2MKEA

Solution structure of cpeb1 zz domain in the free state
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
IDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation regulator
molecule keywords Cytoplasmic polyadenylation element-binding protein 1
publication title A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.130 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2mkeA00
2MKEA 2M13A
chains in the Genus database with same CATH superfamily
4IC3A 1X4JA 2OXQC 5LCWB 2DJAA 2KWNA 4YBTA 2E6RA 2JMIA 2YUCA 4V3KC 4W4UA 2YURA 4AP4A 2F42A 2KU3A 3GL6A 3N9MA 4C9ZA 2KKXA 2QJ0A 1HYJA 2KKYA 4GNGA 2CRWA 3L11A 5KH7A 2K4DA 2YQMA 3DPLR 4CCGX 3N9OA 2XB1A 5LKTA 2VJFA 2VNFA 4UP0A 1CHCA 2MNYA 2G6QA 2JM3A 2M3HA 4ZUXU 4O64A 2KYUA 5TRBA 2YREA 4Q6FA 2FUIA 1V87A 3U5NA 2JMDA 3EB6A 4FIPA 2DX8A 4GNEA 4LKAA 2MKEA 4O62A 5JG6A 1DCQA 5TDWA 5SVIA 3LQIA 4WZ0A 5TDRA 2HYED 3PUQA 2EODA 2C2LA 2ZETC 4WZ2A 2MIQA 4AVXA 3N9LA 2KWKA 5AITA 5B75A 2VP7A 2XOYA 3L1XA 1JOCA 5B77A 5D1MB 1WEEA 2L0BA 2L43A 2OWAA 4NN2A 5KH9A 2L5UA 2VPEA 3O37A 5EYAF 5FEYA 1Z6UA 2CKLB 2ECVA 1IYMA 3HTKC 2G45A 2FD4A 2XOZA 4AYCA 2XOCA 3KQIA 2ECGA 4LK9A 2EA6A 1WEMA 4I7CA 5SVYA 1WENA 2KWJA 2YQLA 4QF2A 1ZBDB 2KGIA 1WILA 2YSJA 3T9KA 5D1LB 3RPGB 4QF3A 1RMDA 2KFTA 2E6SA 4OGCA 3MHSA 5FERA 4R7EA 3SHBA 4LADB 5H1UA 5I3LA 5AIUA 1G25A 2LAUA 1X4IA 3JUEA 3C6WA 4AUQB 2EXUA 5DKAA 4FJCA 4GB0A 4N4FA 4R8PK 1JM7B 3ZTGA 4TKPB 1K2FA 2L7PA 2H0DB 1MM3A 5FB1A 2JUNA 2ECJA 1WESA 3HCSA 5KH3A 2KE1A 4R2YA 3O36A 2MA6A 5G0FA 3KDEC 3N9NA 1LDJB 2MUMA 2Y43A 2XP0A 3ZNIA 2C2VS 4BBQA 3HCUA 3SOUA 1WEVA 3DDTA 2FUUA 4GNDA 5D1KB 2M1RA 4WZ3B 2K16A 2VJEA 3SOWA 3EB5A 3O70A 3SOXA 5TABA 4A4BA 2EGMA 4GNFA 2F6NA 2RSDA 3SUBA 2RR4A 3M62A 4QQ4A 4WA6A 4H9DA 3C5KA 2AN6A 3LDYA 3O35A 2DSMA 2YT5A 4F1PA 5SVIB 5G05B 3U5PA 1WEOA 2G43A 2LXHC 2Y1MA 1Z2QA 2YYRA 5B79A 1BORA 3FJUB 3LQHA 2BAYA 3GV4A 2MD7B 2B0OE 2D8SA 4B86C 2YU4A 3M7KA 3PHDA 2QICA 2D8UA 2E61A 1WEPA 3V43A 2YVRA 2PUYA 4YAXA 1Z60A 3M99A 2LGVA 3LVRE 4YATA 4MVTA 3HCTA 4L7XA 2L75A 3LVQE 1FBVA 2RI7A 4YBSA 2LGGA 1LDKC 1MBMA 4A49A 5FB0A 3LJUX 3PLWA 4FK5A 2JMJA 2CT2A 2MD8C 2YSMA 4BHWA 4L58A 3E2DA 