2M6MA

Solution structure of ring domain of e3 ubiquitin ligase doa10
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
83
structure length
83
Chain Sequence
b'VANEETDTATFNDDAPSGATCRICRGEATEDNPLFHPCKCRGSIKYMHESCLLEWVASKNIDISKPGADVKCDICHYPIQFKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERAD-associated E3 ubiquitin-protein ligase DOA10
publication title Solution structure of RING domain of E3 ubiquitin ligase Doa10
rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 12
structure length 83
sequence length 83
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12906 RINGv RING-variant domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2m6mA00
2MNYA 4V3KC 4A49A 2EA6A 4FJCA 2YYRA 1JOCA 3MHHA 2EGPA 4L58A 3PUQA 1T1HA 2C2LA 2YW8A 1G25A 3HTKC 1X4IA 1IYMA 4S3OB 3ZNIA 4IC3A 3ZPVE 2LGGA 2D8SA 5LKZA 3ZPV1 2CKLA 2BAYA 1WGMA 4I7CA 5C11A 2CSZA 3HCSA 2VPDA 5C13A 3LQHA 4AUQB 4YABA 2H0DA 2KR4A 5B75A 2QIZA 5J3XA 3M99A 2UZGA 2VPEA 2YHOA 2LQ6A 3LQIA 3ZYQA 2DX8A 4L7XA 2KU3A 3GV4A 1RMDA 3PHDA 1XWHA 4UP0A 2L80A 2LGLA 1MM2A 2JMJA 3SOWA 2K1JA 4LK9A 5TRBA 4TKPB 2KGIA 4LLBA 2NAAA 2YU4A 2VPBA 4BHWA 4FK5A 4GNGA 2ECWA 2KYUA 4I7DA 2LRIC 1BORA 2XEUA 2HYED 4N4FA 1DVPA 2ECIA 3KV6A 5D1LB 2YHNA 4YATA 2YSJA 3V43A 2LGKA 1WEWA 1WESA 2G6QA 4N3WA 2KFTA 3L11A 4X3GA 2LGVA 2MA5A 2ECNA 2CSYA 5FERA 3QZVA 4MVTA 2MIQA 2OXQC 3U5OA 2QJ0A 2MD7B 1ZBDB 4R8PK 2QICA 5FEYA 4FIPA 3SHBA 4CA1A 5TDWA 4YBMA 3T7LA 1WENA 4AVXA 1CHCA 2KE1A 2Y43A 3O33A 4AYCB 3O37A 5LCWB 3EB6A 4ZQLA 3N9OA 3O35A 1Z2QA 4GNFA 2LN0A 4PPEA 2F6JA 4V3LC 5H9MA 2YREA 4WZ0A 4LKAA 3ZVZB 3O36A 4P5OB 3O70A 2FUIA 5LKUA 5B8DA 2VNFA 1Z6UA 4B7YC 5I3LA 5DKAA 3O7AA 3I2DA 1V87A 4UI9B 5LKTA 5AIUA 2FUUA 3N9MA 5D1KB 3T6RA 1JM7A 5FB1A 2KWNA 4CCGX 2YUCA 2L75A 5TBNA 4C9ZA 4IC2A 2ECVA 4GNEA 3RPGC 4GB0A 3SOUA 1E4UA 3FL2A 2E6RA 1MM3A 5G04B 4I7BA 2M6MA 2L43A 3N9NA 1VD4A 1WEQA 2MA6A 2M3HA 3EB5A 1N87A 4O64A 2MNZA 2G43A 3VK6A 1WIMA 4R7EA 2L0BA 3RTRB 2M1RA 4R2YA 2KREA 2F6NA 2RSDA 4LADB 1WEVA 5B76A 2ECGA 2PUYA 2CT2A 1WEPA 4Q6FA 2JMDA 2KWOA 1K2FA 3M62A 1WE9A 3C6WA 4QF3A 5B78A 2G45A 1VYXA 2VPGA 1X4UA 2MUMA 2LV9A 4F52B 3N9PA 4YADA 4AYCA 5JG6A 2K16A 4W4UA 2C2VS 2KGGA 5TDRA 1X4JA 1U6GB 1FBVA 4WZ3B 2YQMA 2VJEB 5FB0A 4ZUXU 3ZVYA 2YURA 2HDPA 3N9LA 2VJFB 2XB1A 4FO9A 3PURA 3HCTA 3KNVA 2MD8C 4S3OC 3NG2A 2EODA 3C5KA 4ZDTA 4YC9A 2JRJA 2M85A 4YBSA 3L1ZB 1HYJA 3U5PA 3IHPA 2LXPC 3LQJA 3KQIA 4LJNA 2AN6A 2Y1MA 