5H1TA

Complex structure of trim24 phd-bromodomain and inhibitor 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
172
Chain Sequence
NEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The polar warhead of a TRIM24 bromodomain inhibitor rearranges a water-mediated interaction network
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
molecule keywords Transcription intermediary factor 1-alpha
total genus 50
structure length 172
sequence length 182
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5h1tA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5h1tA01
4R8PK 5B77A 4LZRA 3LRQA 4ZUXU 4AUQB 4CA1A 2YQMA 2QICA 4LYWA 3D7CA 4MEQA 3MB3A 4YYGA 5I29A 1Z6UA 1EQFA 2DKWA 5KTWA 4A0CD 4HXNA 5DFBA 4A9LA 3JVKA 4DONA 5IIDA 2YW8A 2D9EA 4F3IA 1MM3A 5A81A 4BBQA 5DBMA 4QF2A 1E4UA 5F25A 3C5KA 1CHCA 4CCGX 2RNXA 5IGLA 5H85A 4O71A 3ASLA 4LZ2A 5HFRA 5B76A 5K29A 4GNDA 5JG6A 5CTLA 5D1MB 3Q2FA 3PURA 3O70A 3L1XA 5A83A 2KR4A 2LGVA 2YEKA 2E7NA 4J0SA 2YYNA 2LRIC 5CS8A 2WP2A 1LDKC 2LN0A 3ZPVE 4NR6A 4IR6A 5EPSA 5CGPA 5C85A 5LVQA 5A82A 3U5PA 4QSSA 2XB1A 5FE7A 2DX8A 5EISA 5TDRA 5FE0A 5IG6A 4Q0NA 3L1ZB 5EWHA 4YY4A 4MVTA 1WIMA 2LGGA 3MQMA 4HXSA 4L7XA 5DYXA 2G6QA 4QEVA 2G43A 4Q6FA 1E6IA 4NRAA 5F36A 2LXPC 5EYAF 2YURA 4QSRA 4MR3A 5I89A 2K16A 4YADA 5TRBA 1MM2A 4KV1A 2LGLA 4NRBA 2OSSA 4GNFA 5DW1A 2LGKA 2NXBA 4N4IA 5HRVA 2L5UA 2MA6A 5DFDA 5B79A 1ZBDB 5D25A 5E9IA 3QZSA 4A9IA 4QNSA 4TT6A 4BW2A 4YC9A 2Y1MA 4FK5A 4O7FA 2E3KA 4NQNA 4LLBA 4I7CA 5LKXA 2GRCA 4PY6A 4XY8A 2L43A 5F62A 5BT5A 3RCWA 3O33A 5ENGA 4AP4A 4C66A 5EU1A 3UW9A 2YUCA 3L11A 4IOQA 5CUGA 4YABA 5LKZA 1WESA 5A5QA 4UIXA 4UIYA 4QSTA 2DVQA 2R0SA 5I40A 4R7EA 4NYXA 4Z93A 2L84A 1T1HA 2M3HA 3SVHA 2M6MA 4A9FA 2KWJA 2VPGA 5D3RA 4Y03A 5DYCA 3JVJA 4ZW1A 3ZVYA 5KHMA 3NG2A 5I83A 4NR9A 3EB6A 4QSUA 2VP7A 4A49A 3MB4A 1WEUA 2ECGA 4A9HA 4YYHA 1Z2QA 5ENIA 4O75A 3JVMA 4MSXA 1WENA 4NUEA 4IC3A 1WFKA 5AMFA 2K17A 2DATA 5F5ZA 3MHSA 4I7DA 1Z60A 2FUUA 2QIZA 2Y43A 2PUYA 4XUAA 5FB0A 5CQ5A 3O34A 5D3TA 5D3NA 4YAXA 1X4UA 4TZ8A 2RI7A 2RO1A 5F63A 2C2VS 5EGUA 5G04B 5CUEA 3MXFA 1RMDA 5I80A 5CFWA 3C6WA 1DVPA 5I7XA 5L98A 5A85A 4E96A 4HXOA 4YY6A 5JI8A 3SOWA 4HBYA 4LYSA 4YBMA 2CKLB 1WUGA 2VPBA 3MULA 3M62A 2RS9B 3I3JA 2YW5A 5EA1A 5FDZA 2MJVB 4QC1A 5DKHA 5ENFA 5AD3A 2FUIA 4ALGA 3SVFA 3M63A 3V43A 1JSPB 3DAIA 4HBXA 5FG6A 3O36A 1VD4A 4PKLA 4QZSA 4YK0A 5E73A 5EV9A 3UVWA 1N87A 4XI1A 5KH7A 4UITA 4UIWA 5EICA 2KIZA 5L96A 2RNWA 2D8SA 2VNFA 5DKAA 3UVXA 3FL2A 2VJFB 5L8UA 5EVAA 4MENA 1WEQA 5F3AA 4O70A 1K2FA 4N4GA 4NR8A 4UIVA 5D3LA 5EWWA 5TABA 4QSQA 4TU6A 3LJWA 3I2DA 2NAAA 2ECWA 2G45A 5L97A 5IGNA 2F6NA 2YHOA 5B75A 4WZ0A 3UVYA 1WEMA 2OO1A 5C4QA 3S91A 3U5KA 1WGMA 4OGJA 4UYFB 5HFQA 4QSPA 3LQIA 5FH8A 2JRJA 2K1JA 5FE6A 5DYUA 2H0DB 5FB1A 4PS5A 4XUBA 4A9NA 1WEWA 2DVVA 4NUCA 4O77A 4TT2A 5G4SA 5DY7A 5L99A 5ENJA 4TU4A 2UZGA 5KH9A 3NXBA 4OUFA 4FLPA 5E7DA 5LKTA 1G25A 4NRCA 1WILA 4TT4A 2JMDA 3ZTGA 2KWOA 4LK9A 4A9OA 5HELA 1WEEA 2R10A 4YYDA 4TZ2A 4BW1A 3UVDA 2MA5A 2YSMA 5H1TA 4V3KC 3U5NA 4B86C 5EWCA 1F68A 5CUDA 4WZ3B 4AYCA 4UYGA 4FJCA 4CUQA 5EWVA 5KH3A 3QZVA 3P1EA 5LCWB 3RPGC 5E3GA 2Y1NA 4CUTA 5ENBA 5I1QA 4C67A 5TB6A 2KWNA 4GPJA 5I7YA 1FP0A 5JWMA 5C11A 4Q0OA 3N9OA 2N9GA 2ECVA 5DW2A 3G0LA 2LQ6A 4YH4A 2I50A 4P5OB 1VYXA 5DFCA 2QJ0A 4HXPA 4PCIA 3HCSA 2M1RA 5AMEA 4TKPB 3DQVR 4QB3A 3UV5A 4NR7A 4MEPA 2LXHC 4CFKA 4FO9A 4Z1SA 5D1LB 1X0JA 4RVRA 5CPEA 5ETDA 4O7EA 4WIVA 3U5OA 4UP0A 5C8GA 2YQLA 3N9MA 2BAYA 5DINA 4QYLA 5CQ7A 5E0RA 3LQJA 3SVGA 4TYLA 2ECTA 5LUUA 5FEYA 3PUQA 2D82A 5DKDA 2CSYA 4BJXA 2KGGA 4S3OC 5B8DA 4QUTA 4UYDA 3K2JA 4KV4A 5LKUA 3HCTA 3PHDA 5FBXA 4HBVA 5CQ6A 5E74A 5HLSA 2EGPA 5CRMA 4OGIA 2YREA 5C87A 4WHWA 2I7KA 4O74A 4N4FA 5A7CA 2L80A 5HCLA 4QC3A 5E9MA 3N9PA 4O78A 4LKAA 5LVRA 5D3JA 4N4HA 2YYRA 3SOUA 4CL9A 4IR3A 2YSJA 4AVXA 5H1VA 2RFJA 4YYNA 3UV2A 4IORA 4YBTA 2YDWA 3ZYQA 5EWDA 5AITA 5HQ7A 2F6JA 4NUDA 3AADA 5CQ3A 1LDJB 2DVRA 5J0DA 4HBWA 4QEWA 5ENHA 2ECNA 2M85A 5ENCA 5F2PA 5C7NA 2MNZA 3EB5A 5HENA 4J1PA 5CY9A 5F60A 5A5OA 5DLZA 1WE9A 3AQAA 4C9ZA 4WZ2A 4QR5A 1IYMA 2MNYA 3SHBA 5A5RA 4UYFA 2YT5A 4MR4A 4WHUA 4WA6A 5EP7A 3S92A 1VFYA 3ZPV1 4HXMA 2OUOA 5FG5A 2YHNA 5CQTA 5TBNA 2KYUA 2C2LA 4BHWA 5F61A 3ZYUA 5LJ0A 2L0BA 2VPEA 5FFWA 3M99A 5EQ1A 2KU3A 4IR5A 4O7BA 4L58A 2ZETC 2H60A 2VJFA 2VJEA 1ZS5A 5ENEA 5FG4A 1JM4B 3N9NA 5G4RA 5IGMA 5ETBA 3P1DA 2KFTA 3LXJA 4UIUA 1BORA 3KV5A 1WEVA 5EPBA 2FSAA 4NR5A 4UYHA 2HYED 2JMJA 4LADB 3DPLR 5TCMA 2K4DA 4O7AA 4XYAA 3O35A 2EODA 2LDRA 4UIZA 3IU6A 3GV4A 2CKLA 4J0RA 4O76A 3U5MA 5FH6A 2CSZA 3HMFA 4A4CA 2MUMA 5CU8A 3LQHA 5FERA 4GNEA 1HYJA 4QY4A 5D3PA 3U5JA 2KWKA 2G4AA 3QZTA 2LSPB 2KTBB 4QR4A 5DX4A 5FE3A 5KTXA 3FKMX 5D7XA 4S3OB 3MUKA 5F1LA 2R0YA 5G05B 1FBVA 4LR6A 4IR4A 5CUAA 1JM7B 5E9LA 4HXKA 2PNXA 2OXQC 4LYIA 5DKCA 2MD7B 3RPGB 3O37A 4AYCB 4IOOA 4XY9A 2I8NA 5DLXA 4Z1QA 5COIA 3KNVA 4I7BA 1JM7A 5HM0A 1X4JA 5A5PA 4YYKA 1WEPA 3HTKC 5HQ5A 4UYEA 4NN2A 4ZDTA 5CRZA 4ZQLA 5E9VA 5ACYA 1V87A 4NYVA 4AKNA 2AN6A 4V3LC 4B7YC 5FFYA 2YQDA 5H1UA 1XWHA 4GB0A 2DVSA 5FE9A 3RTRB 1U6GB 5D1KB 4BW4A 4QF3A 5B78A 3ZVZB 3DWYA 4NQMA 2E6SA 3O7AA 2DWWA 3ONIA 4A9EA 1WUMA 5F1HA 2L85A 5HRWA 4QBMA 4NS5A 3U5LA 4Z6IA 2CT2A 4KCXA 5CQ4A 4R2YA 5IBNA 2YELA 2IDAA 2VJEB 4UI9B 4O7CA 2E6RA 5E9KA 3T6RA 5D3SA 4TQNA 2MIQA 4YYIA 4LJNA 3Q2EA 2LV9A 4Z6HA 4A9JA 5LJ2A 5CQAA 5EM3A 4ALHA 2ECJA 4MEOA 4QR3A 5EPRA 3TLPA 3SOXA 3UV4A 5FE5A 5EI4A 3ZNIA 5HQ6A 3KQIA 4QSWA 4YATA 2F42A 4N3WA 5EK9A 3P1FA 4CUUA 2KE1A 5KTUA 1JOCA 1F62A 3P5OA 4A4BA 2L75A 4QYDA 2VPDA 3KV6A 2R0VA 4UP5A 5CP5A 5G0FA 4X3GA 5D24A 5HRXA 4LDFA 4MR5A 5CZGA 2YU4A 3N9QA 5CUBA 3GL6A 3HMEA 4PTBA 4HXRA 5CUCA 5TDWA 3GG3A 4QSXA 4YYMA 3HCUA 5AIUA 4J3IA 2H0DA 5AD2A 4YBSA 3P1CA 5BT4A 3N9LA 5FE2A 2EA6A 5FE8A 4BW3A 5FE4A 5HEMA 5II2A 5D3HA 2KREA 4MR6A 5A5SA 2KGIA 4O72A 1N72A 3JVLA 4TTEA 5CQ8A 2RNYA 5D0CA 3MHHA 5KU3A 2JMIA 4F52B 4QEUA 4HXLA 2ECIA 5D26A 3T7LA 5E9YA 4X2IA 5BT3A 4QUUA 4IC2A 5LJ1A 2MD8C 5I86A 4ZC9A 4QSVA 5HJCA 4CFLA 4YYJA 2YEMA 2E7OA 3G0JA 4A9KA 4CURA 4NXJA 2L5EA 2WP1A 4LC2A 5C89A 4CLBA 2XEUA 4NYWA 3IU5A 4TS8A 5H9MA 3IHPA 5DYAA 1WEOA 4PCEA 4PPEA 5I3LA 4O64A 4CUPA 5I88A 4LRGA 5L8TA 4FIPA 4GNGA 4W4UA 2HDPA 4LZSA 1X4IA 5J3XA 5C13A 5IGKA 5A5NA 1HYIA 5FFVA 5FH7A 3HMHA 4NR4A 5II1A 2RSDA 5E3DA 2MT5A 4YH3A 5FE1A 4CUSA 4A9MA 5KO4A 3VK6A
