5HJC A;  1V87 A;  5BT5 A;  3AAD A;  2L5E A;  5EPB A;  1WEW A;  1ZBD B;  2ECW A;  4Z0R A;  4YYJ A;  5FH6 A;  4NYV A;  2DVV A;  5E9K A;  2DJA A;  3LJW A;  3NXB A;  5CRZ A;  5ENI A;  4GNF A;  2LN0 A;  2CSY A;  2JMD A;  2NAA A;  5FE4 A;  1WUG A;  2LGG A;  4WHW A;  2D9E A;  2B0O E;  3UV5 A;  4QSU A;  2KWK A;  4UP5 A;  2DVQ A;  2DX8 A;  4IR5 A;  1JM4 B;  1WEQ A;  4NUC A;  5C89 A;  2IQJ A;  4NS5 A;  4LLB A;  1WEU A;  4Z0O A;  5F60 A;  2OWA A;  4HXK A;  1VFY A;  4YBS A;  3N9O A;  3H7H A;  4MR6 A;  5EU1 A;  2D8U A;  2VPG A;  4NR8 A;  2JMJ A;  4YBT A;  5EWW A;  1E6I A;  2RNW A;  5DYA A;  4AVX A;  5EV9 A;  3RPG B;  5D3H A;  5FE3 A;  2DVR A;  4IC2 A;  4A9K A;  4CUQ A;  4QSW A;  2YT5 A;  5EPS A;  3LQI A;  5E9Y A;  5HRW A;  2YEK A;  5IGL A;  4CUS A;  2ECT A;  4Y03 A;  5F3A A;  1IYM A;  3KQI A;  1Z6U A;  3IU5 A;  4N4I A;  5CUC A;  2M6M A;  4R7E A;  5HQ7 A;  1DCQ A;  1ZKR A;  4O7B A;  4O78 A;  3UVD A;  4N4G A;  2IDA A;  5E74 A;  2ECJ A;  2XP0 A;  4HXO A;  5B75 A;  5A5N A;  3DQV R;  5FBX A;  4QEV A;  4IOQ A;  4Z6H A;  4O7A A;  5AD3 A;  2FD4 A;  2Y43 A;  3JVK A;  4XY8 A;  4TT4 A;  4FK5 A;  5H1U A;  2F6J A;  4OGE A;  3PHD A;  5HRV A;  3T9K A;  4E96 A;  4O7E A;  2KE1 A;  5SVI B;  2OO1 A;  5L96 A;  4YH4 A;  3K2J A;  3UV2 A;  4HBW A;  2QIZ A;  2MUM A;  2RSD A;  4UYE A; 
#chains in the Genus database with same CATH homology
 4QB3 A;  5H85 A;  4WZ0 A;  1BOR A;  3UV4 A;  5CUB A;  3HTK C;  2E3K A;  5FE2 A;  3MB4 A;  4Q0N A;  5C87 A;  5COI A;  5D0C A;  4F52 B;  5LUU A;  4UIY A;  4O74 A;  4QSR A;  5H9M A;  4UP0 A;  4TYL A;  5F5Z A;  4TKP B;  5DY7 A;  1F62 A;  3QZT A;  4CA1 A;  4ZQL A;  2G4A A;  5DYX A;  2E7N A;  5FE9 A;  2C2L A;  2LXH C;  4A9O A;  5CFW A;  1MM2 A;  4UYF A;  4HXS A;  3U5P A;  2K1J A;  4J1P A;  5HEL A;  2YEM A;  4AYC A;  5I40 A;  5C11 A;  3RTR B;  4MEO A;  2ECN A;  2VJF B;  2DWW A;  4YAD A;  5TAB A;  4TU4 A;  4A9I A;  4TU6 A;  5L98 A;  2G6Q A;  4R2Y A;  5F2P A;  2YDW A;  3VK6 A;  5EIC A;  