3U5NA 5DINA 2KWJA 5EYAF 2YSMA 2LDRA 5KH9A 4AP4A 4B86C 2CKLB 2YQLA 4NN2A 1LDJB 2VP7A 3U5MA 2JMIA 3ZTGA 2H0DB 4WA6A 1WEEA 5D1MB 1Z60A 3RPGB 3M63A 1LDKC 5H1TA 4XI1A 1JM7B 1F62A 2ECTA 2E6SA 3SOXA 4BBQA 4A4BA 2FSAA 4QF2A 4PTBA 5AITA 1FP0A 2Y1NA 2F42A 2IDAA 3ASLA 2KIZA 4A4CA 5H1UA 3L1XA 2RI7A 4MSXA 1HYIA 5B77A 2K4DA 2K17A 1WEMA 2KWKA 3GL6A 3LRQA 2LXHC 5B79A 1VFYA 3DPLR 1WFKA 2L5UA 1WEUA 2ECJA 5H1VA 2PNXA 2MT5A 3N9QA 2VJEA 5G0FA 2I50A 3O34A 3KV5A 4YAXA 2ZETC 5G05B 3DQVR 2VJFA 1WILA 4A0CD 1WEOA 3MHSA 5KH3A 5KH7A 3HCUA 4UP5A 4WZ2A 4GNDA 4YBTA 5LKXA 5TABA 2YT5A
chains in the Genus database with same CATH superfamily
2MNYA 4V3KC 4A49A 2EA6A 4FJCA 2YYRA 1JOCA 3MHHA 2EGPA 4L58A 3DWDA 3PUQA 1T1HA 2C2LA 2YW8A 1G25A 3HTKC 1X4IA 2P57A 2EXUA 1IYMA 4S3OB 3ZNIA 4IC3A 3ZPVE 2LGGA 2D8SA 5LKZA 2E61A 3ZPV1 2CKLA 2BAYA 1WGMA 4I7CA 3KDEC 3FAOA 5C11A 2CSZA 2D8UA 3HCSA 2VPDA 5C13A 3LQHA 4AUQB 4YABA 2H0DA 2KR4A 3FJUB 5B75A 3SUBA 2QIZA 5J3XA 3M99A 2CSVA 2UZGA 2VPEA 2MKEA 2YHOA 2LQ6A 3LQIA 3ZYQA 2DX8A 4L7XA 2KU3A 3GV4A 1RMDA 3PHDA 1XWHA 4UP0A 2L80A 2LGLA 3JUEA 1MM2A 2JMJA 2KKXA 3SOWA 2K1JA 4LK9A 5TRBA 4TKPB 3LDYA 2KGIA 4LLBA 2NAAA 2YU4A 2VPBA 4BHWA 2CONA 4FK5A 4GNGA 2XOZA 2ECWA 4I7DA 2KYUA 2LRIC 1BORA 2XEUA 2HYED 4N4FA 1DVPA 2OWAA 2ECIA 3KV6A 5D1LB 2YHNA 5SVIA 4YATA 3PLWA 2YSJA 3V43A 2LGKA 1WEWA 1WESA 2G6QA 4N3WA 2KFTA 3L11A 4X3GA 2LGVA 2MA5A 2ECNA 2CSYA 5FERA 3QZVA 4MVTA 2MIQA 2OXQC 3U5OA 2QJ0A 2MD7B 1ZBDB 4R8PK 2QICA 5FEYA 2YVRA 4FIPA 5SVXA 3SHBA 4CA1A 5TDWA 4YBMA 2FD4A 3O47A 2IQJA 3LVRE 3T7LA 1DCQA 2XOCA 1WENA 4AVXA 1CHCA 2KE1A 2Y43A 3O33A 4AYCB 3O37A 5LCWB 3EB6A 4ZQLA 3N9OA 3O35A 1Z2QA 4GNFA 2LN0A 4PPEA 2F6JA 4V3LC 5H9MA 2YREA 4WZ0A 4LKAA 3ZVZB 3O36A 4P5OB 3O70A 2FUIA 5LKUA 5B8DA 2VNFA 2EGMA 1Z6UA 4B7YC 2RR4A 5I3LA 5DKAA 3O7AA 3I2DA 1V87A 4UI9B 5LKTA 5AIUA 2FUUA 3N9MA 5D1KB 3T6RA 1JM7A 5FB1A 2KWNA 4CCGX 2YUCA 3MDBC 2L75A 5TBNA 4H9DA 4C9ZA 4IC2A 4Z0OA 2ECVA 4GNEA 3RPGC 4GB0A 3SOUA 1MBMA 1E4UA 3FL2A 2E6RA 1MM3A 2CRRA 5G04B 4I7BA 2M6MA 2L43A 3N9NA 1VD4A 2JM3A 1WEQA 2MA6A 2M3HA 3EB5A 1N87A 2B0OE 4O64A 2MNZA 2G43A 3VK6A 1WIMA 4R7EA 2L0BA 2L7PA 2XP0A 3RTRB 2M1RA 4R2YA 2XOYA 2KREA 2F6NA 2M13A 2RSDA 4LADB 1WEVA 5B76A 2ECGA 2PUYA 2CT2A 1WEPA 4Q6FA 3M62A 2JMDA 2KWOA 1K2FA 1WE9A 3C6WA 4QF3A 5B78A 2G45A 1VYXA 2KKYA 2VPGA 2DSMA 1X4UA 2MUMA 2LV9A 4F52B 3N9PA 4YADA 4AYCA 5JG6A 2K16A 4W4UA 2C2VS 2KGGA 5TDRA 3DDTA 2FFWA 1X4JA 1U6GB 4Z0RA 