chains in the Genus database with same CATH superfamily
4R8PK 5B77A 4LZRA 3LRQA 4ZUXU 4AUQB 4CA1A 2YQMA 2QICA 4LYWA 3D7CA 4MEQA 3MB3A 4YYGA 5I29A 1Z6UA 1EQFA 2DKWA 5KTWA 4A0CD 4HXNA 5DFBA 4A9LA 3JVKA 4DONA 5IIDA 2YW8A 2D9EA 4F3IA 1MM3A 5A81A 3VKHA 5DBMA 4QF2A 1E4UA 5F25A 3C5KA 4Z0OA 1CHCA 4CCGX 2RNXA 5IGLA 5H85A 4O71A 3ASLA 4LZ2A 5HFRA 5B76A 5K29A 4GNDA 5JG6A 4AKIA 5CTLA 2JM3A 5D1MB 3Q2FA 3PURA 3O70A 3L1XA 5A83A 3LVRE 2KR4A 2LGVA 2YEKA 2MKEA 2E7NA 4J0SA 2YYNA 2LRIC 5CS8A 2WP2A 1LDKC 2LN0A 3ZPVE 3VKGA 4NR6A 4IR6A 5EPSA 5CGPA 5C85A 5LVQA 4OGEA 5A82A 3U5PA 4QSSA 2XB1A 5FE7A 2DX8A 5EISA 5TDRA 5FE0A 5IG6A 4Q0NA 3L1ZB 4AKHA 5EWHA 4YY4A 3D1DA 4MVTA 1WIMA 2LGGA 3MQMA 4HXSA 4L7XA 5DYXA 2DJAA 3FANA 2G6QA 4QEVA 2G43A 1PUOA 4Q6FA 1E6IA 4NRAA 5F36A 2LXPC 5EYAF 2YURA 4QSRA 4MR3A 5I89A 2K16A 4YADA 5TRBA 1MM2A 4KV1A 2LGLA 4NRBA 2OSSA 4GNFA 5DW1A 2LGKA 2NXBA 4N4IA 5HRVA 2L5UA 2MA6A 5DFDA 2CRWA 5B79A 1ZBDB 5D25A 5E9IA 3QZSA 4A9IA 4QNSA 2M13A 4TT6A 4BW2A 4YC9A 2Y1MA 4FK5A 4O7FA 2E3KA 4NQNA 4LLBA 4I7CA 5LKXA 2GRCA 4PY6A 4XY8A 2L43A 3PLWA 2IQJA 5F62A 5BT5A 3RCWA 2EXUA 3O33A 5ENGA 4AP4A 4H9DA 4C66A 5EU1A 3UW9A 2YUCA 3JUEA 3L11A 4Z0RA 4IOQA 5CUGA 4YABA 5LKZA 1WESA 3FEHA 3LVQE 5A5QA 4UIXA 4UIYA 4QSTA 2DVQA 2R0SA 5I40A 4R7EA 4NYXA 4Z93A 2L84A 1T1HA 2M3HA 3SVHA 2M6MA 4A9FA 2KWJA 2VPGA 5D3RA 4Y03A 5DYCA 3JVJA 3FAOA 4ZW1A 3ZVYA 5KHMA 3NG2A 5I83A 4NR9A 3EB6A 4QSUA 2VP7A 4A49A 3MB4A 1WEUA 2ECGA 4A9HA 4YYHA 1Z2QA 5ENIA 4O75A 3JVMA 4MSXA 1WENA 2FD4A 4NUEA 4IC3A 1WFKA 5AMFA 2K17A 2DATA 5SVYA 5F5ZA 3MHSA 4I7DA 1Z60A 2FUUA 2QIZA 2Y43A 2PUYA 4XUAA 5FB0A 5CQ5A 3O34A 5D3TA 5D3NA 4YAXA 1X4UA 4TZ8A 2RI7A 2RO1A 5F63A 2C2VS 5EGUA 5G04B 5CUEA 3MXFA 1RMDA 5I80A 5CFWA 3C6WA 1DVPA 5I7XA 5L98A 5A85A 4E96A 2B0OE 4HXOA 4YY6A 5JI8A 2CSVA 3SOWA 4HBYA 4LYSA 4YBMA 2CKLB 1WUGA 2VPBA 3MULA 3M62A 2RS9B 3I3JA 2YW5A 5EA1A 5FDZA 2MJVB 4QC1A 5DKHA 5ENFA 5AD3A 2FUIA 4ALGA 3SVFA 3DWDA 3M63A 3V43A 1JSPB 3DAIA 4HBXA 5FG6A 3O36A 1VD4A 4PKLA 4QZSA 4YK0A 5E73A 5EV9A 3UVWA 1N87A 4XI1A 5KH7A 4UITA 4UIWA 5EICA 2KIZA 5L96A 2RNWA 2D8SA 2VNFA 5DKAA 3UVXA 3FL2A 2VJFB 5L8UA 5EVAA 4MENA 1WEQA 5F3AA 4O70A 1K2FA 4N4GA 4NR8A 4UIVA 5D3LA 5EWWA 5TABA 4QSQA 4TU6A 3LJWA 3I2DA 2NAAA 2ECWA 2G45A 5L97A 5IGNA 2F6NA 2YHOA 5B75A 4WZ0A 3UVYA 1WEMA 2OO1A 5C4QA 3S91A 3U5KA 1WGMA 4OGJA 4UYFB 5HFQA 4QSPA 3LQIA 5FH8A 2JRJA 2K1JA 5FE6A 5DYUA 2H0DB 5FB1A 4PS5A 4XUBA 4A9NA 1WEWA 2DVVA 4NUCA 4O77A 4TT2A 5G4SA 5DY7A 5L99A 5ENJA 4TU4A 2UZGA 5KH9A 3NXBA 4OUFA 4FLPA 5E7DA 5LKTA 1G25A 4NRCA 1WILA 4TT4A 4AKGA 2JMDA 3ZTGA 2KWOA 4LK9A 3H7HA 4A9OA 5HELA 1WEEA 2R10A 4YYDA 4TZ2A 4BW1A 3UVDA 3KDEC 2MA5A 2YSMA 5H1TA 4V3KC 3U5NA 2EGMA 4B86C 5EWCA 1F68A 2YVRA 2KKXA 5CUDA 4WZ3B 4AYCA 4UYGA 4FJCA 4CUQA 5EWVA 5KH3A 3QZVA 3P1EA 2XP0A 5LCWB 5E3GA 2Y1NA 3RPGC 4CUTA 5ENBA 5I1QA 4C67A 2CRRA 5TB6A 2KWNA 4GPJA 5I7YA 1FP0A 5JWMA 5C11A 3Q1DA 4Q0OA 3N9OA 1MBMA 2N9GA 2ECVA 5DW2A 3G0LA 2LQ6A 4YH4A 2DSMA 2I50A 4P5OB 1VYXA 5DFCA 2QJ0A 4HXPA 4PCIA 3HCSA 2M1RA 5AMEA 4TKPB 5SVXA 3DQVR 4QB3A 3UV5A 4NR7A 4MEPA 2LXHC 4OGCA 4CFKA 4FO9A 4Z1SA 5D1LB 1X0JA 4RVRA 2JUNA 5CPEA 5ETDA 4O7EA 4WIVA 3U5OA 4UP0A 5C8GA 2YQLA 2FFWA 3N9MA 2BAYA 5DINA 4BBQA 4QYLA 5CQ7A 5E0RA 3LQJA 3SVGA 4TYLA 2ECTA 5LUUA 5FEYA 3PUQA 2D82A 5DKDA 2CSYA 4BJXA 2KGGA 4S3OC 5SVIB 4QUTA 4UYDA 3K2JA 4KV4A 5LKUA 3DDTA 3HCTA 3PHDA 5B8DA 4O62A 5FBXA 4HBVA 5CQ6A 5E74A 5HLSA 2EGPA 5CRMA 4OGIA 2YREA 5C87A 4WHWA 3SUBA 2I7KA 4O74A 4N4FA 5A7CA 2L80A 3M7KA 5HCLA 4QC3A 5E9MA 3N9PA 4O78A 4LKAA 5LVRA 5D3JA 4N4HA 2YYRA 3SOUA 4CL9A 4IR3A 2YSJA 4AVXA 5H1VA 2RFJA 4YYNA 3UV2A 4IORA 4YBTA 2YDWA 3ZYQA 3ERRA 4AI6A 5EWDA 5AITA 5HQ7A 2F6JA 4NUDA 3AADA 5CQ3A 1LDJB 2DVRA 5J0DA 4HBWA 4QEWA 5ENHA 2ECNA 2M85A 5ENCA 5F2PA 5C7NA 2MNZA 3EB5A 5HENA 4J1PA 5CY9A 5F60A 5A5OA 5DLZA 1WE9A 3AQAA 4C9ZA 4WZ2A 4QR5A 1IYMA 2MNYA 3SHBA 5A5RA 4UYFA 2YT5A 4MR4A 4WHUA 3LJUX 4WA6A 5EP7A 3S92A 3LDYA 1VFYA 3ZPV1 4HXMA 2OUOA 5FG5A 2YHNA 5CQTA 5TBNA 2KYUA 2C2LA 4BHWA 5F61A 3ZYUA 5LJ0A 2L0BA 2VPEA 5FFWA 3M99A 5EQ1A 2KU3A 4IR5A 4O7BA 4L58A 2ZETC 2H60A 2VJFA 2VJEA 1ZS5A 5ENEA 5FG4A 1JM4B 3N9NA 5G4RA 5IGMA 5ETBA 3P1DA 2KFTA 3LXJA 4UIUA 1BORA 3KV5A 1WEVA 5EPBA 2FSAA 4NR5A 4UYHA 2HYED 2JMJA 4LADB 3DPLR 5TCMA 4QQ4A 2K4DA 4O7AA 4XYAA 3O35A 2EODA 2LDRA 4UIZA 3IU6A 3GV4A 2CKLA 4J0RA 4O76A 3U5MA 5FH6A 2CSZA 3HMFA 4A4CA 2MUMA 5CU8A 3LQHA 2OWAA 4GNEA 2L7PA 5FERA 1HYJA 4QY4A 5D3PA 3U5JA 2KWKA 2G4AA 3QZTA 2LSPB 2KTBB 4QR4A 5DX4A 5FE3A 5KTXA 3FKMX 5D7XA 4S3OB 3MUKA 5F1LA 2R0YA 5G05B 1FBVA 3FJUB 4LR6A 4IR4A 5CUAA 1JM7B 3O47A 5E9LA 4HXKA 2PNXA 2OXQC 4LYIA 5DKCA 2MD7B 3RPGB 3O37A 4AYCB 4IOOA 4XY9A 2I8NA 5DLXA 4Z1QA 5COIA 3KNVA 4I7BA 1JM7A 5HM0A 1X4JA 5A5PA 4YYKA 1WEPA 3HTKC 5HQ5A 2KKYA 4UYEA 4NN2A 4ZDTA 5CRZA 5SVIA 4ZQLA 5E9VA 5ACYA 1V87A 4NYVA 4AKNA 2AN6A 2RR4A 4V3LC 4B7YC 5FFYA 3E2DA 2YQDA 5H1UA 1XWHA 4GB0A 2DVSA 5FE9A 3RTRB 1U6GB 5D1KB 4BW4A 4QF3A 5B78A 