3DQVR

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords NEDD8
total genus 7
structure length 86
sequence length 86
chains with identical sequence Y
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3dqvR00
4MSXA 3T6RA 2K17A 4LADB 4S3OC 2L5UA 2Y1MA 1JOCA 3M62A 3MHHA 2MUMA 4V3LC 1Z6UA 1HYJA 3KV5A 2H0DB 2ECTA 2PNXA 5J3XA 4I7BA 2C2VS 2KWNA 1VD4A 2RSDA 5AIUA 2FSAA 1WEQA 5JG6A 2MA6A 1IYMA 1WE9A 2CKLB 4WZ2A 2C2LA 3NG2A 2KE1A 2F6NA 2LGKA 1HYIA 2L75A 3O35A 2YHOA 4NN2A 2KWOA 3ZTGA 5AITA 4B7YC 4I7DA 2JMIA 4XI1A 2YT5A 5LKZA 1JM7B 2F42A 3O34A 3PURA 2FUIA 4FJCA 2AN6A 3SOUA 4QF3A 2VJEA 2ECVA 3VK6A 4WZ0A 1BORA 4TKPB 1MM3A 2YSJA 3FL2A 2K4DA 5TRBA 4LKAA 2QIZA 3HCUA 2QJ0A 5KH9A 2ECWA 5TDWA 5D1MB 2YUCA 3ZPV1 2IDAA 1WEUA 5FB0A 5KH3A 2XB1A 3LQJA 5D1KB 3U5OA 2KIZA 5LCWB 2HYED 3ASLA 2M85A 2VJFB 1WEEA 2EGPA 3O36A 4GNFA 1WENA 3HCSA 2LGGA 2JMJA 2MT5A 4L7XA 1F62A 2VPBA 3EB6A 2LN0A 2LQ6A 2JRJA 3ZYQA 4UI9B 3V43A 2G43A 3KQIA 4CCGX 3O70A 1VYXA 2ECIA 3O37A 5B79A 2H0DA 5EYAF 3M63A 1WEOA 3PHDA 2LGLA 3ZVYA 3C5KA 4YADA 1WEMA 4YBMA 2ECJA 4A49A 2CT2A 1X4IA 3N9OA 2YHNA 2LXPC 4PPEA 5C11A 2YQMA 5LKTA 1E4UA 4R2YA 2UZGA 3PUQA 1ZBDB 4FO9A 3QZVA 4YAXA 2LGVA 5B77A 2KU3A 2YREA 3ZNIA 2KWJA 4MVTA 2LXHC 1LDKC 2RI7A 4AVXA 5KH7A 2EODA 3N9PA 2FUUA 1K2FA 3SOWA 2MNYA 4LLBA 4P5OB 3EB5A 5FERA 2LV9A 2M1RA 3U5MA 2MA5A 1FBVA 5G04B 4V3KC 1XWHA 3O7AA 3ZPVE 3U5PA 3U5NA 1WILA 2Y1NA 2G45A 3T7LA 5G05B 2VPGA 2KR4A 2K1JA 2MIQA 4S3OB 2YW8A 2L43A 5H1TA 2DX8A 4N4FA 2KGGA 1MM2A 2MD8C 4I7CA 4FK5A 3L1ZB 2PUYA 5DINA 3RPGC 2KYUA 2VJFA 2G6QA 4W4UA 3M99A 2L80A 5B8DA 2I50A 2OXQC 4BBQA 1RMDA 2EA6A 4R8PK 2VNFA 2LDRA 2NAAA 5B76A 2QICA 4X3GA 5FB1A 2M6MA 3GV4A 4CA1A 3N9MA 4GNEA 3MHSA 4PTBA 2KFTA 1DVPA 4A0CD 2JMDA 2YURA 1FP0A 1WEVA 4L58A 2KWKA 1X4JA 2XEUA 3RTRB 1Z60A 3DPLR 3N9QA 4O64A 1WGMA 2MNZA 4N3WA 2VP7A 2ECGA 3SOXA 4GB0A 3RPGB 4UP5A 1WESA 4WA6A 2K16A 1VFYA 4ZDTA 2HDPA 3HTKC 5B78A 2D8SA 1WIMA 3ZVZB 2ECNA 1WEWA 4QF2A 2YYRA 2L0BA 4UP0A 2CKLA 5G0FA 3GL6A 3L1XA 4ZQLA 4GNDA 5FEYA 4C9ZA 4AUQB 1LDJB 4LJNA 2F6JA 4AYCA 5LKXA 2MD7B 5H1VA 2VPDA 2CSYA 2KREA 4IC3A 5B75A 5DKAA 2VPEA 1U6GB 4B86C 3N9NA 4ZUXU 5H1UA 3N9LA 