1FBVA 3H7HA 4WZ3B 2YQMA 2VJEB 4QQ4A 5FB0A 4ZUXU 3ZVYA 2YURA 2HDPA 3N9LA 2VJFB 2XB1A 4FO9A 3PURA 3HCTA 3KNVA 2MD8C 4S3OC 3FANA 3NG2A 2EODA 3C5KA 4ZDTA 4OGEA 4YC9A 2JRJA 2M85A 4YBSA 3L1ZB 2LAUA 1HYJA 3U5PA 3T9KA 3IHPA 2LXPC 3LQJA 3KQIA 4LJNA 2AN6A 2Y1MA 3U5NA 5DINA 2KWJA 5EYAF 2YSMA 2LDRA 5KH9A 4AP4A 4B86C 2CKLB 2YQLA 4NN2A 1LDJB 2VP7A 3U5MA 3LVQE 2JMIA 3ZTGA 2H0DB 4WA6A 1WEEA 5D1MB 1Z60A 3RPGB 4OGCA 3M63A 1LDKC 5H1TA 2DJAA 4XI1A 5K3QA 1JM7B 1F62A 2ECTA 2E6SA 3SOXA 3M7KA 3Q1DA 4BBQA 3FEHA 4A4BA 2FSAA 4QF2A 4PTBA 5AITA 1FP0A 2Y1NA 2F42A 2IDAA 3ASLA 2KIZA 4A4CA 3FM8C 4F1PA 2JUNA 5H1UA 5SVYA 3L1XA 2RI7A 4MSXA 1HYIA 5B77A 2K4DA 2K17A 1WEMA 2KWKA 3GL6A 3LRQA 2LXHC 5B79A 5SVIB 1VFYA 4O62A 3DPLR 1WFKA 2L5UA 1WEUA 2ECJA 5H1VA 2PNXA 2MT5A 3N9QA 2VJEA 5G0FA 2I50A 3LJUX 3O34A 3KV5A 4YAXA 2ZETC 5G05B 3DQVR 2CRWA 2VJFA 1WILA 3E2DA 4A0CD 1WEOA 3MHSA 5KH3A 5KH7A 3HCUA 4UP5A 4WZ2A 4GNDA 4YBTA 5LKXA 5TABA 2YT5A
chains in the Genus database with same CATH topology
2MNYA 4V3KC 4A49A 2EA6A 4FJCA 2YYRA 1JOCA 3MHHA 2EGPA 4L58A 3PUQA 1T1HA 2C2LA 2YW8A 1G25A 3HTKC 1X4IA 1IYMA 4S3OB 3ZNIA 4IC3A 3ZPVE 2LGGA 2D8SA 5LKZA 3ZPV1 2CKLA 2BAYA 1WGMA 4I7CA 5C11A 2CSZA 3HCSA 2VPDA 5C13A 3LQHA 4AUQB 4YABA 2H0DA 2KR4A 5B75A 2QIZA 5J3XA 3M99A 2UZGA 2VPEA 2YHOA 2LQ6A 3LQIA 3ZYQA 2DX8A 4L7XA 2KU3A 3GV4A 1RMDA 3PHDA 1XWHA 4UP0A 2L80A 2LGLA 1MM2A 2JMJA 3SOWA 2K1JA 4LK9A 5TRBA 4TKPB 2KGIA 4LLBA 2NAAA 2YU4A 2VPBA 4BHWA 4FK5A 4GNGA 2ECWA 2KYUA 4I7DA 2LRIC 1BORA 2XEUA 2HYED 4N4FA 1DVPA 2ECIA 3KV6A 5D1LB 2YHNA 4YATA 2YSJA 3V43A 2LGKA 1WEWA 1WESA 2G6QA 4N3WA 2KFTA 3L11A 4X3GA 2LGVA 2MA5A 2ECNA 2CSYA 5FERA 3QZVA 4MVTA 2MIQA 2OXQC 3U5OA 2QJ0A 2MD7B 1ZBDB 4R8PK 2QICA 5FEYA 4FIPA 3SHBA 4CA1A 5TDWA 4YBMA 3T7LA 1WENA 4AVXA 1CHCA 2KE1A 2Y43A 3O33A 4AYCB 3O37A 5LCWB 3EB6A 4ZQLA 3N9OA 3O35A 1Z2QA 4GNFA 2LN0A 4PPEA 2F6JA 4V3LC 5H9MA 2YREA 4WZ0A 4LKAA 3ZVZB 3O36A 4P5OB 3O70A 2FUIA 5LKUA 5B8DA 2VNFA 1Z6UA 4B7YC 5I3LA 5DKAA 3O7AA 3I2DA 1V87A 4UI9B 5LKTA 5AIUA 2FUUA 3N9MA 5D1KB 3T6RA 1JM7A 5FB1A 2KWNA 4CCGX 2YUCA 2L75A 5TBNA 4C9ZA 4IC2A 2ECVA 4GNEA 3RPGC 4GB0A 3SOUA 1E4UA 3FL2A 2E6RA 1MM3A 5G04B 4I7BA 2M6MA 2L43A 3N9NA 1VD4A 1WEQA 2MA6A 2M3HA 3EB5A 1N87A 4O64A 2MNZA 2G43A 3VK6A 1WIMA 4R7EA 2L0BA 3RTRB 2M1RA 4R2YA 2KREA 2F6NA 2RSDA 4LADB 1WEVA 5B76A 2ECGA 2PUYA 2CT2A 1WEPA 4Q6FA 2JMDA 2KWOA 1K2FA 3M62A 1WE9A 3C6WA 4QF3A 5B78A 2G45A 1VYXA 2VPGA 1X4UA 2MUMA 