3ZVZB 3DWYA 4NQMA 2E6SA 3O7AA 2DWWA 3ONIA 4A9EA 2LAUA 1WUMA 5F1HA 2L85A 5HRWA 4QBMA 4NS5A 3U5LA 4Z6IA 2CT2A 4KCXA 5CQ4A 4R2YA 5IBNA 2YELA 2IDAA 2VJEB 4UI9B 4O7CA 2E6RA 5E9KA 3D1BA 5D3SA 1DCQA 3T6RA 5K3QA 4TQNA 2MIQA 4YYIA 3FM8C 4LJNA 3Q2EA 2LV9A 4Z6HA 4A9JA 2XOZA 5LJ2A 5CQAA 5EM3A 4ALHA 2ECJA 4MEOA 4QR3A 5EPRA 3TLPA 3SOXA 3UV4A 5FE5A 5EI4A 3ZNIA 5HQ6A 3KQIA 4QSWA 4YATA 2CONA 4N3WA 2EJNA 3P1FA 5EK9A 4CUUA 2F42A 2KE1A 5KTUA 1JOCA 1F62A 3P5OA 4A4BA 2L75A 4QYDA 2VPDA 3KV6A 2R0VA 4UP5A 5CP5A 5G0FA 4X3GA 5D24A 1ZKRA 4LDFA 5HRXA 4MR5A 5CZGA 2YU4A 2D8UA 3N9QA 5CUBA 3GL6A 3HMEA 4PTBA 4HXRA 5CUCA 5TDWA 3GG3A 4QSXA 4YYMA 3HCUA 5AIUA 4J3IA 2H0DA 5AD2A 4YBSA 3P1CA 5BT4A 3N9LA 5FE2A 2EA6A 5FE8A 2XOCA 4BW3A 5FE4A 5HEMA 5II2A 5D3HA 2KREA 4MR6A 5A5SA 2KGIA 4O72A 1N72A 3JVLA 4TTEA 5CQ8A 2RNYA 5D0CA 3MHHA 5KU3A 2JMIA 4F1PA 4F52B 4QEUA 2P57A 4HXLA 2ECIA 5D26A 3T7LA 2XOYA 5E9YA 4X2IA 5BT3A 4QUUA 4IC2A 5LJ1A 2MD8C 5I86A 4ZC9A 4QSVA 5HJCA 4CFLA 4YYJA 2YEMA 2E7OA 3G0JA 4A9KA 4CURA 4NXJA 2L5EA 2WP1A 4LC2A 5C89A 4CLBA 2XEUA 4NYWA 3IU5A 4TS8A 5H9MA 3IHPA 5DYAA 1WEOA 4PCEA 4PPEA 3T9KA 5I3LA 4O64A 4CUPA 5I88A 4LRGA 5L8TA 4FIPA 4GNGA 4W4UA 2HDPA 4LZSA 1X4IA 5J3XA 5C13A 5IGKA 2E61A 5A5NA 1HYIA 5FFVA 5FH7A 3HMHA 3MDBC 4NR4A 5II1A 2RSDA 5E3DA 2MT5A 4YH3A 5FE1A 4CUSA 4A9MA 5KO4A 3VK6A
chains in the Genus database with same CATH topology
4R8PK 5B77A 4LZRA 3LRQA 4ZUXU 4AUQB 4CA1A 2YQMA 2QICA 4LYWA 3D7CA 4MEQA 3MB3A 4YYGA 5I29A 1Z6UA 1EQFA 2DKWA 5KTWA 4A0CD 4HXNA 5DFBA 4A9LA 3JVKA 4DONA 5IIDA 2YW8A 2D9EA 4F3IA 1MM3A 5A81A 4BBQA 5DBMA 4QF2A 1E4UA 5F25A 3C5KA 1CHCA 4CCGX 2RNXA 5IGLA 5H85A 4O71A 3ASLA 4LZ2A 5HFRA 5B76A 5K29A 4GNDA 5JG6A 5CTLA 5D1MB 3Q2FA 3PURA 3O70A 3L1XA 5A83A 2KR4A 2LGVA 2YEKA 2E7NA 4J0SA 2YYNA 2LRIC 5CS8A 2WP2A 1LDKC 2LN0A 3ZPVE 4NR6A 4IR6A 5EPSA 5CGPA 5C85A 5LVQA 5A82A 3U5PA 4QSSA 2XB1A 5FE7A 2DX8A 5EISA 5TDRA 5FE0A 5IG6A 4Q0NA 3L1ZB 5EWHA 4YY4A 4MVTA 1WIMA 2LGGA 3MQMA 4HXSA 4L7XA 5DYXA 2G6QA 4QEVA 2G43A 4Q6FA 1E6IA 4NRAA 5F36A 2LXPC 5EYAF 2YURA 4QSRA 4MR3A 5I89A 2K16A 4YADA 5TRBA 1MM2A 4KV1A 2LGLA 4NRBA 2OSSA 4GNFA 5DW1A 2LGKA 2NXBA 4N4IA 5HRVA 2L5UA 2MA6A 5DFDA 5B79A 1ZBDB 5D25A 5E9IA 3QZSA 4A9IA 4QNSA 4TT6A 4BW2A 4YC9A 2Y1MA 4FK5A 4O7FA 2E3KA 4NQNA 4LLBA 4I7CA 5LKXA 2GRCA 4PY6A 4XY8A 2L43A 5F62A 5BT5A 3RCWA 3O33A 5ENGA 4AP4A 4C66A 5EU1A 3UW9A 2YUCA 3L11A 4IOQA 5CUGA 4YABA 5LKZA 1WESA 5A5QA 4UIXA 4UIYA 4QSTA 2DVQA 2R0SA 5I40A 4R7EA 4NYXA 4Z93A 2L84A 1T1HA 2M3HA 3SVHA 2M6MA 4A9FA 2KWJA 2VPGA 5D3RA 4Y03A 5DYCA 3JVJA 4ZW1A 3ZVYA 5KHMA 3NG2A 5I83A 4NR9A 3EB6A 4QSUA 2VP7A 4A49A 3MB4A 1WEUA 2ECGA 4A9HA 4YYHA 1Z2QA 5ENIA 4O75A 3JVMA 4MSXA 1WENA 4NUEA 4IC3A 1WFKA 5AMFA 2K17A 2DATA 5F5ZA 3MHSA 4I7DA 1Z60A 2FUUA 2QIZA 2Y43A 2PUYA 4XUAA 5FB0A 5CQ5A 3O34A 5D3TA 5D3NA 4YAXA 1X4UA 4TZ8A 2RI7A 2RO1A 5F63A 2C2VS 5EGUA 5G04B 5CUEA 3MXFA 1RMDA 5I80A 5CFWA 3C6WA 1DVPA 5I7XA 5L98A 5A85A 4E96A 4HXOA 4YY6A 5JI8A 3SOWA 4HBYA 4LYSA 4YBMA 2CKLB 1WUGA 2VPBA 3MULA 3M62A 2RS9B 3I3JA 2YW5A 5EA1A 5FDZA 2MJVB 4QC1A 5DKHA 5ENFA 5AD3A 2FUIA 4ALGA 3SVFA 3M63A 3V43A 1JSPB 3DAIA 4HBXA 5FG6A 3O36A 1VD4A 4PKLA 4QZSA 4YK0A 5E73A 5EV9A 3UVWA 1N87A 4XI1A 5KH7A 4UITA 4UIWA 5EICA 2KIZA 5L96A 2RNWA 2D8SA 2VNFA 5DKAA 3UVXA 3FL2A 2VJFB 5L8UA 5EVAA 4MENA 1WEQA 5F3AA 4O70A 1K2FA 4N4GA 4NR8A 4UIVA 5D3LA 5EWWA 5TABA 4QSQA 4TU6A 3LJWA 3I2DA 2NAAA 2ECWA 2G45A 5L97A 5IGNA 2F6NA 2YHOA 5B75A 4WZ0A 3UVYA 1WEMA 2OO1A 5C4QA 3S91A 3U5KA 1WGMA 4OGJA 4UYFB 5HFQA 4QSPA 3LQIA 5FH8A 2JRJA 2K1JA 5FE6A 5DYUA 2H0DB 5FB1A 4PS5A 4XUBA 4A9NA 1WEWA 2DVVA 4NUCA 4O77A 4TT2A 5G4SA 5DY7A 5L99A 5ENJA 4TU4A 2UZGA 5KH9A 3NXBA 4OUFA 4FLPA 5E7DA 5LKTA 1G25A 4NRCA 1WILA 4TT4A 2JMDA 3ZTGA 2KWOA 4LK9A 4A9OA 5HELA 1WEEA 2R10A 4YYDA 4TZ2A 4BW1A 3UVDA 2MA5A 2YSMA 5H1TA 4V3KC 3U5NA 4B86C 5EWCA 1F68A 5CUDA 4WZ3B 4AYCA 4UYGA 4FJCA 4CUQA 5EWVA 5KH3A 3QZVA 3P1EA 5LCWB 3RPGC 5E3GA 2Y1NA 4CUTA 5ENBA 5I1QA 4C67A 5TB6A 2KWNA 4GPJA 5I7YA 1FP0A 5JWMA 5C11A 4Q0OA 3N9OA 2N9GA 2ECVA 5DW2A 3G0LA 2LQ6A 4YH4A 2I50A 4P5OB 1VYXA 5DFCA 2QJ0A 4HXPA 4PCIA 3HCSA 2M1RA 5AMEA 4TKPB 3DQVR 4QB3A 3UV5A 4NR7A 4MEPA 2LXHC 4CFKA 4FO9A 4Z1SA 5D1LB 1X0JA 4RVRA 5CPEA 5ETDA 4O7EA 4WIVA 3U5OA 4UP0A 5C8GA 2YQLA 3N9MA 2BAYA 5DINA 4QYLA 5CQ7A 5E0RA 3LQJA 3SVGA 4TYLA 2ECTA 5LUUA 5FEYA 3PUQA 2D82A 5DKDA 2CSYA 4BJXA 2KGGA 4S3OC 5B8DA 4QUTA 4UYDA 3K2JA 4KV4A 5LKUA 3HCTA 3PHDA 5FBXA 4HBVA 5CQ6A 5E74A 5HLSA 2EGPA 5CRMA 4OGIA 2YREA 5C87A 4WHWA 2I7KA 4O74A 4N4FA 5A7CA 2L80A 5HCLA 4QC3A 5E9MA 3N9PA 4O78A 4LKAA 5LVRA 5D3JA 4N4HA 2YYRA 3SOUA 4CL9A 4IR3A 2YSJA 4AVXA 5H1VA 2RFJA 4YYNA 3UV2A 4IORA 4YBTA 2YDWA 3ZYQA 5EWDA 5AITA 5HQ7A 2F6JA 4NUDA 3AADA 5CQ3A 1LDJB 2DVRA 5J0DA 4HBWA 4QEWA 5ENHA 2ECNA 2M85A 5ENCA 5F2PA 5C7NA 2MNZA 3EB5A 5HENA 4J1PA 5CY9A 5F60A 5A5OA 5DLZA 1WE9A 3AQAA 4C9ZA 4WZ2A 4QR5A 1IYMA 2MNYA 3SHBA 5A5RA 4UYFA 2YT5A 4MR4A 4WHUA 4WA6A 5EP7A 3S92A 1VFYA 3ZPV1 4HXMA 2OUOA 5FG5A 2YHNA 5CQTA 5TBNA 2KYUA 2C2LA 4BHWA 5F61A 3ZYUA 5LJ0A 2L0BA 2VPEA 5FFWA 3M99A 5EQ1A 2KU3A 4IR5A 4O7BA 4L58A 2ZETC 2H60A 2VJFA 2VJEA 1ZS5A 5ENEA 5FG4A 1JM4B 3N9NA 5G4RA 5IGMA 5ETBA 3P1DA 2KFTA 3LXJA 4UIUA 1BORA 3KV5A 1WEVA 5EPBA 2FSAA 4NR5A 4UYHA 2HYED 2JMJA 4LADB 3DPLR 5TCMA 2K4DA 4O7AA 4XYAA 3O35A 2EODA 2LDRA 4UIZA 3IU6A 3GV4A 2CKLA 4J0RA 4O76A 3U5MA 5FH6A 2CSZA 3HMFA 4A4CA 2MUMA 5CU8A 3LQHA 5FERA 4GNEA 1HYJA 4QY4A 5D3PA 3U5JA 2KWKA 2G4AA 3QZTA 2LSPB 2KTBB 4QR4A 5DX4A 5FE3A 5KTXA 3FKMX 5D7XA 4S3OB 3MUKA 5F1LA 2R0YA 5G05B 1FBVA 4LR6A 4IR4A 5CUAA 1JM7B 5E9LA 4HXKA 2PNXA 2OXQC 4LYIA 5DKCA 2MD7B 3RPGB 3O37A 4AYCB 4IOOA 4XY9A 2I8NA 