3RPGC 3T7LA 2LXPC 3H7HA 2F6JA 2EGPA 4P5OB 1VYXA 1MM2A 3L1ZB 1X4UA 2IQJA 3ZVZB 1WE9A 2KR4A 2ECNA 2H0DA 2LV9A 3RTRB 5K3QA 2CSVA 1N87A 5H1VA 4XI1A 3MDBC 2LDRA 3ASLA 4CA1A 3FEHA 5LKZA 2ECWA 2KREA 1T1HA 2M6MA 2Y1NA 5B76A 1HYIA 2VJFB 4YBMA 3DWDA 4V3LC 3NG2A 3N9PA 1VFYA 4PTBA 5B78A 2JRJA 4Z0RA 4PPEA 5TBNA 3I2DA 3M63A 2MA5A 4ZDTA 2VJEB 2VPGA 2IDAA 2LN0A 4UP5A 1E4UA 3O7AA 4F52B 2KWOA 2VPBA 2LGKA 5LKXA 1WEQA 2VPDA 4B7YC 2I50A 4IC2A 3FAOA 1WEWA 4S3OB 3KNVA 2P57A 2QIZA 5C11A 2KGGA 2YW8A 2CSYA 3ZYQA 1WGMA 2LRIC 2ECIA 2L80A 3ZPV1 5DINA 4I7BA 2K17A 4LJNA 3N9QA 4A0CD 2YHNA 4S3OC 3DQVR 1WEUA 3ZVYA 5G04B 4MSXA 4OGEA 1DVPA 4N3WA 3LRQA 3O47A 3LQJA 1F62A 2UZGA 3O33A 5J3XA 2CKLA 3MHHA 4AYCB 2FFWA 1FP0A 3ZPVE 3FM8C 3U5OA 1XWHA 2MT5A 2LQ6A 2M13A 2CSZA 3FL2A 2LGLA 2XEUA 2FSAA 2KIZA 4ZQLA 5LKUA 2ECTA 5H1TA 3IHPA 5SVXA 3KV5A 5H9MA 2K1JA 1WIMA 3KV6A 1WFKA 2MNZA 3QZVA 2M85A 3U5MA 2CONA 3T6RA 4Z0OA 4I7DA 2YHOA 4YABA 4LLBA 2CRRA 3VK6A 1U6GB 2HDPA 3FANA 4FO9A 4X3GA 3Q1DA 5C13A 1JM7A 4YADA 4A4CA 1VD4A 4YC9A 3O34A 4UI9B 5B8DA 3PURA 2NAAA 2PNXA
chains in the Genus database with same CATH topology
3FJUB 2MKEA 3FM8C 2RR4A 3T9KA 3FEHA 4O62A 3E2DA 2CONA 2B0OE 1DCQA 2DJAA 2L7PA 4QQ4A 4Z0OA 5SVIA 3H7HA 2JUNA 2M13A 4OGCA 4H9DA 3M7KA 2CRRA 2FD4A 2JM3A 3LVQE 3DDTA 3LDYA 2LAUA 3JUEA 2IQJA 2D8UA 2XP0A 3DWDA 2XOZA 2E61A 4F1PA 2XOCA 5SVIB 3SUBA 3Q1DA 2YVRA 2EXUA 2KKXA 2P57A 2YREA 4OGEA 5SVXA 2XOYA 2KKYA 3O47A 5SVYA 4Z0RA 2EGMA 3LJUX 2CRWA 2CSVA 3LVRE 5K3QA 3PLWA 3KDEC 3MDBC 2FFWA 2OWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKE A;  2M13 A; 
#chains in the Genus database with same CATH topology
 4IC3 A;  1X4J A;  2OXQ C;  5LCW B;  2DJA A;  2KWN A;  4YBT A;  2E6R A;  2JMI A;  2YUC A;  4V3K C;  4W4U A;  2YUR A;  4AP4 A;  2F42 A;  2KU3 A;  3GL6 A;  3N9M A;  4C9Z A;  2KKX A;  2QJ0 A;  1HYJ A;  2KKY A;  4GNG A;  2CRW A;  3L11 A;  5KH7 A;  2K4D A;  2YQM A;  3DPL R;  4CCG X;  3N9O A;  2XB1 A;  5LKT A;  2VJF A;  2VNF A;  4UP0 A;  1CHC A;  2MNY A;  2G6Q A;  2JM3 A;  2M3H A;  4ZUX U;  4O64 A;  2KYU A;  5TRB A;  2YRE A;  4Q6F A;  2FUI A;  1V87 A;  3U5N A;  2JMD A;  3EB6 A;  4FIP A;  