2LV9A 4F52B 3N9PA 4YADA 4AYCA 5JG6A 2K16A 4W4UA 2C2VS 2KGGA 5TDRA 1X4JA 1U6GB 1FBVA 4WZ3B 2YQMA 2VJEB 5FB0A 4ZUXU 3ZVYA 2YURA 2HDPA 3N9LA 2VJFB 2XB1A 4FO9A 3PURA 3HCTA 3KNVA 2MD8C 4S3OC 3NG2A 2EODA 3C5KA 4ZDTA 4YC9A 2JRJA 2M85A 4YBSA 3L1ZB 1HYJA 3U5PA 3IHPA 2LXPC 3LQJA 3KQIA 4LJNA 2AN6A 2Y1MA 3U5NA 5DINA 2KWJA 5EYAF 2YSMA 2LDRA 5KH9A 4AP4A 4B86C 2CKLB 2YQLA 4NN2A 1LDJB 2VP7A 3U5MA 2JMIA 3ZTGA 2H0DB 4WA6A 1WEEA 5D1MB 1Z60A 3RPGB 3M63A 1LDKC 5H1TA 4XI1A 1JM7B 1F62A 2ECTA 2E6SA 3SOXA 4BBQA 4A4BA 2FSAA 4QF2A 4PTBA 5AITA 1FP0A 2Y1NA 2F42A 2IDAA 3ASLA 2KIZA 4A4CA 5H1UA 3L1XA 2RI7A 4MSXA 1HYIA 5B77A 2K4DA 2K17A 1WEMA 2KWKA 3GL6A 3LRQA 2LXHC 5B79A 1VFYA 3DPLR 1WFKA 2L5UA 1WEUA 2ECJA 5H1VA 2PNXA 2MT5A 3N9QA 2VJEA 5G0FA 2I50A 3O34A 3KV5A 4YAXA 2ZETC 5G05B 3DQVR 2VJFA 1WILA 4A0CD 1WEOA 3MHSA 5KH3A 5KH7A 3HCUA 4UP5A 4WZ2A 4GNDA 4YBTA 5LKXA 5TABA 2YT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNY A;  4V3K C;  4A49 A;  2EA6 A;  4FJC A;  2YYR A;  1JOC A;  3MHH A;  2EGP A;  4L58 A;  3PUQ A;  1T1H A;  2C2L A;  2YW8 A;  1G25 A;  3HTK C;  1X4I A;  1IYM A;  4S3O B;  3ZNI A;  4IC3 A;  3ZPV E;  2LGG A;  2D8S A;  5LKZ A;  3ZPV 1;  2CKL A;  2BAY A;  1WGM A;  4I7C A;  5C11 A;  2CSZ A;  3HCS A;  2VPD A;  5C13 A;  3LQH A;  4AUQ B;  4YAB A;  2H0D A;  2KR4 A;  5B75 A;  2QIZ A;  5J3X A;  3M99 A;  2UZG A;  2VPE A;  2YHO A;  2LQ6 A;  3LQI A;  3ZYQ A;  2DX8 A;  4L7X A;  2KU3 A;  3GV4 A;  1RMD A;  3PHD A;  1XWH A;  4UP0 A;  2L80 A;  2LGL A;  1MM2 A;  2JMJ A;  3SOW A;  2K1J A;  4LK9 A;  5TRB A;  4TKP B;  2KGI A;  4LLB A;  2NAA A;  2YU4 A;  2VPB A;  4BHW A;  4FK5 A;  4GNG A;  2ECW A;  2KYU A;  4I7D A;  2LRI C;  1BOR A;  2XEU A;  2HYE D;  4N4F A;  1DVP A;  2ECI A;  3KV6 A;  5D1L B;  2YHN A;  4YAT A;  2YSJ A;  3V43 A;  2LGK A;  1WEW A;  1WES A;  2G6Q A;  4N3W A;  2KFT A;  3L11 A;  4X3G A;  2LGV A;  2MA5 A;  2ECN A;  2CSY A;  5FER A;  3QZV A;  4MVT A;  2MIQ A;  2OXQ C;  3U5O A;  2QJ0 A;  2MD7 B;  1ZBD B;  4R8P K;  2QIC A;  5FEY A;  4FIP A;  3SHB A;  4CA1 A;  5TDW A;  4YBM A;  3T7L A;  1WEN A;  4AVX A;  1CHC A;  2KE1 A;  2Y43 A;  3O33 A;  4AYC B;  3O37 A;  5LCW B;  3EB6 A;  4ZQL A;  3N9O A;  3O35 A;  1Z2Q A;  4GNF A;  2LN0 A;  4PPE A;  2F6J A;  4V3L C;  5H9M A;  2YRE A;  4WZ0 A;  4LKA A;  3ZVZ B;  3O36 A;  4P5O B;  3O70 A;  2FUI A;  5LKU A;  5B8D A;  2VNF A;  1Z6U A;  4B7Y C;  5I3L A;  5DKA A;  3O7A A;  3I2D A;  1V87 A;  4UI9 