5DLXA 4Z1QA 5COIA 3KNVA 4I7BA 1JM7A 5HM0A 1X4JA 5A5PA 4YYKA 1WEPA 3HTKC 5HQ5A 4UYEA 4NN2A 4ZDTA 5CRZA 4ZQLA 5E9VA 5ACYA 1V87A 4NYVA 4AKNA 2AN6A 4V3LC 4B7YC 5FFYA 2YQDA 5H1UA 1XWHA 4GB0A 2DVSA 5FE9A 3RTRB 1U6GB 5D1KB 4BW4A 4QF3A 5B78A 3ZVZB 3DWYA 4NQMA 2E6SA 3O7AA 2DWWA 3ONIA 4A9EA 1WUMA 5F1HA 2L85A 5HRWA 4QBMA 4NS5A 3U5LA 4Z6IA 2CT2A 4KCXA 5CQ4A 4R2YA 5IBNA 2YELA 2IDAA 2VJEB 4UI9B 4O7CA 2E6RA 5E9KA 3T6RA 5D3SA 4TQNA 2MIQA 4YYIA 4LJNA 3Q2EA 2LV9A 4Z6HA 4A9JA 5LJ2A 5CQAA 5EM3A 4ALHA 2ECJA 4MEOA 4QR3A 5EPRA 3TLPA 3SOXA 3UV4A 5FE5A 5EI4A 3ZNIA 5HQ6A 3KQIA 4QSWA 4YATA 2F42A 4N3WA 5EK9A 3P1FA 4CUUA 2KE1A 5KTUA 1JOCA 1F62A 3P5OA 4A4BA 2L75A 4QYDA 2VPDA 3KV6A 2R0VA 4UP5A 5CP5A 5G0FA 4X3GA 5D24A 5HRXA 4LDFA 4MR5A 5CZGA 2YU4A 3N9QA 5CUBA 3GL6A 3HMEA 4PTBA 4HXRA 5CUCA 5TDWA 3GG3A 4QSXA 4YYMA 3HCUA 5AIUA 4J3IA 2H0DA 5AD2A 4YBSA 3P1CA 5BT4A 3N9LA 5FE2A 2EA6A 5FE8A 4BW3A 5FE4A 5HEMA 5II2A 5D3HA 2KREA 4MR6A 5A5SA 2KGIA 4O72A 1N72A 3JVLA 4TTEA 5CQ8A 2RNYA 5D0CA 3MHHA 5KU3A 2JMIA 4F52B 4QEUA 4HXLA 2ECIA 5D26A 3T7LA 5E9YA 4X2IA 5BT3A 4QUUA 4IC2A 5LJ1A 2MD8C 5I86A 4ZC9A 4QSVA 5HJCA 4CFLA 4YYJA 2YEMA 2E7OA 3G0JA 4A9KA 4CURA 4NXJA 2L5EA 2WP1A 4LC2A 5C89A 4CLBA 2XEUA 4NYWA 3IU5A 4TS8A 5H9MA 3IHPA 5DYAA 1WEOA 4PCEA 4PPEA 5I3LA 4O64A 4CUPA 5I88A 4LRGA 5L8TA 4FIPA 4GNGA 4W4UA 2HDPA 4LZSA 1X4IA 5J3XA 5C13A 5IGKA 5A5NA 1HYIA 5FFVA 5FH7A 3HMHA 4NR4A 5II1A 2RSDA 5E3DA 2MT5A 4YH3A 5FE1A 4CUSA 4A9MA 5KO4A 3VK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P K;  5B77 A;  4LZR A;  3LRQ A;  4ZUX U;  4AUQ B;  4CA1 A;  2YQM A;  2QIC A;  4LYW A;  3D7C A;  4MEQ A;  3MB3 A;  4YYG A;  5I29 A;  1Z6U A;  1EQF A;  2DKW A;  5KTW A;  4A0C D;  4HXN A;  5DFB A;  4A9L A;  3JVK A;  4DON A;  5IID A;  2YW8 A;  2D9E A;  4F3I A;  1MM3 A;  5A81 A;  4BBQ A;  5DBM A;  4QF2 A;  1E4U A;  5F25 A;  3C5K A;  1CHC A;  4CCG X;  2RNX A;  5IGL A;  5H85 A;  4O71 A;  3ASL A;  4LZ2 A;  5HFR A;  5B76 A;  5K29 A;  4GND A;  5JG6 A;  5CTL A;  5D1M B;  3Q2F A;  3PUR A;  3O70 A;  3L1X A;  5A83 A;  2KR4 A;  2LGV A;  2YEK A;  2E7N A;  4J0S A;  2YYN A;  2LRI C;  5CS8 A;  2WP2 A;  1LDK C;  2LN0 A;  3ZPV E;  4NR6 A;  4IR6 A;  5EPS A;  5CGP A;  5C85 A;  5LVQ A;  5A82 A;  3U5P A;  4QSS A;  2XB1 A;  5FE7 A;  2DX8 A;  5EIS A;  5TDR A;  5FE0 A;  5IG6 A;  4Q0N A;  3L1Z B;  5EWH A;  4YY4 A;  4MVT A;  1WIM A;  2LGG A;  3MQM A;  4HXS A;  4L7X A;  5DYX A;  2G6Q A;  4QEV A;  2G43 A;  4Q6F A;  1E6I A;  4NRA A;  5F36 A;  2LXP C;  5EYA F;  2YUR A;  4QSR A;  4MR3 A;  5I89 A;  2K16 A;  4YAD A;  5TRB A;  1MM2 A;  4KV1 A;  2LGL A;  4NRB A;  2OSS A;  4GNF A;  5DW1 A;  2LGK A;  2NXB A;  4N4I A;  5HRV A;  2L5U A;  2MA6 A;  5DFD A;  5B79 A;  1ZBD B;  5D25 A;  5E9I A;  3QZS A;  4A9I A;  4QNS A;  4TT6 A;  4BW2 A;  4YC9 A;  2Y1M A;  4FK5 A;  4O7F A;  2E3K A;  4NQN A;  4LLB A;  4I7C A;  5LKX A;  2GRC A;  4PY6 A;  4XY8 A;  2L43 A;  5F62 A;  5BT5 A;  3RCW A;  3O33 A;  5ENG A;  4AP4 A;  4C66 A;  5EU1 A;  3UW9 A;  2YUC A;  3L11 A;  4IOQ A;  5CUG A;  4YAB A;  5LKZ A;  1WES A;  5A5Q A;  4UIX A;  4UIY A;  4QST A;  2DVQ A;  2R0S A;  5I40 A;  4R7E A;  4NYX A;  4Z93 A;  2L84 A;  1T1H A;  2M3H A;  3SVH A;  2M6M A;  4A9F A;  2KWJ A;  2VPG A;  5D3R A;  4Y03 A;  5DYC A;  3JVJ A;  4ZW1 A;  3ZVY A;  5KHM A;  3NG2 A;  5I83 A;  4NR9 A;  3EB6 A;  4QSU A;  2VP7 A;  4A49 A;  3MB4 A;  1WEU A;  2ECG A;  4A9H A;  4YYH A;  1Z2Q A;  5ENI A;  4O75 A;  3JVM A;  4MSX A;  1WEN A;  4NUE A;  4IC3 A;  1WFK A;  5AMF A;  2K17 A;  2DAT A;  5F5Z A;  3MHS A;  4I7D A;  1Z60 A;  2FUU A;  2QIZ A;  2Y43 A;  2PUY A;  4XUA A;  5FB0 A;  5CQ5 A;  3O34 A;  5D3T A;  5D3N A;  4YAX A;  1X4U A;  4TZ8 A;  2RI7 A;  2RO1 A;  5F63 A;  2C2V S;  5EGU A;  5G04 B;  5CUE A;  3MXF A;  1RMD A;  5I80 A;  5CFW A;  3C6W A;  1DVP A;  5I7X A;  5L98 A;  5A85 A;  4E96 A;  4HXO A;  4YY6 A;  5JI8 A;  3SOW A;  4HBY A;  4LYS A;  4YBM A;  2CKL B;  1WUG A;  2VPB A;  3MUL A;  3M62 A;  2RS9 B;  3I3J A;  2YW5 A;  5EA1 A;  5FDZ A;  2MJV B;  4QC1 A;  5DKH A;  5ENF A;  5AD3 A;  2FUI A;  4ALG A;  3SVF A;  3M63 A;  3V43 A;  1JSP B;  3DAI A;  4HBX A;  5FG6 A;  3O36 A;  1VD4 A;  4PKL A;  4QZS A;  4YK0 A;  5E73 A;  5EV9 A;  3UVW A;  1N87 A;  4XI1 A;  5KH7 A;  4UIT A;  4UIW A;  5EIC A;  2KIZ A;  5L96 A;  2RNW A;  2D8S A;  2VNF A;  5DKA A;  3UVX A;  3FL2 A;  2VJF B;  5L8U A;  5EVA A;  4MEN A;  1WEQ A;  5F3A A;  4O70 A;  1K2F A;  4N4G A;  4NR8 A;  4UIV A;  5D3L A;  5EWW A;  5TAB A;  4QSQ A;  4TU6 A;  3LJW A;  3I2D A;  2NAA A;  2ECW A;  2G45 A;  5L97 A;  5IGN A;  2F6N A;  2YHO A;  5B75 A;  4WZ0 A;  3UVY A;  1WEM A;  2OO1 A;  5C4Q A;  3S91 A;  3U5K A;  1WGM A;  4OGJ A;  4UYF B;  5HFQ A;  4QSP A;  3LQI A;  5FH8 A;  2JRJ A;  2K1J A;  5FE6 A;  5DYU A;  2H0D B;  5FB1 A;  4PS5 A;  4XUB A;  4A9N A;  1WEW A;  2DVV A;  4NUC A;  4O77 A;  4TT2 A;  5G4S A;  5DY7 A;  5L99 A;  5ENJ A;  4TU4 A;  2UZG A;  5KH9 A;  3NXB A;  4OUF A;  4FLP A;  5E7D A;  5LKT A;  1G25 A;  4NRC A;  1WIL A;  4TT4 A;  2JMD A;  3ZTG A;  2KWO A;  4LK9 A;  4A9O A;  5HEL A;  1WEE A;  2R10 A;  4YYD A;  4TZ2 A;  4BW1 A;  3UVD A;  2MA5 A;  2YSM A;  5H1T A;  4V3K C;  3U5N A;  4B86 C;  5EWC A;  1F68 A;  5CUD A;  4WZ3 B;  4AYC A;  4UYG A;  4FJC A;  4CUQ A;  5EWV A;  5KH3 A;  3QZV A;  3P1E A;  5LCW B;  3RPG C;  5E3G A;  2Y1N A;  4CUT A;  5ENB A;  5I1Q A;  4C67 A;  5TB6 A;  2KWN A;  4GPJ A;  5I7Y A;  1FP0 A;  5JWM A;  5C11 A;  4Q0O A;  3N9O A;  2N9G A;  2ECV A;  5DW2 A;  3G0L A;  2LQ6 A;  4YH4 A;  2I50 A;  4P5O B;  1VYX A;  5DFC A;  2QJ0 A;  4HXP A;  4PCI A;  3HCS A;  2M1R A;  5AME A;  4TKP B;  3DQV