2MKEA

Solution structure of cpeb1 zz domain in the free state
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
b'IDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytoplasmic polyadenylation element-binding protein 1
publication title A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation regulator
total genus 8
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.130 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2mkeA00
2MKEA 2M13A
chains in the Genus database with same CATH superfamily
1RMDA 2UZGA 1WILA 3N9MA 2G45A 3NG2A 1ZBDB 2D8UA 3KV6A 3FM8C 1WEOA 3O70A 4GNGA 2LRIC 1N87A 4FJCA 4F52B 5LKXA 2FFWA 2JMJA 5TDWA 1WEMA 4YADA 3RPGB 5H1TA 4LKAA 5AITA 1VD4A 2KYUA 4CCGX 2KR4A 3N9PA 5TBNA 1XWHA 4UP0A 2ZETC 2YUCA 3LQHA 1WEQA 4CA1A 2VP7A 2KWJA 4FO9A 4YBMA 4V3LC 2M1RA 3DWDA 2LV9A 3GL6A 3RTRB 4IC3A 3HCSA 4N3WA 1HYIA 3HTKC 3ZPVE 2MNZA 3SOWA 2EGMA 2XOZA 4AP4A 2ECNA 2ECJA 2FSAA 2JMIA 3ZVYA 5B8DA 1WGMA 3V43A 2MT5A 4ZQLA 2ECIA 3M63A 3QZVA 2YW8A 5H1VA 5AIUA 2I50A 4GNFA 2CKLA 1Z2QA 1VYXA 1MBMA 4L7XA 3O37A 3RPGC 3EB5A 4BHWA 5SVXA 5TRBA 3LVQE 4R2YA 1WENA 4O64A 2M13A 1G25A 4YBSA 3U5NA 1WIMA 1X4UA 2MKEA 3DPLR 2YQMA 3N9NA 4UI9B 4FIPA 1HYJA 1X4IA 3H7HA 2QJ0A 5C13A 4GB0A 3FJUB 5KH7A 2OXQC 4LLBA 2DSMA 3GV4A 2KWOA 5LKTA 4LK9A 1Z60A 2M85A 2KGGA 3MHHA 2VJFB 4WZ2A 2VJEA 2KFTA 3MHSA 4S3OC 4UP5A 2L43A 4P5OB 3EB6A 5KH9A 3N9QA 5SVIA 2HDPA 2EXUA 1DCQA 5KH3A 2L0BA 2YQLA 5B75A 2CONA 5I3LA 3FANA 5FERA 4WZ0A 2YYRA 4LADB 4LJNA 1WEVA 2C2VS 3HCUA 1WEWA 3LRQA 2YT5A 1WE9A 2L80A 2YHOA 4N4FA 3LJUX 2ECGA 2YVRA 1WESA 3C5KA 5B76A 2VPDA 2CKLB 5C11A 4F1PA 2KKYA 2QICA 3FAOA 3ZYQA 5TDRA 3MDBC 5B79A 4AYCA 2L75A 2K17A 2YU4A 1MM3A 4B7YC 5B77A 3O33A 2CSYA 3KNVA 5DKAA 2IQJA 4AVXA 5G0FA 5K3QA 1V87A 2LN0A 4O62A 3I2DA 1JM7B 2YSMA 2H0DA 2P57A 3ZPV1 2LXHC 2KWKA 3KV5A 4Z0RA 2XP0A 4AUQB 1BORA 3HCTA 4OGCA 2IDAA 2CSVA 2KIZA 5EYAF 3T9KA 3DQVR 5D1LB 4H9DA 5LKZA 1X4JA 3SHBA 5LKUA 2QIZA 3PLWA 1U6GB 2PUYA 2DJAA 4ZUXU 3SUBA 4A0CD 2RSDA 3O35A 4YAXA 2RR4A 2F6NA 2ECWA 2XOCA 2XEUA 3DDTA 3L1ZB 3O7AA 3KQIA 4PPEA 5TABA 1JOCA 2KKXA 2LGLA 5LCWB 3C6WA 2FUUA 3LVRE 3M99A 3Q1DA 5D1KB 4B86C 2L7PA 4AYCB 4QQ4A 