B;  5LKT A;  5AIU A;  2FUU A;  3N9M A;  5D1K B;  3T6R A;  1JM7 A;  5FB1 A;  2KWN A;  4CCG X;  2YUC A;  2L75 A;  5TBN A;  4C9Z A;  4IC2 A;  2ECV A;  4GNE A;  3RPG C;  4GB0 A;  3SOU A;  1E4U A;  3FL2 A;  2E6R A;  1MM3 A;  5G04 B;  4I7B A;  2M6M A;  2L43 A;  3N9N A;  1VD4 A;  1WEQ A;  2MA6 A;  2M3H A;  3EB5 A;  1N87 A;  4O64 A;  2MNZ A;  2G43 A;  3VK6 A;  1WIM A;  4R7E A;  2L0B A;  3RTR B;  2M1R A;  4R2Y A;  2KRE A;  2F6N A;  2RSD A;  4LAD B;  1WEV A;  5B76 A;  2ECG A;  2PUY A;  2CT2 A;  1WEP A;  4Q6F A;  2JMD A;  2KWO A;  1K2F A;  3M62 A;  1WE9 A;  3C6W A;  4QF3 A;  5B78 A;  2G45 A;  1VYX A;  2VPG A;  1X4U A;  2MUM A;  2LV9 A;  4F52 B;  3N9P A;  4YAD A;  4AYC A;  5JG6 A;  2K16 A;  4W4U A;  2C2V S;  2KGG A;  5TDR A;  1X4J A;  1U6G B;  1FBV A;  4WZ3 B;  2YQM A;  2VJE B;  5FB0 A;  4ZUX U;  3ZVY A;  2YUR A;  2HDP A;  3N9L A;  2VJF B;  2XB1 A;  4FO9 A;  3PUR A;  3HCT A;  3KNV A;  2MD8 C;  4S3O C;  3NG2 A;  2EOD A;  3C5K A;  4ZDT A;  4YC9 A;  2JRJ A;  2M85 A;  4YBS A;  3L1Z B;  1HYJ A;  3U5P A;  3IHP A;  2LXP C;  3LQJ A;  3KQI A;  4LJN A;  2AN6 A;  2Y1M A;  3U5N A;  5DIN A;  2KWJ A;  5EYA F;  2YSM A;  2LDR A;  5KH9 A;  4AP4 A;  4B86 C;  2CKL B;  2YQL A;  4NN2 A;  1LDJ B;  2VP7 A;  3U5M A;  2JMI A;  3ZTG A;  2H0D B;  4WA6 A;  1WEE A;  5D1M B;  1Z60 A;  3RPG B;  3M63 A;  1LDK C;  5H1T A;  4XI1 A;  1JM7 B;  1F62 A;  2ECT A;  2E6S A;  3SOX A;  4BBQ A;  4A4B A;  2FSA A;  4QF2 A;  4PTB A;  5AIT A;  1FP0 A;  2Y1N A;  2F42 A;  2IDA A;  3ASL A;  2KIZ A;  4A4C A;  5H1U A;  3L1X A;  2RI7 A;  4MSX A;  1HYI A;  5B77 A;  2K4D A;  2K17 A;  1WEM A;  2KWK A;  3GL6 A;  3LRQ A;  2LXH C;  5B79 A;  1VFY A;  3DPL R;  1WFK A;  2L5U A;  1WEU A;  2ECJ A;  5H1V A;  2PNX A;  2MT5 A;  3N9Q A;  2VJE A;  5G0F A;  2I50 A;  3O34 A;  3KV5 A;  4YAX A;  2ZET C;  5G05 B;  3DQV R;  2VJF A;  1WIL A;  4A0C D;  1WEO A;  3MHS A;  5KH3 A;  5KH7 A;  3HCU A;  4UP5 A;  4WZ2 A;  4GND A;  4YBT A;  5LKX A;  5TAB A;  2YT5 A; 
#chains in the Genus database with same CATH topology
 2MNY A;  4V3K C;  4A49 A;  2EA6 A;  4FJC A;  2YYR A;  1JOC A;  3MHH A;  2EGP A;  4L58 A;  3DWD A;  3PUQ A;  1T1H A;  2C2L A;  2YW8 A;  1G25 A;  3HTK C;  1X4I A;  2P57 A;  2EXU A;  1IYM A;  4S3O B;  3ZNI A;  4IC3 A;  3ZPV E;  2LGG A;  2D8S A;  5LKZ A;  2E61 A;  3ZPV 1;  2CKL A;  2BAY A;  1WGM A;  4I7C A;  3KDE C;  3FAO A;  5C11 A;  2CSZ A;  2D8U A;  3HCS A;  2VPD A;  5C13 A;  