R;  4QB3 A;  3UV5 A;  4NR7 A;  4MEP A;  2LXH C;  4CFK A;  4FO9 A;  4Z1S A;  5D1L B;  1X0J A;  4RVR A;  5CPE A;  5ETD A;  4O7E A;  4WIV A;  3U5O A;  4UP0 A;  5C8G A;  2YQL A;  3N9M A;  2BAY A;  5DIN A;  4QYL A;  5CQ7 A;  5E0R A;  3LQJ A;  3SVG A;  4TYL A;  2ECT A;  5LUU A;  5FEY A;  3PUQ A;  2D82 A;  5DKD A;  2CSY A;  4BJX A;  2KGG A;  4S3O C;  5B8D A;  4QUT A;  4UYD A;  3K2J A;  4KV4 A;  5LKU A;  3HCT A;  3PHD A;  5FBX A;  4HBV A;  5CQ6 A;  5E74 A;  5HLS A;  2EGP A;  5CRM A;  4OGI A;  2YRE A;  5C87 A;  4WHW A;  2I7K A;  4O74 A;  4N4F A;  5A7C A;  2L80 A;  5HCL A;  4QC3 A;  5E9M A;  3N9P A;  4O78 A;  4LKA A;  5LVR A;  5D3J A;  4N4H A;  2YYR A;  3SOU A;  4CL9 A;  4IR3 A;  2YSJ A;  4AVX A;  5H1V A;  2RFJ A;  4YYN A;  3UV2 A;  4IOR A;  4YBT A;  2YDW A;  3ZYQ A;  5EWD A;  5AIT A;  5HQ7 A;  2F6J A;  4NUD A;  3AAD A;  5CQ3 A;  1LDJ B;  2DVR A;  5J0D A;  4HBW A;  4QEW A;  5ENH A;  2ECN A;  2M85 A;  5ENC A;  5F2P A;  5C7N A;  2MNZ A;  3EB5 A;  5HEN A;  4J1P A;  5CY9 A;  5F60 A;  5A5O A;  5DLZ A;  1WE9 A;  3AQA A;  4C9Z A;  4WZ2 A;  4QR5 A;  1IYM A;  2MNY A;  3SHB A;  5A5R A;  4UYF A;  2YT5 A;  4MR4 A;  4WHU A;  4WA6 A;  5EP7 A;  3S92 A;  1VFY A;  3ZPV 1;  4HXM A;  2OUO A;  5FG5 A;  2YHN A;  5CQT A;  5TBN A;  2KYU A;  2C2L A;  4BHW A;  5F61 A;  3ZYU A;  5LJ0 A;  2L0B A;  2VPE A;  5FFW A;  3M99 A;  5EQ1 A;  2KU3 A;  4IR5 A;  4O7B A;  4L58 A;  2ZET C;  2H60 A;  2VJF A;  2VJE A;  1ZS5 A;  5ENE A;  5FG4 A;  1JM4 B;  3N9N A;  5G4R A;  5IGM A;  5ETB A;  3P1D A;  2KFT A;  3LXJ A;  4UIU A;  1BOR A;  3KV5 A;  1WEV A;  5EPB A;  2FSA A;  4NR5 A;  4UYH A;  2HYE D;  2JMJ A;  4LAD B;  3DPL R;  5TCM A;  2K4D A;  4O7A A;  4XYA A;  3O35 A;  2EOD A;  2LDR A;  4UIZ A;  3IU6 A;  3GV4 A;  2CKL A;  4J0R A;  4O76 A;  3U5M A;  5FH6 A;  2CSZ A;  3HMF A;  4A4C A;  2MUM A;  5CU8 A;  3LQH A;  5FER A;  4GNE A;  1HYJ A;  4QY4 A;  5D3P A;  3U5J A;  2KWK A;  2G4A A;  3QZT A;  2LSP B;  2KTB B;  4QR4 A;  5DX4 A;  5FE3 A;  5KTX A;  3FKM X;  5D7X A;  4S3O B;  3MUK A;  5F1L A;  2R0Y A;  5G05 B;  1FBV A;  4LR6 A;  4IR4 A;  5CUA A;  1JM7 B;  5E9L A;  4HXK A;  2PNX A;  2OXQ C;  4LYI A;  5DKC A;  2MD7 B;  3RPG B;  3O37 A;  4AYC B;  4IOO A;  4XY9 A;  2I8N A;  5DLX A;  4Z1Q A;  5COI A;  3KNV A;  4I7B A;  1JM7 A;  5HM0 A;  1X4J A;  5A5P A;  4YYK A;  1WEP A;  3HTK C;  5HQ5 A;  4UYE A;  4NN2 A;  4ZDT A;  5CRZ A;  4ZQL A;  5E9V A;  5ACY A;  1V87 A;  4NYV A;  4AKN A;  2AN6 A;  4V3L C;  4B7Y C;  5FFY A;  2YQD A;  5H1U A;  1XWH A;  4GB0 A;  2DVS A;  5FE9 A;  3RTR B;  1U6G B;  5D1K B;  4BW4 A;  4QF3 A;  5B78 A;  3ZVZ B;  3DWY A;  4NQM A;  2E6S A;  3O7A A;  2DWW A;  3ONI A;  4A9E A;  1WUM A;  5F1H A;  2L85 A;  5HRW A;  4QBM A;  4NS5 A;  3U5L A;  4Z6I A;  2CT2 A;  4KCX A;  5CQ4 A;  4R2Y A;  5IBN A;  2YEL A;  2IDA A;  2VJE B;  4UI9 B;  4O7C A;  2E6R A;  5E9K A;  3T6R A;  5D3S A;  4TQN A;  2MIQ A;  4YYI A;  4LJN A;  3Q2E A;  2LV9 A;  4Z6H A;  4A9J A;  5LJ2 A;  5CQA A;  5EM3 A;  4ALH A;  2ECJ A;  4MEO A;  4QR3 A;  5EPR A;  3TLP A;  3SOX A;  3UV4 A;  5FE5 A;  5EI4 A;  3ZNI A;  5HQ6 A;  3KQI A;  4QSW A;  4YAT A;  2F42 A;  4N3W A;  5EK9 A;  3P1F A;  4CUU A;  2KE1 A;  5KTU A;  1JOC A;  1F62 A;  3P5O A;  4A4B A;  2L75 A;  4QYD A;  2VPD A;  3KV6 A;  2R0V A;  4UP5 A;  5CP5 A;  5G0F A;  4X3G A;  5D24 A;  5HRX A;  4LDF A;  4MR5 A;  5CZG A;  2YU4 A;  3N9Q A;  5CUB A;  3GL6 A;  3HME A;  4PTB A;  4HXR A;  5CUC A;  5TDW A;  3GG3 A;  4QSX A;  4YYM A;  3HCU A;  5AIU A;  4J3I A;  2H0D A;  5AD2 A;  4YBS A;  3P1C A;  5BT4 A;  3N9L A;  5FE2 A;  2EA6 A;  5FE8 A;  4BW3 A;  5FE4 A;  5HEM A;  5II2 A;  5D3H A;  2KRE A;  4MR6 A;  5A5S A;  2KGI A;  4O72 A;  1N72 A;  3JVL A;  4TTE A;  5CQ8 A;  2RNY A;  5D0C A;  3MHH A;  5KU3 A;  2JMI A;  4F52 B;  4QEU A;  4HXL A;  2ECI A;  5D26 A;  3T7L A;  5E9Y A;  4X2I A;  5BT3 A;  4QUU A;  4IC2 A;  5LJ1 A;  2MD8 C;  5I86 A;  4ZC9 A;  4QSV A;  5HJC A;  4CFL A;  4YYJ A;  2YEM A;  2E7O A;  3G0J A;  4A9K A;  4CUR A;  4NXJ A;  2L5E A;  2WP1 A;  4LC2 A;  5C89 A;  4CLB A;  2XEU A;  4NYW A;  3IU5 A;  4TS8 A;  5H9M A;  3IHP A;  5DYA A;  1WEO A;  4PCE A;  4PPE A;  5I3L A;  4O64 A;  4CUP A;  5I88 A;  4LRG A;  5L8T A;  4FIP A;  4GNG A;  4W4U A;  2HDP A;  4LZS A;  1X4I A;  5J3X A;  5C13 A;  5IGK A;  5A5N A;  1HYI A;  5FFV A;  5FH7 A;  3HMH A;  4NR4 A;  5II1 A;  2RSD A;  5E3D A;  2MT5 A;  4YH3 A;  5FE1 A;  4CUS A;  4A9M A;  5KO4 A;  3VK6 A; 
#chains in the Genus database with same CATH topology
 4R8P K;  5B77 A;  4LZR A;  3LRQ A;  4ZUX U;  4AUQ B;  4CA1 A;  2YQM A;  2QIC A;  4LYW A;  3D7C A;  4MEQ A;  3MB3 A;  4YYG A;  5I29 A;  1Z6U A;  1EQF A;  2DKW A;  5KTW A;  4A0C D;  4HXN A;  5DFB A;  4A9L A;  3JVK A;  4DON A;  5IID A;  2YW8 A;  2D9E A;  4F3I A;  1MM3 A;  5A81 A;  3VKH A;  5DBM A;  4QF2 A;  1E4U A;  5F25 A;  3C5K A;  4Z0O A;  1CHC A;  4CCG X;  2RNX A;  5IGL A;  5H85 A;  4O71 A;  3ASL A;  4LZ2 A;  5HFR A;  5B76 A;  5K29 A;  4GND A;  5JG6 A;  4AKI A;  5CTL A;  2JM3 A;  5D1M B;  3Q2F A;  3PUR A;  3O70 A;  3L1X A;  5A83 A;  3LVR E;  2KR4 A;  2LGV A;  2YEK A;  2MKE A;  2E7N A;  4J0S A;  2YYN A;  2LRI C;  5CS8 A;  2WP2 A;  1LDK C;  2LN0 A;  3ZPV E;  3VKG A;  4NR6 A;  4IR6 A;  5EPS A;  5CGP A;  5C85 A;  5LVQ A;  4OGE A;  5A82 A;  3U5P A;  4QSS A;  2XB1 A;  5FE7 A;  2DX8 A;  5EIS A;  5TDR A;  5FE0 A;  5IG6 A;  4Q0N A;  3L1Z B;  4AKH A;  5EWH A;  4YY4 A;  3D1D A;  4MVT A;  1WIM A;  2LGG A;  3MQM A;  4HXS A;  4L7X A;  5DYX A;  2DJA A;  3FAN A;  2G6Q A;  4QEV A;  2G43 A;  1PUO A;  4Q6F A;  1E6I A;  4NRA A;  5F36 A;  2LXP C;  5EYA F;  