2L5U A;  3KV5 A;  4PY6 A;  3GV4 A;  2KIZ A;  4TS8 A;  5A5O A;  4NQN A;  4QR4 A;  5FFW A;  5KTX A;  5E9I A;  2C2V S;  2VPD A;  4LRG A;  5FH8 A;  3Q2F A;  5D7X A;  4WIV A;  3SVG A;  4UIU A;  3I2D A;  5EA1 A;  5FE7 A;  1XWH A;  3P1E A;  5TRB A;  4A9N A;  5DW1 A;  2KGI A;  2L0B A;  5EM3 A;  5D24 A;  2F42 A;  5G0F A;  5B77 A;  4QYL A;  4XYA A;  2E6S A;  2ECI A;  2LGV A;  4UI9 B;  4HBX A;  5TBN A;  1FBV A;  1JM7 A;  3LXJ A;  5L99 A;  2I8N A;  4A9F A;  4YYM A;  4GND A;  3DAI A;  4L58 A;  5F62 A;  2YUC A;  4NYW A;  5EIS A;  4AKN A;  4KCX A;  4J0R A;  4NRA A;  5ENH A;  2YYN A;  2D82 A;  5KH3 A;  3V43 A;  5BT4 A;  5CUE A;  5D3S A;  4S3O B;  4TTE A;  5D3P A;  4KV1 A;  1WGM A;  3N9Q A;  1WEP A;  4A4C A;  4OGI A;  5CQ3 A;  5A83 A;  1G25 A;  5B79 A;  1N72 A;  4GPJ A;  5DBM A;  5CUD A;  4A9M A;  3C6W A;  4Z6I A;  5II1 A;  2OSS A;  5FEY A;  4LYI A;  5DKH A;  4V3L C;  5EI4 A;  4YAX A;  5F36 A;  3P1F A;  4BW2 A;  5KU3 A;  4HXN A;  4NR4 A;  2YHO A;  3SHB A;  5JWM A;  3NG2 A;  5D1M B;  3T7L A;  1U6G B;  4GNE A;  1JSP B;  4YAT A;  4N3W A;  5L8T A;  1VD4 A;  4KV4 A;  5A82 A;  5I83 A;  4C66 A;  4A9J A;  2R0S A;  5D3T A;  5IGM A;  5JI8 A;  4UYH A;  3U5L A;  4LYS A;  5A5P A;  5HLS A;  5DFC A;  1X0J A;  5HQ5 A;  2ECV A;  5LVQ A;  2DAT A;  4QC3 A;  2G45 A;  3ZPV E;  3QZS A;  4DON A;  5LJ1 A;  2K4D A;  4C9Z A;  1ZS5 A;  2MNY A;  5A5R A;  5LKU A;  5FFV A;  4QSS A;  4J3I A;  4O7F A;  2WP2 A;  5C13 A;  3S91 A;  5IBN A;  3RCW A;  4NXJ A;  3ONI A;  5CQ8 A;  2KFT A;  5G4R A;  1LDK C;  5D3R A;  4YYH A;  3LQH A;  4O72 A;  5D1K B;  4XUA A;  4UIT A;  4I7B A;  4YYN A;  5TCM A;  4NQM A;  5B78 A;  2K16 A;  5E3D A;  4ALG A;  4QR3 A;  2OUO A;  3JVJ A;  3SOX A;  5CQ7 A;  4A9L A;  4HXP A;  4GNG A;  4UYF B;  2K17 A;  1WES A;  3P1C A;  5L97 A;  5I88 A;  4LC2 A;  4AYC B;  4UIX A;  5E9V A;  5BT3 A;  3LRQ A;  3C5K A;  4IR3 A;  1DVP A;  5EP7 A;  4N4H A;  5CZG A;  5ENJ A;  3N9P A;  2YSJ A;  5C8G A;  4BW3 A;  5CQT A;  5DFD