3LQH A;  4AUQ B;  4YAB A;  2H0D A;  2KR4 A;  3FJU B;  5B75 A;  3SUB A;  2QIZ A;  5J3X A;  3M99 A;  2CSV A;  2UZG A;  2VPE A;  2MKE A;  2YHO A;  2LQ6 A;  3LQI A;  3ZYQ A;  2DX8 A;  4L7X A;  2KU3 A;  3GV4 A;  1RMD A;  3PHD A;  1XWH A;  4UP0 A;  2L80 A;  2LGL A;  3JUE A;  1MM2 A;  2JMJ A;  2KKX A;  3SOW A;  2K1J A;  4LK9 A;  5TRB A;  4TKP B;  3LDY A;  2KGI A;  4LLB A;  2NAA A;  2YU4 A;  2VPB A;  4BHW A;  2CON A;  4FK5 A;  4GNG A;  2XOZ A;  2ECW A;  4I7D A;  2KYU A;  2LRI C;  1BOR A;  2XEU A;  2HYE D;  4N4F A;  1DVP A;  2OWA A;  2ECI A;  3KV6 A;  5D1L B;  2YHN A;  5SVI A;  4YAT A;  3PLW A;  2YSJ A;  3V43 A;  2LGK A;  1WEW A;  1WES A;  2G6Q A;  4N3W A;  2KFT A;  3L11 A;  4X3G A;  2LGV A;  2MA5 A;  2ECN A;  2CSY A;  5FER A;  3QZV A;  4MVT A;  2MIQ A;  2OXQ C;  3U5O A;  2QJ0 A;  2MD7 B;  1ZBD B;  4R8P K;  2QIC A;  5FEY A;  2YVR A;  4FIP A;  5SVX A;  3SHB A;  4CA1 A;  5TDW A;  4YBM A;  2FD4 A;  3O47 A;  2IQJ A;  3LVR E;  3T7L A;  1DCQ A;  2XOC A;  1WEN A;  4AVX A;  1CHC A;  2KE1 A;  2Y43 A;  3O33 A;  4AYC B;  3O37 A;  5LCW B;  3EB6 A;  4ZQL A;  3N9O A;  3O35 A;  1Z2Q A;  4GNF A;  2LN0 A;  4PPE A;  2F6J A;  4V3L C;  5H9M A;  2YRE A;  4WZ0 A;  4LKA A;  3ZVZ B;  3O36 A;  4P5O B;  3O70 A;  2FUI A;  5LKU A;  5B8D A;  2VNF A;  2EGM A;  1Z6U A;  4B7Y C;  2RR4 A;  5I3L A;  5DKA A;  3O7A A;  3I2D A;  1V87 A;  4UI9 B;  5LKT A;  5AIU A;  2FUU A;  3N9M A;  5D1K B;  3T6R A;  1JM7 A;  5FB1 A;  2KWN A;  4CCG X;  2YUC A;  3MDB C;  2L75 A;  5TBN A;  4H9D A;  4C9Z A;  4IC2 A;  4Z0O A;  2ECV A;  4GNE A;  3RPG C;  4GB0 A;  3SOU A;  1MBM A;  1E4U A;  3FL2 A;  2E6R A;  1MM3 A;  2CRR A;  5G04 B;  4I7B A;  2M6M A;  2L43 A;  3N9N A;  1VD4 A;  2JM3 A;  1WEQ A;  2MA6 A;  2M3H A;  3EB5 A;  1N87 A;  2B0O E;  4O64 A;  2MNZ A;  2G43 A;  3VK6 A;  1WIM A;  4R7E A;  2L0B A;  2L7P A;  2XP0 A;  3RTR B;  2M1R A;  4R2Y A;  2XOY A;  2KRE A;  2F6N A;  2M13 A;  2RSD A;  4LAD B;  1WEV A;  5B76 A;  2ECG A;  2PUY A;  2CT2 A;  1WEP A;  4Q6F A;  3M62 A;  2JMD A;  2KWO A;  1K2F A;  1WE9 A;  3C6W A;  4QF3 A;  5B78 A;  2G45 A;  1VYX A;  2KKY A;  2VPG A;  2DSM A;  1X4U A;  2MUM A;  2LV9 A;  4F52 B;  3N9P A;  4YAD A;  4AYC A;  5JG6 A;  2K16 A;  4W4U A;  2C2V S;  2KGG A;  5TDR A;  3DDT A;  2FFW A;  1X4J A;  1U6G B;  4Z0R A;  1FBV A;  3H7H A;  4WZ3 B;  2YQM A;  2VJE B;  4QQ4 A;  5FB0 A;  4ZUX U;  3ZVY A;  2YUR A;  2HDP A;  3N9L A;  2VJF B;  2XB1 A;  4FO9 