2DX8 A;  4GNE A;  4LKA A;  2MKE A;  4O62 A;  5JG6 A;  1DCQ A;  5TDW A;  5SVI A;  3LQI A;  4WZ0 A;  5TDR A;  2HYE D;  3PUQ A;  2EOD A;  2C2L A;  2ZET C;  4WZ2 A;  2MIQ A;  4AVX A;  3N9L A;  2KWK A;  5AIT A;  5B75 A;  2VP7 A;  2XOY A;  3L1X A;  1JOC A;  5B77 A;  5D1M B;  1WEE A;  2L0B A;  2L43 A;  2OWA A;  4NN2 A;  5KH9 A;  2L5U A;  2VPE A;  3O37 A;  5EYA F;  5FEY A;  1Z6U A;  2CKL B;  2ECV A;  1IYM A;  3HTK C;  2G45 A;  2FD4 A;  2XOZ A;  4AYC A;  2XOC A;  3KQI A;  2ECG A;  4LK9 A;  2EA6 A;  1WEM A;  4I7C A;  5SVY A;  1WEN A;  2KWJ A;  2YQL A;  4QF2 A;  1ZBD B;  2KGI A;  1WIL A;  2YSJ A;  3T9K A;  5D1L B;  3RPG B;  4QF3 A;  1RMD A;  2KFT A;  2E6S A;  4OGC A;  3MHS A;  5FER A;  4R7E A;  3SHB A;  4LAD B;  5H1U A;  5I3L A;  5AIU A;  1G25 A;  2LAU A;  1X4I A;  3JUE A;  3C6W A;  4AUQ B;  2EXU A;  5DKA A;  4FJC A;  4GB0 A;  4N4F A;  4R8P K;  1JM7 B;  3ZTG A;  4TKP B;  1K2F A;  2L7P A;  2H0D B;  1MM3 A;  5FB1 A;  2JUN A;  2ECJ A;  1WES A;  3HCS A;  5KH3 A;  2KE1 A;  4R2Y A;  3O36 A;  2MA6 A;  5G0F A;  3KDE C;  3N9N A;  1LDJ B;  2MUM A;  2Y43 A;  2XP0 A;  3ZNI A;  2C2V S;  4BBQ A;  3HCU A;  3SOU A;  1WEV A;  3DDT A;  2FUU A;  4GND A;  5D1K B;  2M1R A;  4WZ3 B;  2K16 A;  2VJE A;  3SOW A;  3EB5 A;  3O70 A;  3SOX A;  5TAB A;  4A4B A;  2EGM A;  4GNF A;  2F6N A;  2RSD A;  3SUB A;  2RR4 A;  3M62 A;  4QQ4 A;  4WA6 A;  4H9D A;  3C5K A;  2AN6 A;  3LDY A;  3O35 A;  2DSM A;  2YT5 A;  4F1P A;  5SVI B;  5G05 B;  3U5P A;  1WEO A;  2G43 A;  2LXH C;  2Y1M A;  1Z2Q A;  2YYR A;  5B79 A;  1BOR A;  3FJU B;  3LQH A;  2BAY A;  3GV4 A;  2MD7 B;  2B0O E;  2D8S A;  4B86 C;  2YU4 A;  3M7K A;  3PHD A;  2QIC A;  2D8U A;  2E61 A;  1WEP A;  3V43 A;  2YVR A;  2PUY A;  4YAX A;  1Z60 A;  3M99 A;  2LGV A;  3LVR E;  4YAT A;  4MVT A;  3HCT A;  4L7X A;  2L75 A;  3LVQ E;  1FBV A;  2RI7 A;  4YBS A;  2LGG A;  1LDK C;  1MBM A;  4A49 A;  5FB0 A;  3LJU X;  3PLW A;  4FK5 A;  2JMJ A;  2CT2 A;  2MD8 C;  2YSM A;  4BHW A;  4L58 A;  3E2D A;  3RPG C;  3T7L A;  2LXP C;  3H7H A;  2F6J A;  2EGP A;  4P5O B;  1VYX A;  1MM2 A;  3L1Z B;  1X4U A;  2IQJ A;  3ZVZ B;  1WE9 A;  2KR4 A;  2ECN A;  2H0D A;  