2JRJA 3JUEA 5FB0A 4OGEA 2M6MA 2CSZA 4A4BA 2LGVA 2LGGA 4GNEA 1FBVA 5JG6A 1LDJB 5H9MA 2K4DA 2MA6A 2VPGA 2OWAA 2C2LA 2EODA 2K16A 3L1XA 4YABA 2FD4A 1DVPA 4TKPB 2DX8A 2HYED 4X3GA 1LDKC 3O47A 2JMDA 3ASLA 2MNYA 2MIQA 1CHCA 3KDEC 5G04B 5D1MB 1F62A 4YC9A 4A4CA 1IYMA 2PNXA 4Z0OA 3T7LA 4XI1A 1MM2A 5SVYA 2MA5A 3E2DA 3M62A 2JM3A 2G43A 3VK6A 2VJFA 2Y1NA 3U5MA 3LQIA 3LDYA 4I7BA 4MSXA 2EA6A 4WA6A 4I7CA 2M3HA 3N9OA 5J3XA 5G05B 2YSJA 2VPEA 3T6RA 4Q6FA 2RI7A 1Z6UA 3O34A 1WEEA 2XOYA 5FB1A 2EGPA 2B0OE 2E6RA 2VJEB 4PTBA 1K2FA 3L11A 2YREA 4S3OB 2G6QA 2CRRA 2VPBA 2LDRA 5SVIB 5B78A 1WFKA 2MUMA 1T1HA 1WEPA 2Y43A 2E6SA 3LQJA 4YBTA 2KU3A 2LAUA 3U5OA 4QF3A 4W4UA 2KREA 2Y1MA 4BBQA 2CRWA 3ZVZB 2FUIA 2BAYA 2F42A 3ZTGA 4IC2A 2KWNA 4V3KC 3PHDA 2D8SA 4ZDTA 4L58A 2AN6A 3SOUA 3PURA 2ECTA 3FEHA 4C9ZA 5DINA 2CT2A 2LXPC 5H1UA 4A49A 3IHPA 4QF2A 3ZNIA 2JUNA 4MVTA 2F6JA 1VFYA 2XB1A 3SOXA 2ECVA 2LGKA 3M7KA 2K1JA 1JM7A 1WEUA 4YATA 5FEYA 2YURA 4I7DA 4WZ3B 2KE1A 4NN2A 4R8PK 4GNDA 3FL2A 4R7EA 2NAAA 1FP0A 2LQ6A 2MD7B 2VNFA 2YHNA 2L5UA 4FK5A 3U5PA 2MD8C 2KGIA 2E61A 3PUQA 3O36A 1E4UA 2H0DB 3N9LA
chains in the Genus database with same CATH topology
3JUEA 5SVIA 5SVYA 3LJUX 2IQJA 4H9DA 2XOYA 2CRWA 2YVRA 3E2DA 5K3QA 2RR4A 3H7HA 2B0OE 2JM3A 4O62A 2XOCA 3DDTA 3FJUB 3O47A 2YREA 4OGEA 2EXUA 2D8UA 4F1PA 2CRRA 2EGMA 1DCQA 2KKYA 2XOZA 3LDYA 5SVXA 2KKXA 2P57A 5SVIB 3LVQE 3MDBC 3FM8C 3KDEC 3FEHA 2CONA 4Z0RA 3PLWA 2M13A 3LVRE 2XP0A 3Q1DA 2LAUA 2FFWA 2E61A 2JUNA 2MKEA 2DJAA 3DWDA 4Z0OA 4OGCA 2CSVA 2OWAA 3SUBA 2L7PA 3M7KA 3T9KA 4QQ4A 2FD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKE A;  2M13 A; 
#chains in the Genus database with same CATH topology
 1RMD A;  2UZG A;  1WIL A;  3N9M A;  2G45 A;  3NG2 A;  1ZBD B;  2D8U A;  3KV6 A;  3FM8 C;  1WEO A;  3O70 A;  4GNG A;  2LRI C;  1N87 A;  4FJC A;  4F52 B;  5LKX A;  2FFW A;  2JMJ A;  5TDW A;  1WEM A;  4YAD A;  3RPG B;  5H1T A;  4LKA A;  5AIT A;  1VD4 A;  2KYU A;  4CCG X;  2KR4 A;  3N9P A;  5TBN A;  1XWH A;  4UP0 A;  2ZET C;  2YUC A;  3LQH A;  1WEQ A;  4CA1 A;  2VP7 A;  2KWJ A;  4FO9 A;  4YBM A;  4V3L C;  2M1R A;  3DWD A;  2LV9 A;  3GL6 A;  3RTR B;  4IC3 A;  