A;  4WHU A;  4PTB A;  2HYE D;  5A7C A;  5HFQ A;  4QSQ A;  5ENC A;  3HCS A;  5FE0 A;  5CQ4 A;  3DWY A;  4UIW A;  2EGP A;  2LXP C;  1F68 A;  2VP7 A;  4YC9 A;  2MA6 A;  2QJ0 A;  4WA6 A;  4ZUX U;  4UIZ A;  5D3N A;  2YUR A;  2FUI A;  5G04 B;  5ENG A;  3U5O A;  4YK0 A;  3ZYU A;  2LGL A;  3ZTG A;  2LSP B;  3HMH A;  2YW8 A;  4A49 A;  5CQ6 A;  5AD2 A;  3MB3 A;  2LGK A;  4QY4 A;  2BAY A;  4PCI A;  4LZR A;  2VPB A;  4YY4 A;  5K29 A;  3O33 A;  2N9G A;  3IU6 A;  2E6R A;  2EOD A;  4NRB A;  2RI7 A;  5FB1 A;  4BJX A;  4QST A;  5J0D A;  4XY9 A;  3U5K A;  4MVT A;  5FG6 A;  2YYR A;  2RS9 B;  2KWJ A;  2PUY A;  1EQF A;  4O76 A;  4CFL A;  2MD8 C;  5ENB A;  2PNX A;  3EB5 A;  5IGK A;  3ZYQ A;  4YYK A;  4HXR A;  3O70 A;  5CPE A;  2RNY A;  3UVW A;  5I29 A;  5FE8 A;  5I7X A;  5J3X A;  2KU3 A;  3M99 A;  4L7X A;  3O36 A;  3D7C A;  4LKA A;  5EWD A;  5FER A;  5F1H A;  5D1L B;  1FP0 A;  4IR6 A;  4IR4 A;  3L1X A;  4YAB A;  4QEU A;  5DFB A;  1K2F A;  4O75 A;  2L84 A;  2Y1M A;  2NXB A;  5I80 A;  3HCT A;  3M62 A;  5IG6 A;  2R10 A;  5KHM A;  4A0C D;  5DIN A;  2YSM A;  4I7C A;  3GL6 A;  5FE5 A;  4O64 A;  3U5N A;  5B76 A;  3UVX A;  4C67 A;  4WZ2 A;  4W4U A;  5HCL A;  5EWC A;  5CRM A;  4QF3 A;  4S3O C;  5DKA A;  4P5O B;  5H1T A;  5EGU A;  4NN2 A;  4UIV A;  4AUQ B;  4O77 A;  1X4U A;  4YYI A;  3JVM A;  5DYU A;  1Z2Q A;  1E4U A;  4MR4 A;  3U5M A;  4YYD A;  3SVF A;  1T1H A;  4PS5 A;  4GB0 A;  4I7D A;  5EYA F;  4AP4 A;  5FE1 A;  2CKL A;  2L85 A;  2G43 A;  5CTL A;  1HYJ A;  4QR5 A;  4ZW1 A;  4A4B A;  3I3J A;  4NUD A;  2FUU A;  4X3G A;  4R8P K;  5E7D A;  5EPR A;  4QSP A;  3N9M A;  4HXL A;  5FG5 A;  5HM0 A;  5G05 B;  2ECG A;  3KNV A;  3Q2E A;  5LKT A;  4J0S A;  2LDR A;  5F61 A;  4QYD A;  4XI1 A;  5DKD A;  3N9L A;  4YY6 A;  5KH7 A;  4TT6 A;  2H0D A;  3ZVY A;  2RNX A;  4MR5 A;  3TLP A;  2I7K A;  2Y1N A;  4FIP A;  5AIU A;  4TT2 A;  5DYC A;  4F3I A;  4OUF A;  2YW5 A;  1RMD A;  5E73 A;  3O37 A;  2HDP A;  3L1Z B;  4TZ8 A;  5CUA