2LV9 A;  3RTR B;  5K3Q A;  2CSV A;  1N87 A;  5H1V A;  4XI1 A;  3MDB C;  2LDR A;  3ASL A;  4CA1 A;  3FEH A;  5LKZ A;  2ECW A;  2KRE A;  1T1H A;  2M6M A;  2Y1N A;  5B76 A;  1HYI A;  2VJF B;  4YBM A;  3DWD A;  4V3L C;  3NG2 A;  3N9P A;  1VFY A;  4PTB A;  5B78 A;  2JRJ A;  4Z0R A;  4PPE A;  5TBN A;  3I2D A;  3M63 A;  2MA5 A;  4ZDT A;  2VJE B;  2VPG A;  2IDA A;  2LN0 A;  4UP5 A;  1E4U A;  3O7A A;  4F52 B;  2KWO A;  2VPB A;  2LGK A;  5LKX A;  1WEQ A;  2VPD A;  4B7Y C;  2I50 A;  4IC2 A;  3FAO A;  1WEW A;  4S3O B;  3KNV A;  2P57 A;  2QIZ A;  5C11 A;  2KGG A;  2YW8 A;  2CSY A;  3ZYQ A;  1WGM A;  2LRI C;  2ECI A;  2L80 A;  3ZPV 1;  5DIN A;  4I7B A;  2K17 A;  4LJN A;  3N9Q A;  4A0C D;  2YHN A;  4S3O C;  3DQV R;  1WEU A;  3ZVY A;  5G04 B;  4MSX A;  4OGE A;  1DVP A;  4N3W A;  3LRQ A;  3O47 A;  3LQJ A;  1F62 A;  2UZG A;  3O33 A;  5J3X A;  2CKL A;  3MHH A;  4AYC B;  2FFW A;  1FP0 A;  3ZPV E;  3FM8 C;  3U5O A;  1XWH A;  2MT5 A;  2LQ6 A;  2M13 A;  2CSZ A;  3FL2 A;  2LGL A;  2XEU A;  2FSA A;  2KIZ A;  4ZQL A;  5LKU A;  2ECT A;  5H1T A;  3IHP A;  5SVX A;  3KV5 A;  5H9M A;  2K1J A;  1WIM A;  3KV6 A;  1WFK A;  2MNZ A;  3QZV A;  2M85 A;  3U5M A;  2CON A;  3T6R A;  4Z0O A;  4I7D A;  2YHO A;  4YAB A;  4LLB A;  2CRR A;  3VK6 A;  1U6G B;  2HDP A;  3FAN A;  4FO9 A;  4X3G A;  3Q1D A;  5C13 A;  1JM7 A;  4YAD A;  4A4C A;  1VD4 A;  4YC9 A;  3O34 A;  4UI9 B;  5B8D A;  3PUR A;  2NAA A;  2PNX A; 
#chains in the Genus database with same CATH homology
 3FJU B;  2MKE A;  3FM8 C;  2RR4 A;  3T9K A;  3FEH A;  4O62 A;  3E2D A;  2CON A;  2B0O E;  1DCQ A;  2DJA A;  2L7P A;  4QQ4 A;  4Z0O A;  5SVI A;  3H7H A;  2JUN A;  2M13 A;  4OGC A;  4H9D A;  3M7K A;  2CRR A;  2FD4 A;  2JM3 A;  3LVQ E;  3DDT A;  3LDY A;  2LAU A;  3JUE A;  2IQJ A;  2D8U A;  2XP0 A;  3DWD A;  2XOZ A;  2E61 A;  4F1P A;  2XOC A;  5SVI B;  3SUB A;  3Q1D A;  2YVR A;  2EXU A;  2KKX A;  2P57 A;  2YRE A;  4OGE A;  5SVX A;  2XOY A;  2KKY A;  3O47 A;  5SVY A;  4Z0R A;  2EGM A;  3LJU X;  2CRW A;  2CSV A;  3LVR E;  5K3Q A;  3PLW A;  3KDE C;  3MDB C;  2FFW A;  2OWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...