3HCS A;  4N3W A;  1HYI A;  3HTK C;  3ZPV E;  2MNZ A;  3SOW A;  2EGM A;  2XOZ A;  4AP4 A;  2ECN A;  2ECJ A;  2FSA A;  2JMI A;  3ZVY A;  5B8D A;  1WGM A;  3V43 A;  2MT5 A;  4ZQL A;  2ECI A;  3M63 A;  3QZV A;  2YW8 A;  5H1V A;  5AIU A;  2I50 A;  4GNF A;  2CKL A;  1Z2Q A;  1VYX A;  1MBM A;  4L7X A;  3O37 A;  3RPG C;  3EB5 A;  4BHW A;  5SVX A;  5TRB A;  3LVQ E;  4R2Y A;  1WEN A;  4O64 A;  2M13 A;  1G25 A;  4YBS A;  3U5N A;  1WIM A;  1X4U A;  2MKE A;  3DPL R;  2YQM A;  3N9N A;  4UI9 B;  4FIP A;  1HYJ A;  1X4I A;  3H7H A;  2QJ0 A;  5C13 A;  4GB0 A;  3FJU B;  5KH7 A;  2OXQ C;  4LLB A;  2DSM A;  3GV4 A;  2KWO A;  5LKT A;  4LK9 A;  1Z60 A;  2M85 A;  2KGG A;  3MHH A;  2VJF B;  4WZ2 A;  2VJE A;  2KFT A;  3MHS A;  4S3O C;  4UP5 A;  2L43 A;  4P5O B;  3EB6 A;  5KH9 A;  3N9Q A;  5SVI A;  2HDP A;  2EXU A;  1DCQ A;  5KH3 A;  2L0B A;  2YQL A;  5B75 A;  2CON A;  5I3L A;  3FAN A;  5FER A;  4WZ0 A;  2YYR A;  4LAD B;  4LJN A;  1WEV A;  2C2V S;  3HCU A;  1WEW A;  3LRQ A;  2YT5 A;  1WE9 A;  2L80 A;  2YHO A;  4N4F A;  3LJU X;  2ECG A;  2YVR A;  1WES A;  3C5K A;  5B76 A;  2VPD A;  2CKL B;  5C11 A;  4F1P A;  2KKY A;  2QIC A;  3FAO A;  3ZYQ A;  5TDR A;  3MDB C;  5B79 A;  4AYC A;  2L75 A;  2K17 A;  2YU4 A;  1MM3 A;  4B7Y C;  5B77 A;  3O33 A;  2CSY A;  3KNV A;  5DKA A;  2IQJ A;  4AVX A;  5G0F A;  5K3Q A;  1V87 A;  2LN0 A;  4O62 A;  3I2D A;  1JM7 B;  2YSM A;  2H0D A;  2P57 A;  3ZPV 1;  2LXH C;  2KWK A;  3KV5 A;  4Z0R A;  2XP0 A;  4AUQ B;  1BOR A;  3HCT A;  4OGC A;  2IDA A;  2CSV A;  2KIZ A;  5EYA F;  3T9K A;  3DQV R;  5D1L B;  4H9D A;  5LKZ A;  1X4J A;  3SHB A;  5LKU A;  2QIZ A;  3PLW A;  1U6G B;  2PUY A;  2DJA A;  4ZUX U;  3SUB A;  4A0C D;  2RSD A;  3O35 A;  4YAX A;  2RR4 A;  2F6N A;  2ECW A;  2XOC A;  2XEU A;  3DDT A;  3L1Z B;  3O7A A;  3KQI A;  4PPE A;  5TAB A;  1JOC A;  2KKX A;  2LGL A;  5LCW B;  3C6W A;  2FUU A;  3LVR E;  3M99 A;  3Q1D A;  5D1K B;  4B86 C;  2L7P A;  4AYC B;  4QQ4 A;  2JRJ A;  3JUE A;  5FB0 A;  4OGE A;  2M6M A;  2CSZ A;  4A4B A;  2LGV A;  2LGG A;  4GNE A;  1FBV A;  5JG6 A;  1LDJ B;  5H9M A;  2K4D A;  2MA6 A;  2VPG A;  2OWA A;  2C2L A;  2EOD A;  2K16 A;  3L1X