A;  2MJV B;  4MR3 A;  5AMF A;  4MEP A;  2KRE A;  2L75 A;  4ZDT A;  5DW2 A;  2UZG A;  2WP1 A;  4Z93 A;  5A5S A;  1HYI A;  5EVA A;  3MHS A;  4LYW A;  4O70 A;  5FFY A;  5DLZ A;  2MIQ A;  4CUT A;  5ACY A;  5A85 A;  2VJE A;  4QSV A;  4QNS A;  1WIL A;  3G0L A;  5B8D A;  4Z1S A;  4UYD A;  5KTU A;  4NR7 A;  3RPG C;  5KTW A;  5LJ0 A;  2M3H A;  1MM3 A;  3HME A;  4PCE A;  4YBM A;  2MA5 A;  5H1V A;  5HEN A;  2JMI A;  4QF2 A;  5FDZ A;  4ZC9 A;  2YQM A;  3L11 A;  2MD7 B;  5CUG A;  2KTB B;  2JRJ A;  5JG6 A;  4MSX A;  2XEU A;  4PPE A;  1WEE A;  4CLB A;  5E9L A;  4LZ2 A;  4TZ2 A;  3MQM A;  4XUB A;  5ENF A;  4IC3 A;  5ENE A;  4HBY A;  5AME A;  4CUP A;  5CS8 A;  4ALH A;  3SOU A;  2LV9 A;  5E0R A;  3SVH A;  3M63 A;  3O7A A;  2CT2 A;  2F6N A;  5II2 A;  3HCU A;  5CU8 A;  4Z1Q A;  3O35 A;  5F1L A;  3LQJ A;  3MUL A;  4QEW A;  3DPL R;  3MHH A;  5LJ2 A;  4YH3 A;  5TDR A;  4UYG A;  2KWN A;  1N87 A;  2E7O A;  4O71 A;  5CGP A;  5I1Q A;  3AQA A;  4QC1 A;  5L8U A;  2M1R A;  3U5J A;  2M85 A;  2KGG A;  4MEQ A;  2YRE A;  3S92 A;  5DLX A;  5G4S A;  5CY9 A;  2AN6 A;  4HXM A;  5C4Q A;  4QUT A;  2QIC A;  5I7Y A;  5A81 A;  1WUM A;  4YYG A;  4Q6F A;  3G0J A;  3ZPV 1;  3FKM X;  3UVY A;  1JM7 B;  4N4F A;  5D3L A;  3GG3 A;  5E9M A;  5I89 A;  5HQ6 A;  1WEN A;  2KWO A;  5FE6 A;  2DKW A;  1WEO A;  4B7Y C;  5EWH A;  5C85 A;  1CHC A;  5FB0 A;  3O34 A;  4RVR A;  5AIT A;  5D3J A;  2YHN A;  2RO1 A;  4X2I A;  5LKZ A;  4LR6 A;  4LAD B;  5EK9 A;  2YQD A;  4QSX A;  1LDJ B;  2FSA A;  4B86 C;  3N9N A;  4LDF A;  5I3L A;  5FG4 A;  2KR4 A;  2MNZ A;  2VPE A;  2CKL B;  2YQL A;  4NYX A;  3P1D A;  3ZNI A;  2EA6 A;  4O7C A;  4LZS A;  5C7N A;  4CL9 A;  3MXF A;  4TQN A;  5A5Q A;  4LJN A;  4NUE A;  2LQ6 A;  2KYU A;  4LK9 A;  1WEV A;  5LKX A;  2ZET C;  4FJC A;  3T6R A;  4BW4 A;  2GRC A;  3QZV A;  3P5O A;  4IOR A;  5IGN A;  2H0D B;  2MT5 A;  2OXQ C;  4Q0O A;  3PUR A;  3JVL A;  3FL2 A;  4PKL A;  4QUU A;  4CCG X;  4BHW A;  5CP5 A;  2RFJ A;  2YEL