2YUR A;  4QSR A;  4MR3 A;  5I89 A;  2K16 A;  4YAD A;  5TRB A;  1MM2 A;  4KV1 A;  2LGL A;  4NRB A;  2OSS A;  4GNF A;  5DW1 A;  2LGK A;  2NXB A;  4N4I A;  5HRV A;  2L5U A;  2MA6 A;  5DFD A;  2CRW A;  5B79 A;  1ZBD B;  5D25 A;  5E9I A;  3QZS A;  4A9I A;  4QNS A;  2M13 A;  4TT6 A;  4BW2 A;  4YC9 A;  2Y1M A;  4FK5 A;  4O7F A;  2E3K A;  4NQN A;  4LLB A;  4I7C A;  5LKX A;  2GRC A;  4PY6 A;  4XY8 A;  2L43 A;  3PLW A;  2IQJ A;  5F62 A;  5BT5 A;  3RCW A;  2EXU A;  3O33 A;  5ENG A;  4AP4 A;  4H9D A;  4C66 A;  5EU1 A;  3UW9 A;  2YUC A;  3JUE A;  3L11 A;  4Z0R A;  4IOQ A;  5CUG A;  4YAB A;  5LKZ A;  1WES A;  3FEH A;  3LVQ E;  5A5Q A;  4UIX A;  4UIY A;  4QST A;  2DVQ A;  2R0S A;  5I40 A;  4R7E A;  4NYX A;  4Z93 A;  2L84 A;  1T1H A;  2M3H A;  3SVH A;  2M6M A;  4A9F A;  2KWJ A;  2VPG A;  5D3R A;  4Y03 A;  5DYC A;  3JVJ A;  3FAO A;  4ZW1 A;  3ZVY A;  5KHM A;  3NG2 A;  5I83 A;  4NR9 A;  3EB6 A;  4QSU A;  2VP7 A;  4A49 A;  3MB4 A;  1WEU A;  2ECG A;  4A9H A;  4YYH A;  1Z2Q A;  5ENI A;  4O75 A;  3JVM A;  4MSX A;  1WEN A;  2FD4 A;  4NUE A;  4IC3 A;  1WFK A;  5AMF A;  2K17 A;  2DAT A;  5SVY A;  5F5Z A;  3MHS A;  4I7D A;  1Z60 A;  2FUU A;  2QIZ A;  2Y43 A;  2PUY A;  4XUA A;  5FB0 A;  5CQ5 A;  3O34 A;  5D3T A;  5D3N A;  4YAX A;  1X4U A;  4TZ8 A;  2RI7 A;  2RO1 A;  5F63 A;  2C2V S;  5EGU A;  5G04 B;  5CUE A;  3MXF A;  1RMD A;  5I80 A;  5CFW A;  3C6W A;  1DVP A;  5I7X A;  5L98 A;  5A85 A;  4E96 A;  2B0O E;  4HXO A;  4YY6 A;  5JI8 A;  2CSV A;  3SOW A;  4HBY A;  4LYS A;  4YBM A;  2CKL B;  1WUG A;  2VPB A;  3MUL A;  3M62 A;  2RS9 B;  3I3J A;  2YW5 A;  5EA1 A;  5FDZ A;  2MJV B;  4QC1 A;  5DKH A;  5ENF A;  5AD3 A;  2FUI A;  4ALG A;  3SVF A;  3DWD A;  3M63 A;  3V43 A;  1JSP B;  3DAI A;  4HBX A;  5FG6 A;  3O36 A;  1VD4 A;  4PKL A;  4QZS A;  4YK0 A;  5E73 A;  5EV9 A;  3UVW A;  1N87 A;  4XI1 A;  5KH7 A;  4UIT A;  4UIW A;  5EIC A;  2KIZ A;  5L96 A;  2RNW A;  2D8S A;  2VNF A;  5DKA A;  3UVX A;  3FL2 A;  2VJF B;  5L8U A;  5EVA A;  4MEN A;  1WEQ A;  5F3A A;  4O70 A;  1K2F A;  4N4G A;  4NR8 A;  4UIV A;  5D3L A;  5EWW A;  5TAB A;  4QSQ A;  4TU6 A;  3LJW A;  3I2D A;  2NAA A;  2ECW A;  2G45 A;  5L97 A;  5IGN A;  2F6N A;  2YHO A;  5B75 A;  4WZ0 A;  3UVY A;  1WEM A;  2OO1 A;  5C4Q A;  3S91 A;  3U5K A;  1WGM A;  4OGJ A;  4UYF B;  5HFQ A;  4QSP A;  3LQI A;  5FH8 A;  2JRJ A;  2K1J A;  5FE6 A;  5DYU A;  2H0D B;  5FB1 A;  4PS5 A;  4XUB A;  4A9N A;  1WEW A;  2DVV A;  4NUC A;  4O77 A;  4TT2 A;  5G4S A;  5DY7 A;  5L99 A;  5ENJ A;  4TU4 A;  2UZG A;  5KH9 A;  3NXB A;  4OUF A;  4FLP A;  5E7D A;  5LKT A;  1G25 A;  4NRC A;  1WIL A;  4TT4 A;  4AKG A;  2JMD A;  3ZTG A;  2KWO A;  4LK9 A;  3H7H A;  4A9O A;  5HEL A;  1WEE A;  2R10 A;  4YYD A;  4TZ2 A;  4BW1 A;  3UVD A;  3KDE C;  2MA5 A;  2YSM A;  5H1T A;  4V3K C;  3U5N A;  2EGM A;  4B86 C;  5EWC A;  1F68 A;  2YVR A;  2KKX A;  5CUD A;  4WZ3 B;  4AYC A;  4UYG A;  4FJC A;  4CUQ A;  5EWV A;  5KH3 A;  3QZV A;  3P1E A;  2XP0 A;  5LCW B;  5E3G A;  2Y1N A;  3RPG C;  4CUT A;  5ENB A;  5I1Q A;  4C67 A;  2CRR A;  5TB6 A;  2KWN A;  4GPJ A;  5I7Y A;  1FP0 A;  5JWM A;  5C11 A;  3Q1D A;  4Q0O A;  3N9O A;  1MBM A;  2N9G A;  2ECV A;  5DW2 A;  3G0L A;  2LQ6 A;  4YH4 A;  2DSM A;  2I50 A;  4P5O B;  1VYX A;  5DFC A;  2QJ0 A;  4HXP A;  4PCI A;  3HCS A;  2M1R A;  5AME A;  4TKP B;  5SVX A;  3DQV R;  4QB3 A;  3UV5 A;  4NR7 A;  4MEP A;  2LXH C;  4OGC A;  4CFK A;  4FO9 A;  4Z1S A;  5D1L B;  1X0J A;  4RVR A;  2JUN A;  5CPE A;  5ETD A;  4O7E A;  4WIV A;  3U5O A;  4UP0 A;  5C8G A;  2YQL A;  2FFW A;  3N9M A;  2BAY A;  5DIN A;  4BBQ A;  4QYL A;  5CQ7 A;  5E0R A;  3LQJ A;  3SVG A;  4TYL A;  2ECT A;  5LUU A;  5FEY A;  3PUQ A;  2D82 A;  5DKD A;  2CSY A;  4BJX A;  2KGG A;  4S3O C;  5SVI B;  4QUT A;  4UYD A;  3K2J A;  4KV4 A;  5LKU A;  3DDT A;  3HCT A;  3PHD A;  5B8D A;  4O62 A;  5FBX A;  4HBV A;  5CQ6 A;  5E74 A;  5HLS A;  2EGP A;  5CRM A;  4OGI A;  2YRE A;  5C87 A;  4WHW A;  3SUB A;  2I7K A;  4O74 A;  4N4F A;  5A7C A;  2L80 A;  3M7K A;  5HCL A;  4QC3 A;  5E9M A;  3N9P A;  4O78 A;  4LKA A;  5LVR A;  5D3J A;  4N4H A;  2YYR A;  3SOU A;  4CL9 A;  4IR3 A;  2YSJ A;  4AVX A;  5H1V A;  2RFJ A;  4YYN A;  3UV2 A;  4IOR A;  4YBT A;  2YDW A;  3ZYQ A;  3ERR A;  4AI6 A;  5EWD A;  5AIT A;  5HQ7 A;  2F6J A;  4NUD A;  3AAD A;  5CQ3 A;  1LDJ B;  2DVR A;  5J0D A;  4HBW A;  4QEW A;  5ENH A;  2ECN A;  2M85 A;  5ENC A;  5F2P A;  5C7N A;  2MNZ A;  3EB5 A;  5HEN A;  4J1P A;  5CY9 A;  5F60 A;  5A5O A;  5DLZ A;  1WE9 A;  3AQA A;  4C9Z A;  4WZ2 A;  4QR5 A;  1IYM A;  2MNY A;  3SHB A;  5A5R A;  4UYF A;  2YT5 A;  4MR4 A;  4WHU A;  3LJU X;  4WA6 A;  5EP7 A;  3S92 A;  3LDY A;  1VFY A;  3ZPV 1;  4HXM A;  2OUO A;  5FG5 A;  2YHN A;  5CQT A;  5TBN A;  2KYU A;  2C2L A;  4BHW A;  5F61 A;  3ZYU A;  5LJ0 A;  2L0B A;  2VPE A;  5FFW A;  3M99 A;  5EQ1 A;  2KU3 A;  4IR5 A;  4O7B A;  4L58 A;  2ZET C;  2H60 A;  2VJF A;  2VJE A;  1ZS5 A;  5ENE A;  5FG4 A;  1JM4 B;  3N9N A;  5G4R A;  5IGM A;  5ETB A;  3P1D A;  2KFT A;  3LXJ A;  4UIU A;  1BOR A;  3KV5 A;  1WEV A;  5EPB A;  2FSA A;  4NR5 A;  4UYH A;  2HYE D;  2JMJ A;  4LAD B;  3DPL R;  5TCM A;  4QQ4 A;  2K4D A;  4O7A A;  4XYA A;  3O35 A;  2EOD A;  2LDR A;  4UIZ A;  3IU6 A;  3GV4 A;  2CKL A;  4J0R A;  4O76 A;  3U5M A;  5FH6 A;  2CSZ A;  3HMF A;  4A4C A;  2MUM A;  5CU8 A;  3LQH A;  2OWA A;  4GNE A;  2L7P A;  5FER A;  1HYJ A;  4QY4 A;  5D3P A;  3U5J A;  2KWK A;  2G4A A;  3QZT A;  2LSP B;  2KTB B;  4QR4 A;  5DX4 A;  5FE3 A;  5KTX A;  3FKM X;  5D7X A;  4S3O B;  3MUK A;  5F1L A;  2R0Y A;  5G05 B;  1FBV A;  3FJU B;  