A;  4YAB A;  2FD4 A;  1DVP A;  4TKP B;  2DX8 A;  2HYE D;  4X3G A;  1LDK C;  3O47 A;  2JMD A;  3ASL A;  2MNY A;  2MIQ A;  1CHC A;  3KDE C;  5G04 B;  5D1M B;  1F62 A;  4YC9 A;  4A4C A;  1IYM A;  2PNX A;  4Z0O A;  3T7L A;  4XI1 A;  1MM2 A;  5SVY A;  2MA5 A;  3E2D A;  3M62 A;  2JM3 A;  2G43 A;  3VK6 A;  2VJF A;  2Y1N A;  3U5M A;  3LQI A;  3LDY A;  4I7B A;  4MSX A;  2EA6 A;  4WA6 A;  4I7C A;  2M3H A;  3N9O A;  5J3X A;  5G05 B;  2YSJ A;  2VPE A;  3T6R A;  4Q6F A;  2RI7 A;  1Z6U A;  3O34 A;  1WEE A;  2XOY A;  5FB1 A;  2EGP A;  2B0O E;  2E6R A;  2VJE B;  4PTB A;  1K2F A;  3L11 A;  2YRE A;  4S3O B;  2G6Q A;  2CRR A;  2VPB A;  2LDR A;  5SVI B;  5B78 A;  1WFK A;  2MUM A;  1T1H A;  1WEP A;  2Y43 A;  2E6S A;  3LQJ A;  4YBT A;  2KU3 A;  2LAU A;  3U5O A;  4QF3 A;  4W4U A;  2KRE A;  2Y1M A;  4BBQ A;  2CRW A;  3ZVZ B;  2FUI A;  2BAY A;  2F42 A;  3ZTG A;  4IC2 A;  2KWN A;  4V3K C;  3PHD A;  2D8S A;  4ZDT A;  4L58 A;  2AN6 A;  3SOU A;  3PUR A;  2ECT A;  3FEH A;  4C9Z A;  5DIN A;  2CT2 A;  2LXP C;  5H1U A;  4A49 A;  3IHP A;  4QF2 A;  3ZNI A;  2JUN A;  4MVT A;  2F6J A;  1VFY A;  2XB1 A;  3SOX A;  2ECV A;  2LGK A;  3M7K A;  2K1J A;  1JM7 A;  1WEU A;  4YAT A;  5FEY A;  2YUR A;  4I7D A;  4WZ3 B;  2KE1 A;  4NN2 A;  4R8P K;  4GND A;  3FL2 A;  4R7E A;  2NAA A;  1FP0 A;  2LQ6 A;  2MD7 B;  2VNF A;  2YHN A;  2L5U A;  4FK5 A;  3U5P A;  2MD8 C;  2KGI A;  2E61 A;  3PUQ A;  3O36 A;  1E4U A;  2H0D B;  3N9L A; 
#chains in the Genus database with same CATH homology
 3JUE A;  5SVI A;  5SVY A;  3LJU X;  2IQJ A;  4H9D A;  2XOY A;  2CRW A;  2YVR A;  3E2D A;  5K3Q A;  2RR4 A;  3H7H A;  2B0O E;  2JM3 A;  4O62 A;  2XOC A;  3DDT A;  3FJU B;  3O47 A;  2YRE A;  4OGE A;  2EXU A;  2D8U A;  4F1P A;  2CRR A;  2EGM A;  1DCQ A;  2KKY A;  2XOZ A;  3LDY A;  5SVX A;  2KKX A;  2P57 A;  5SVI B;  3LVQ E;  3MDB C;  3FM8 C;  3KDE C;  3FEH A;  2CON A;  4Z0R A;  3PLW A;  2M13 A;  3LVR E;  2XP0 A;  3Q1D A;  2LAU A;  2FFW A;  2E61 A;  2JUN A;  2MKE A;  2DJA A;  3DWD A;  4Z0O A;  4OGC A;  2CSV A;  2OWA A;  3SUB A;  2L7P A;  3M7K A;  3T9K A;  4QQ4 A;  2FD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...