A;  3PUR A;  3HCT A;  3KNV A;  2MD8 C;  4S3O C;  3FAN A;  3NG2 A;  2EOD A;  3C5K A;  4ZDT A;  4OGE A;  4YC9 A;  2JRJ A;  2M85 A;  4YBS A;  3L1Z B;  2LAU A;  1HYJ A;  3U5P A;  3T9K A;  3IHP A;  2LXP C;  3LQJ A;  3KQI A;  4LJN A;  2AN6 A;  2Y1M A;  3U5N A;  5DIN A;  2KWJ A;  5EYA F;  2YSM A;  2LDR A;  5KH9 A;  4AP4 A;  4B86 C;  2CKL B;  2YQL A;  4NN2 A;  1LDJ B;  2VP7 A;  3U5M A;  3LVQ E;  2JMI A;  3ZTG A;  2H0D B;  4WA6 A;  1WEE A;  5D1M B;  1Z60 A;  3RPG B;  4OGC A;  3M63 A;  1LDK C;  5H1T A;  2DJA A;  4XI1 A;  5K3Q A;  1JM7 B;  1F62 A;  2ECT A;  2E6S A;  3SOX A;  3M7K A;  3Q1D A;  4BBQ A;  3FEH A;  4A4B A;  2FSA A;  4QF2 A;  4PTB A;  5AIT A;  1FP0 A;  2Y1N A;  2F42 A;  2IDA A;  3ASL A;  2KIZ A;  4A4C A;  3FM8 C;  4F1P A;  2JUN A;  5H1U A;  5SVY A;  3L1X A;  2RI7 A;  4MSX A;  1HYI A;  5B77 A;  2K4D A;  2K17 A;  1WEM A;  2KWK A;  3GL6 A;  3LRQ A;  2LXH C;  5B79 A;  5SVI B;  1VFY A;  4O62 A;  3DPL R;  1WFK A;  2L5U A;  1WEU A;  2ECJ A;  5H1V A;  2PNX A;  2MT5 A;  3N9Q A;  2VJE A;  5G0F A;  2I50 A;  3LJU X;  3O34 A;  3KV5 A;  4YAX A;  2ZET C;  5G05 B;  3DQV R;  2CRW A;  2VJF A;  1WIL A;  3E2D A;  4A0C D;  1WEO A;  3MHS A;  5KH3 A;  5KH7 A;  3HCU A;  4UP5 A;  4WZ2 A;  4GND A;  4YBT A;  5LKX A;  5TAB A;  2YT5 A; 
#chains in the Genus database with same CATH homology
 2MNY A;  4V3K C;  4A49 A;  2EA6 A;  4FJC A;  2YYR A;  1JOC A;  3MHH A;  2EGP A;  4L58 A;  3PUQ A;  1T1H A;  2C2L A;  2YW8 A;  1G25 A;  3HTK C;  1X4I A;  1IYM A;  4S3O B;  3ZNI A;  4IC3 A;  3ZPV E;  2LGG A;  2D8S A;  5LKZ A;  3ZPV 1;  2CKL A;  2BAY A;  1WGM A;  4I7C A;  5C11 A;  2CSZ A;  3HCS A;  2VPD A;  5C13 A;  3LQH A;  4AUQ B;  4YAB A;  2H0D A;  2KR4 A;  5B75 A;  2QIZ A;  5J3X A;  3M99 A;  2UZG A;  2VPE A;  2YHO A;  2LQ6 A;  3LQI A;  3ZYQ A;  2DX8 A;  4L7X A;  2KU3 A;  3GV4 A;  1RMD A;  3PHD A;  1XWH A;  4UP0 A;  2L80 A;  2LGL A;  1MM2 A;  2JMJ A;  3SOW A;  2K1J A;  4LK9 A;  5TRB A;  4TKP B;  2KGI A;  4LLB A;  2NAA A;  2YU4 A;  2VPB A;  4BHW A;  4FK5 A;  4GNG A;  2ECW A;  2KYU A;  4I7D A;  2LRI C;  1BOR A;  2XEU A;  2HYE D;  4N4F A;  1DVP A;  2ECI A;  3KV6 A;  5D1L B;  2YHN A;  4YAT A;  2YSJ A;  3V43 A;  2LGK A;  1WEW A;  1WES A;  2G6Q A;  4N3W A;  2KFT A;  3L11 A;  4X3G A;  2LGV A;  2MA5 A;  2ECN A;  2CSY A;  5FER A;  3QZV A;  4MVT A;  2MIQ A;  2OXQ C;  3U5O A;  2QJ0 A;  2MD7 B;  1ZBD B;  4R8P K;  2QIC A;  5FEY A;  4FIP A;  3SHB A;  