4LR6 A;  4IR4 A;  5CUA A;  1JM7 B;  3O47 A;  5E9L A;  4HXK A;  2PNX A;  2OXQ C;  4LYI A;  5DKC A;  2MD7 B;  3RPG B;  3O37 A;  4AYC B;  4IOO A;  4XY9 A;  2I8N A;  5DLX A;  4Z1Q A;  5COI A;  3KNV A;  4I7B A;  1JM7 A;  5HM0 A;  1X4J A;  5A5P A;  4YYK A;  1WEP A;  3HTK C;  5HQ5 A;  2KKY A;  4UYE A;  4NN2 A;  4ZDT A;  5CRZ A;  5SVI A;  4ZQL A;  5E9V A;  5ACY A;  1V87 A;  4NYV A;  4AKN A;  2AN6 A;  2RR4 A;  4V3L C;  4B7Y C;  5FFY A;  3E2D A;  2YQD A;  5H1U A;  1XWH A;  4GB0 A;  2DVS A;  5FE9 A;  3RTR B;  1U6G B;  5D1K B;  4BW4 A;  4QF3 A;  5B78 A;  3ZVZ B;  3DWY A;  4NQM A;  2E6S A;  3O7A A;  2DWW A;  3ONI A;  4A9E A;  2LAU A;  1WUM A;  5F1H A;  2L85 A;  5HRW A;  4QBM A;  4NS5 A;  3U5L A;  4Z6I A;  2CT2 A;  4KCX A;  5CQ4 A;  4R2Y A;  5IBN A;  2YEL A;  2IDA A;  2VJE B;  4UI9 B;  4O7C A;  2E6R A;  5E9K A;  3D1B A;  5D3S A;  1DCQ A;  3T6R A;  5K3Q A;  4TQN A;  2MIQ A;  4YYI A;  3FM8 C;  4LJN A;  3Q2E A;  2LV9 A;  4Z6H A;  4A9J A;  2XOZ A;  5LJ2 A;  5CQA A;  5EM3 A;  4ALH A;  2ECJ A;  4MEO A;  4QR3 A;  5EPR A;  3TLP A;  3SOX A;  3UV4 A;  5FE5 A;  5EI4 A;  3ZNI A;  5HQ6 A;  3KQI A;  4QSW A;  4YAT A;  2CON A;  4N3W A;  2EJN A;  3P1F A;  5EK9 A;  4CUU A;  2F42 A;  2KE1 A;  5KTU A;  1JOC A;  1F62 A;  3P5O A;  4A4B A;  2L75 A;  4QYD A;  2VPD A;  3KV6 A;  2R0V A;  4UP5 A;  5CP5 A;  5G0F A;  4X3G A;  5D24 A;  1ZKR A;  4LDF A;  5HRX A;  4MR5 A;  5CZG A;  2YU4 A;  2D8U A;  3N9Q A;  5CUB A;  3GL6 A;  3HME A;  4PTB A;  4HXR A;  5CUC A;  5TDW A;  3GG3 A;  4QSX A;  4YYM A;  3HCU A;  5AIU A;  4J3I A;  2H0D A;  5AD2 A;  4YBS A;  3P1C A;  5BT4 A;  3N9L A;  5FE2 A;  2EA6 A;  5FE8 A;  2XOC A;  4BW3 A;  5FE4 A;  5HEM A;  5II2 A;  5D3H A;  2KRE A;  4MR6 A;  5A5S A;  2KGI A;  4O72 A;  1N72 A;  3JVL A;  4TTE A;  5CQ8 A;  2RNY A;  5D0C A;  3MHH A;  5KU3 A;  2JMI A;  4F1P A;  4F52 B;  4QEU A;  2P57 A;  4HXL A;  2ECI A;  5D26 A;  3T7L A;  2XOY A;  5E9Y A;  4X2I A;  5BT3 A;  4QUU A;  4IC2 A;  5LJ1 A;  2MD8 C;  5I86 A;  4ZC9 A;  4QSV A;  5HJC A;  4CFL A;  4YYJ A;  2YEM A;  2E7O A;  3G0J A;  4A9K A;  4CUR A;  4NXJ A;  2L5E A;  2WP1 A;  4LC2 A;  5C89 A;  4CLB A;  2XEU A;  4NYW A;  3IU5 A;  4TS8 A;  5H9M A;  3IHP A;  5DYA A;  1WEO A;  4PCE A;  4PPE A;  3T9K A;  5I3L A;  4O64 A;  4CUP A;  5I88 A;  4LRG A;  5L8T A;  4FIP A;  4GNG A;  4W4U A;  2HDP A;  4LZS A;  1X4I A;  5J3X A;  5C13 A;  5IGK A;  2E61 A;  5A5N A;  1HYI A;  5FFV A;  5FH7 A;  3HMH A;  3MDB C;  4NR4 A;  5II1 A;  2RSD A;  5E3D A;  2MT5 A;  4YH3 A;  5FE1 A;  4CUS A;  4A9M A;  5KO4 A;  3VK6 A; 
#chains in the Genus database with same CATH homology
 4R8P K;  5B77 A;  4LZR A;  3LRQ A;  4ZUX U;  4AUQ B;  4CA1 A;  2YQM A;  2QIC A;  4LYW A;  3D7C A;  4MEQ A;  3MB3 A;  4YYG A;  5I29 A;  1Z6U A;  1EQF A;  2DKW A;  5KTW A;  4A0C D;  4HXN A;  5DFB A;  4A9L A;  3JVK A;  4DON A;  5IID A;  2YW8 A;  2D9E A;  4F3I A;  1MM3 A;  5A81 A;  4BBQ A;  5DBM A;  4QF2 A;  1E4U A;  5F25 A;  3C5K A;  1CHC A;  4CCG X;  2RNX A;  5IGL A;  5H85 A;  4O71 A;  3ASL A;  4LZ2 A;  5HFR A;  5B76 A;  5K29 A;  4GND A;  5JG6 A;  5CTL A;  5D1M B;  3Q2F A;  3PUR A;  3O70 A;  3L1X A;  5A83 A;  2KR4 A;  2LGV A;  2YEK A;  2E7N A;  4J0S A;  2YYN A;  2LRI C;  5CS8 A;  2WP2 A;  1LDK C;  2LN0 A;  3ZPV E;  4NR6 A;  4IR6 A;  5EPS A;  5CGP A;  5C85 A;  5LVQ A;  5A82 A;  3U5P A;  4QSS A;  2XB1 A;  5FE7 A;  2DX8 A;  5EIS A;  5TDR A;  5FE0 A;  5IG6 A;  4Q0N A;  3L1Z B;  5EWH A;  4YY4 A;  4MVT A;  1WIM A;  2LGG A;  3MQM A;  4HXS A;  4L7X A;  5DYX A;  2G6Q A;  4QEV A;  2G43 A;  4Q6F A;  1E6I A;  4NRA A;  5F36 A;  2LXP C;  5EYA F;  2YUR A;  4QSR A;  4MR3 A;  5I89 A;  2K16 A;  4YAD A;  5TRB A;  1MM2 A;  4KV1 A;  2LGL A;  4NRB A;  2OSS A;  4GNF A;  5DW1 A;  2LGK A;  2NXB A;  4N4I A;  5HRV A;  2L5U A;  2MA6 A;  5DFD A;  5B79 A;  1ZBD B;  5D25 A;  5E9I A;  3QZS A;  4A9I A;  4QNS A;  4TT6 A;  4BW2 A;  4YC9 A;  2Y1M A;  4FK5 A;  4O7F A;  2E3K A;  4NQN A;  4LLB A;  4I7C A;  5LKX A;  2GRC A;  4PY6 A;  4XY8 A;  2L43 A;  5F62 A;  5BT5 A;  3RCW A;  3O33 A;  5ENG A;  4AP4 A;  4C66 A;  5EU1 A;  3UW9 A;  2YUC A;  3L11 A;  4IOQ A;  5CUG A;  4YAB A;  5LKZ A;  1WES A;  5A5Q A;  4UIX A;  4UIY A;  4QST A;  2DVQ A;  2R0S A;  5I40 A;  4R7E A;  4NYX A;  4Z93 A;  2L84 A;  1T1H A;  2M3H A;  3SVH A;  2M6M A;  4A9F A;  2KWJ A;  2VPG A;  5D3R A;  4Y03 A;  5DYC A;  3JVJ A;  4ZW1 A;  3ZVY A;  5KHM A;  3NG2 A;  5I83 A;  4NR9 A;  3EB6 A;  4QSU A;  2VP7 A;  4A49 A;  3MB4 A;  1WEU A;  2ECG A;  4A9H A;  4YYH A;  1Z2Q A;  5ENI A;  4O75 A;  3JVM A;  4MSX A;  1WEN A;  4NUE A;  4IC3 A;  1WFK A;  5AMF A;  2K17 A;  2DAT A;  5F5Z A;  3MHS A;  4I7D A;  1Z60 A;  2FUU A;  2QIZ A;  2Y43 A;  2PUY A;  4XUA A;  5FB0 A;  5CQ5 A;  3O34 A;  5D3T A;  5D3N A;  4YAX A;  1X4U A;  4TZ8 A;  2RI7 A;  2RO1 A;  5F63 A;  2C2V S;  5EGU A;  5G04 B;  5CUE A;  3MXF A;  1RMD A;  5I80 A;  5CFW A;  3C6W A;  1DVP A;  5I7X A;  5L98 A;  5A85 A;  4E96 A;  4HXO A;  4YY6 A;  5JI8 A;  3SOW A;  4HBY A;  4LYS A;  4YBM A;  2CKL B;  1WUG A;  2VPB A;  3MUL A;  3M62 A;  2RS9 B;  3I3J A;  2YW5 A;  5EA1 A;  5FDZ A;  2MJV B;  4QC1 A;  5DKH A;  5ENF A;  5AD3 A;  2FUI A;  4ALG A;  3SVF A;  3M63 A;  3V43 A;  1JSP B;  3DAI A;  4HBX A;  5FG6 A;  3O36 A;  1VD4 A;  4PKL A;  4QZS A;  4YK0 A;  5E73 A;  5EV9 A;  3UVW A;  1N87 A;  4XI1 A;  5KH7 A;  4UIT A;  4UIW A;  5EIC A;  2KIZ A;  5L96 A;  2RNW A;  2D8S A;  2VNF A;  5DKA A;  3UVX A;  3FL2 A;  2VJF B;  5L8U A;  5EVA A;  4MEN A;  1WEQ A;  5F3A A;  4O70 A;  1K2F A;  4N4G A;  4NR8 A;  4UIV A;  5D3L A;  5EWW A;  5TAB A;  4QSQ A;  4TU6 A;  3LJW