A;  4NR5 A;  5F63 A;  4QBM A;  4A9E A;  5I86 A;  1JOC A;  4CUR A;  5ETD A;  2VNF A;  2R0Y A;  4MEN A;  4NR6 A;  3PUQ A;  5KH9 A;  5E3G A;  1X4J A;  5LVR A;  3MUK A;  5HRX A;  4NR9 A;  3SOW A;  2DVS A;  1WEM A;  4V3K C;  4BW1 A;  4IOO A;  2YU4 A;  3ASL A;  3EB6 A;  4CUU A;  1Z60 A;  2VJE B;  5HFR A;  5EQ1 A;  2LRI C;  3IHP A;  4OGJ A;  1WIM A;  2D8S A;  5KO4 A;  3ZVZ B;  3UW9 A;  5FH7 A;  2L80 A;  5DKC A;  5DX4 A;  5TDW A;  5HEM A;  5CQA A;  4CFK A;  5ETB A;  1VYX A;  1WE9 A;  2VJF A;  5LCW B;  4BBQ A;  4QZS A;  2I50 A;  5F25 A;  5CQ5 A;  5D26 A;  4FLP A;  5D25 A;  4NRC A;  2H60 A;  4FO9 A;  2R0V A;  4HBV A;  2XB1 A;  5TB6 A;  3KV6 A;  2L43 A;  4A9H A;  5EWV A;  1X4I A;  2CSZ A;  1WFK A;  3HMF A;  5IID A;  4WZ3 B;  5HJC A;  1V87 A;  5BT5 A;  3AAD A;  2L5E A;  5EPB A;  1WEW A;  1ZBD B;  2ECW A;  4YYJ A;  5FH6 A;  4NYV A;  2DVV A;  5E9K A;  3LJW A;  3NXB A;  5CRZ A;  5ENI A;  4GNF A;  2LN0 A;  2CSY A;  2JMD A;  2NAA A;  5FE4 A;  1WUG A;  2LGG A;  4WHW A;  2D9E A;  3UV5 A;  4QSU A;  2KWK A;  4UP5 A;  2DVQ A;  2DX8 A;  4IR5 A;  1JM4 B;  1WEQ A;  4NUC A;  5C89 A;  4NS5 A;  4LLB A;  1WEU A;  5F60 A;  4HXK A;  1VFY A;  4YBS A;  3N9O A;  4MR6 A;  5EU1 A;  2VPG A;  4NR8 A;  2JMJ A;  4YBT A;  5EWW A;  1E6I A;  2RNW A;  5DYA A;  4AVX A;  5EV9 A;  3RPG B;  5D3H A;  5FE3 A;  2DVR A;  4IC2 A;  4A9K A;  4CUQ A;  4QSW A;  2YT5 A;  5EPS A;  3LQI A;  5E9Y A;  5HRW A;  2YEK A;  5IGL A;  4CUS A;  2ECT A;  4Y03 A;  5F3A A;  1IYM A;  3KQI A;  1Z6U A;  3IU5 A;  4N4I A;  5CUC A;  2M6M A;  4R7E A;  5HQ7 A;  4O7B A;  4O78 A;  3UVD A;  4N4G A;  2IDA A;  5E74 A;  2ECJ A;  4HXO A;  5B75 A;  5A5N A;  3DQV R;  5FBX A;  4QEV A;  4IOQ A;  4Z6H A;  4O7A A;  5AD3 A;  2Y43 A;  3JVK A;  4XY8 A;  4TT4 A;  4FK5 A;  5H1U A;  2F6J A;  3PHD A;  5HRV A;  4E96 A;  4O7E A;  2KE1 A;  2OO1 A;  5L96 A;  4YH4 A;  3K2J A;  3UV2 A;  4HBW A;  2QIZ A;  2MUM A;  2RSD A;  4UYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...