4CA1 A;  5TDW A;  4YBM A;  3T7L A;  1WEN A;  4AVX A;  1CHC A;  2KE1 A;  2Y43 A;  3O33 A;  4AYC B;  3O37 A;  5LCW B;  3EB6 A;  4ZQL A;  3N9O A;  3O35 A;  1Z2Q A;  4GNF A;  2LN0 A;  4PPE A;  2F6J A;  4V3L C;  5H9M A;  2YRE A;  4WZ0 A;  4LKA A;  3ZVZ B;  3O36 A;  4P5O B;  3O70 A;  2FUI A;  5LKU A;  5B8D A;  2VNF A;  1Z6U A;  4B7Y C;  5I3L A;  5DKA A;  3O7A A;  3I2D A;  1V87 A;  4UI9 B;  5LKT A;  5AIU A;  2FUU A;  3N9M A;  5D1K B;  3T6R A;  1JM7 A;  5FB1 A;  2KWN A;  4CCG X;  2YUC A;  2L75 A;  5TBN A;  4C9Z A;  4IC2 A;  2ECV A;  4GNE A;  3RPG C;  4GB0 A;  3SOU A;  1E4U A;  3FL2 A;  2E6R A;  1MM3 A;  5G04 B;  4I7B A;  2M6M A;  2L43 A;  3N9N A;  1VD4 A;  1WEQ A;  2MA6 A;  2M3H A;  3EB5 A;  1N87 A;  4O64 A;  2MNZ A;  2G43 A;  3VK6 A;  1WIM A;  4R7E A;  2L0B A;  3RTR B;  2M1R A;  4R2Y A;  2KRE A;  2F6N A;  2RSD A;  4LAD B;  1WEV A;  5B76 A;  2ECG A;  2PUY A;  2CT2 A;  1WEP A;  4Q6F A;  2JMD A;  2KWO A;  1K2F A;  3M62 A;  1WE9 A;  3C6W A;  4QF3 A;  5B78 A;  2G45 A;  1VYX A;  2VPG A;  1X4U A;  2MUM A;  2LV9 A;  4F52 B;  3N9P A;  4YAD A;  4AYC A;  5JG6 A;  2K16 A;  4W4U A;  2C2V S;  2KGG A;  5TDR A;  1X4J A;  1U6G B;  1FBV A;  4WZ3 B;  2YQM A;  2VJE B;  5FB0 A;  4ZUX U;  3ZVY A;  2YUR A;  2HDP A;  3N9L A;  2VJF B;  2XB1 A;  4FO9 A;  3PUR A;  3HCT A;  3KNV A;  2MD8 C;  4S3O C;  3NG2 A;  2EOD A;  3C5K A;  4ZDT A;  4YC9 A;  2JRJ A;  2M85 A;  4YBS A;  3L1Z B;  1HYJ A;  3U5P A;  3IHP A;  2LXP C;  3LQJ A;  3KQI A;  4LJN A;  2AN6 A;  2Y1M A;  3U5N A;  5DIN A;  2KWJ A;  5EYA F;  2YSM A;  2LDR A;  5KH9 A;  4AP4 A;  4B86 C;  2CKL B;  2YQL A;  4NN2 A;  1LDJ B;  2VP7 A;  3U5M A;  2JMI A;  3ZTG A;  2H0D B;  4WA6 A;  1WEE A;  5D1M B;  1Z60 A;  3RPG B;  3M63 A;  1LDK C;  5H1T A;  4XI1 A;  1JM7 B;  1F62 A;  2ECT A;  2E6S A;  3SOX A;  4BBQ A;  4A4B A;  2FSA A;  4QF2 A;  4PTB A;  5AIT A;  1FP0 A;  2Y1N A;  2F42 A;  2IDA A;  3ASL A;  2KIZ A;  4A4C A;  5H1U A;  3L1X A;  2RI7 A;  4MSX A;  1HYI A;  5B77 A;  2K4D A;  2K17 A;  1WEM A;  2KWK A;  3GL6 A;  3LRQ A;  2LXH C;  5B79 A;  1VFY A;  3DPL R;  1WFK A;  2L5U A;  1WEU A;  2ECJ A;  5H1V A;  2PNX A;  2MT5 A;  3N9Q A;  2VJE A;  5G0F A;  2I50 A;  3O34 A;  3KV5 A;  4YAX A;  2ZET C;  5G05 B;  3DQV R;  2VJF A;  1WIL A;  4A0C D;  1WEO A;  3MHS A;  5KH3 A;  5KH7 A;  3HCU A;  4UP5 A;  4WZ2 A;  4GND A;  4YBT A;  5LKX A;  5TAB A;  2YT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...