A;  3I2D A;  2NAA A;  2ECW A;  2G45 A;  5L97 A;  5IGN A;  2F6N A;  2YHO A;  5B75 A;  4WZ0 A;  3UVY A;  1WEM A;  2OO1 A;  5C4Q A;  3S91 A;  3U5K A;  1WGM A;  4OGJ A;  4UYF B;  5HFQ A;  4QSP A;  3LQI A;  5FH8 A;  2JRJ A;  2K1J A;  5FE6 A;  5DYU A;  2H0D B;  5FB1 A;  4PS5 A;  4XUB A;  4A9N A;  1WEW A;  2DVV A;  4NUC A;  4O77 A;  4TT2 A;  5G4S A;  5DY7 A;  5L99 A;  5ENJ A;  4TU4 A;  2UZG A;  5KH9 A;  3NXB A;  4OUF A;  4FLP A;  5E7D A;  5LKT A;  1G25 A;  4NRC A;  1WIL A;  4TT4 A;  2JMD A;  3ZTG A;  2KWO A;  4LK9 A;  4A9O A;  5HEL A;  1WEE A;  2R10 A;  4YYD A;  4TZ2 A;  4BW1 A;  3UVD A;  2MA5 A;  2YSM A;  5H1T A;  4V3K C;  3U5N A;  4B86 C;  5EWC A;  1F68 A;  5CUD A;  4WZ3 B;  4AYC A;  4UYG A;  4FJC A;  4CUQ A;  5EWV A;  5KH3 A;  3QZV A;  3P1E A;  5LCW B;  3RPG C;  5E3G A;  2Y1N A;  4CUT A;  5ENB A;  5I1Q A;  4C67 A;  5TB6 A;  2KWN A;  4GPJ A;  5I7Y A;  1FP0 A;  5JWM A;  5C11 A;  4Q0O A;  3N9O A;  2N9G A;  2ECV A;  5DW2 A;  3G0L A;  2LQ6 A;  4YH4 A;  2I50 A;  4P5O B;  1VYX A;  5DFC A;  2QJ0 A;  4HXP A;  4PCI A;  3HCS A;  2M1R A;  5AME A;  4TKP B;  3DQV R;  4QB3 A;  3UV5 A;  4NR7 A;  4MEP A;  2LXH C;  4CFK A;  4FO9 A;  4Z1S A;  5D1L B;  1X0J A;  4RVR A;  5CPE A;  5ETD A;  4O7E A;  4WIV A;  3U5O A;  4UP0 A;  5C8G A;  2YQL A;  3N9M A;  2BAY A;  5DIN A;  4QYL A;  5CQ7 A;  5E0R A;  3LQJ A;  3SVG A;  4TYL A;  2ECT A;  5LUU A;  5FEY A;  3PUQ A;  2D82 A;  5DKD A;  2CSY A;  4BJX A;  2KGG A;  4S3O C;  5B8D A;  4QUT A;  4UYD A;  3K2J A;  4KV4 A;  5LKU A;  3HCT A;  3PHD A;  5FBX A;  4HBV A;  5CQ6 A;  5E74 A;  5HLS A;  2EGP A;  5CRM A;  4OGI A;  2YRE A;  5C87 A;  4WHW A;  2I7K A;  4O74 A;  4N4F A;  5A7C A;  2L80 A;  5HCL A;  4QC3 A;  5E9M A;  3N9P A;  4O78 A;  4LKA A;  5LVR A;  5D3J A;  4N4H A;  2YYR A;  3SOU A;  4CL9 A;  4IR3 A;  2YSJ A;  4AVX A;  5H1V A;  2RFJ A;  4YYN A;  3UV2 A;  4IOR A;  4YBT A;  2YDW A;  3ZYQ A;  5EWD A;  5AIT A;  5HQ7 A;  2F6J A;  4NUD A;  3AAD A;  5CQ3 A;  1LDJ B;  2DVR A;  5J0D A;  4HBW A;  4QEW A;  5ENH A;  2ECN A;  2M85 A;  5ENC A;  5F2P A;  5C7N A;  2MNZ A;  3EB5 A;  5HEN A;  4J1P A;  5CY9 A;  5F60 A;  5A5O A;  5DLZ A;  1WE9 A;  3AQA A;  4C9Z A;  4WZ2 A;  4QR5 A;  1IYM A;  2MNY A;  3SHB A;  5A5R A;  4UYF A;  2YT5 A;  4MR4 A;  4WHU A;  4WA6 A;  5EP7 A;  3S92 A;  1VFY A;  3ZPV 1;  4HXM A;  2OUO A;  5FG5 A;  2YHN A;  5CQT A;  5TBN A;  2KYU A;  2C2L A;  4BHW A;  5F61 A;  3ZYU A;  5LJ0 A;  2L0B A;  2VPE A;  5FFW A;  3M99 A;  5EQ1 A;  2KU3 A;  4IR5 A;  4O7B A;  4L58 A;  2ZET C;  2H60 A;  2VJF A;  2VJE A;  1ZS5 A;  5ENE A;  5FG4 A;  1JM4 B;  3N9N A;  5G4R A;  5IGM A;  5ETB A;  3P1D A;  2KFT A;  3LXJ A;  4UIU A;  1BOR A;  3KV5 A;  1WEV A;  5EPB A;  2FSA A;  4NR5 A;  4UYH A;  2HYE D;  2JMJ A;  4LAD B;  3DPL R;  5TCM A;  2K4D A;  4O7A A;  4XYA A;  3O35 A;  2EOD A;  2LDR A;  4UIZ A;  3IU6 A;  3GV4 A;  2CKL A;  4J0R A;  4O76 A;  3U5M A;  5FH6 A;  2CSZ A;  3HMF A;  4A4C A;  2MUM A;  5CU8 A;  3LQH A;  5FER A;  4GNE A;  1HYJ A;  4QY4 A;  5D3P A;  3U5J A;  2KWK A;  2G4A A;  3QZT A;  2LSP B;  2KTB B;  4QR4 A;  5DX4 A;  5FE3 A;  5KTX A;  3FKM X;  5D7X A;  4S3O B;  3MUK A;  5F1L A;  2R0Y A;  5G05 B;  1FBV A;  4LR6 A;  4IR4 A;  5CUA A;  1JM7 B;  5E9L A;  4HXK A;  2PNX A;  2OXQ C;  4LYI A;  5DKC A;  2MD7 B;  3RPG B;  3O37 A;  4AYC B;  4IOO A;  4XY9 A;  2I8N A;  5DLX A;  4Z1Q A;  5COI A;  3KNV A;  4I7B A;  1JM7 A;  5HM0 A;  1X4J A;  5A5P A;  4YYK A;  1WEP A;  3HTK C;  5HQ5 A;  4UYE A;  4NN2 A;  4ZDT A;  5CRZ A;  4ZQL A;  5E9V A;  5ACY A;  1V87 A;  4NYV A;  4AKN A;  2AN6 A;  4V3L C;  4B7Y C;  5FFY A;  2YQD A;  5H1U A;  1XWH A;  4GB0 A;  2DVS A;  5FE9 A;  3RTR B;  1U6G B;  5D1K B;  4BW4 A;  4QF3 A;  5B78 A;  3ZVZ B;  3DWY A;  4NQM A;  2E6S A;  3O7A A;  2DWW A;  3ONI A;  4A9E A;  1WUM A;  5F1H A;  2L85 A;  5HRW A;  4QBM A;  4NS5 A;  3U5L A;  4Z6I A;  2CT2 A;  4KCX A;  5CQ4 A;  4R2Y A;  5IBN A;  2YEL A;  2IDA A;  2VJE B;  4UI9 B;  4O7C A;  2E6R A;  5E9K A;  3T6R A;  5D3S A;  4TQN A;  2MIQ A;  4YYI A;  4LJN A;  3Q2E A;  2LV9 A;  4Z6H A;  4A9J A;  5LJ2 A;  5CQA A;  5EM3 A;  4ALH A;  2ECJ A;  4MEO A;  4QR3 A;  5EPR A;  3TLP A;  3SOX A;  3UV4 A;  5FE5 A;  5EI4 A;  3ZNI A;  5HQ6 A;  3KQI A;  4QSW A;  4YAT A;  2F42 A;  4N3W A;  5EK9 A;  3P1F A;  4CUU A;  2KE1 A;  5KTU A;  1JOC A;  1F62 A;  3P5O A;  4A4B A;  2L75 A;  4QYD A;  2VPD A;  3KV6 A;  2R0V A;  4UP5 A;  5CP5 A;  5G0F A;  4X3G A;  5D24 A;  5HRX A;  4LDF A;  4MR5 A;  5CZG A;  2YU4 A;  3N9Q A;  5CUB A;  3GL6 A;  3HME A;  4PTB A;  4HXR A;  5CUC A;  5TDW A;  3GG3 A;  4QSX A;  4YYM A;  3HCU A;  5AIU A;  4J3I A;  2H0D A;  5AD2 A;  4YBS A;  3P1C A;  5BT4 A;  3N9L A;  5FE2 A;  2EA6 A;  5FE8 A;  4BW3 A;  5FE4 A;  5HEM A;  5II2 A;  5D3H A;  2KRE A;  4MR6 A;  5A5S A;  2KGI A;  4O72 A;  1N72 A;  3JVL A;  4TTE A;  5CQ8 A;  2RNY A;  5D0C A;  3MHH A;  5KU3 A;  2JMI A;  4F52 B;  4QEU A;  4HXL A;  2ECI A;  5D26 A;  3T7L A;  5E9Y A;  4X2I A;  5BT3 A;  4QUU A;  4IC2 A;  5LJ1 A;  2MD8 C;  5I86 A;  4ZC9 A;  4QSV A;  5HJC A;  4CFL A;  4YYJ A;  2YEM A;  2E7O A;  3G0J A;  4A9K A;  4CUR A;  4NXJ A;  2L5E A;  2WP1 A;  4LC2 A;  5C89 A;  4CLB A;  2XEU A;  4NYW A;  3IU5 A;  4TS8 A;  5H9M A;  3IHP A;  5DYA A;  1WEO A;  4PCE A;  4PPE A;  5I3L A;  4O64 A;  4CUP A;  5I88 A;  4LRG A;  5L8T A;  4FIP A;  4GNG A;  4W4U A;  2HDP A;  4LZS A;  1X4I A;  5J3X A;  5C13 A;  5IGK A;  5A5N A;  1HYI A;  5FFV A;  5FH7 A;  3HMH A;  4NR4 A;  5II1 A;  2RSD A;  5E3D A;  2MT5 A;  4YH3 A;  5FE1 A;  4CUS A;  4A9M A;  5KO4 A;  3VK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...