4A4CA 3LQHA 3I2DA 4F52B 4FIPA 4YABA 2Y43A 2YU4A 4AP4A 1JM7A 4WZ3B 2VJEB 2CSZA 3KNVA 5I3LA 2YSMA 2ZETC 1WFKA 2YQLA 5H9MA 1G25A 3IHPA 4IC2A 4AYCB 1T1HA 2E6RA 5TBNA 4YC9A 1WEPA 4GNGA 2BAYA 1N87A 3KV6A 3O33A 5LKUA 4R7EA 3HCTA 1Z2QA 5C13A 2LRIC 1CHCA 4YBSA 2E6SA 2M3HA 1V87A 4BHWA 1X4UA 3SHBA 4YBTA 4Q6FA 2KGIA 3LQIA 5TABA 3LRQA 3C6WA 5D1LB 3DQVR 4YATA 3L11A 4LK9A 5TDRA 4A4BA
chains in the Genus database with same CATH superfamily
4MSXA 3T6RA 2K17A 4LADB 4S3OC 4Z0OA 2RR4A 2L5UA 2Y1MA 1JOCA 3T9KA 3M62A 2XOYA 2MKEA 3MHHA 2MUMA 4V3LC 1Z6UA 1HYJA 3KV5A 2H0DB 2ECTA 2PNXA 3FAOA 5J3XA 2XOCA 4I7BA 2C2VS 2KWNA 1VD4A 2RSDA 2YVRA 5AIUA 2FSAA 1WEQA 5JG6A 2MA6A 1IYMA 1WE9A 2CKLB 4WZ2A 2C2LA 3NG2A 2KE1A 2F6NA 2LGKA 1HYIA 2L75A 3O35A 2YHOA 4NN2A 5SVIB 2KWOA 3M7KA 3ZTGA 5AITA 4B7YC 4I7DA 2JMIA 4XI1A 2YT5A 5LKZA 1JM7B 2F42A 3O34A 3PURA 2FUIA 4FJCA 2AN6A 3SOUA 4QF3A 2VJEA 2ECVA 3VK6A 4WZ0A 4OGCA 1BORA 4TKPB 1MM3A 2YSJA 3FL2A 3DDTA 5SVIA 2K4DA 5TRBA 4LKAA 2QIZA 3HCUA 2QJ0A 5KH9A 2ECWA 5TDWA 5D1MB 2YUCA 2CRWA 3ZPV1 2IDAA 2P57A 1WEUA 5FB0A 5KH3A 2XB1A 3LQJA 5D1KB 3U5OA 2KIZA 5LCWB 2HYED 3ASLA 2M85A 2VJFB 1WEEA 2EGPA 3O36A 4GNFA 1WENA 3HCSA 2LGGA 2JMJA 2MT5A 4L7XA 1F62A 2VPBA 3EB6A 2LN0A 2LQ6A 2JRJA 3ZYQA 4UI9B 3V43A 3JUEA 2G43A 3KQIA 4CCGX 3O70A 1VYXA 2ECIA 3O37A 5B79A 2H0DA 5EYAF 3M63A 1WEOA 3PHDA 2LGLA 3ZVYA 4F1PA 3C5KA 3PLWA 4YADA 1WEMA 4YBMA 2ECJA 4A49A 2CT2A 1X4IA 3N9OA 2YHNA 2LXPC 3FEHA 4PPEA 5C11A 2YQMA 5LKTA 1E4UA 4R2YA 4QQ4A 2UZGA 3PUQA 1ZBDB 2DSMA 4FO9A 3QZVA 4YAXA 2LGVA 5B77A 2KU3A 2YREA 3ZNIA 2KWJA 3LDYA 3H7HA 4MVTA 2LXHC 1LDKC 2RI7A 2E61A 2LAUA 4AVXA 5KH7A 2EODA 3N9PA 2FUUA 1K2FA 3SOWA 2MNYA 4LLBA 2FFWA 4P5OB 3EB5A 2B0OE 5FERA 2LV9A 2M1RA 3U5MA 2MA5A 1FBVA 5G04B 4V3KC 1XWHA 3KDEC 3O7AA 3ZPVE 3U5PA 3U5NA 1WILA 2Y1NA 2KKXA 2G45A 2D8UA 5SVXA 3T7LA 5G05B 2VPGA 2KR4A 4H9DA 2K1JA 2MIQA 4S3OB 5K3QA 2YW8A 2L43A 5H1TA 2DX8A 4N4FA 2L7PA 2KGGA 1MM2A 2MD8C 4I7CA 4FK5A 1MBMA 3LJUX 5SVYA 2DJAA 3SUBA 3L1ZB 2PUYA 5DINA 3E2DA 3RPGC 2KYUA 2VJFA 2G6QA 3FANA 4OGEA 2OWAA 3Q1DA 4W4UA 3M99A 2L80A 5B8DA 2I50A 2OXQC 4BBQA 1RMDA 2EA6A 4R8PK 2VNFA 2LDRA 2NAAA 3DWDA 5B76A 2KKYA 2QICA 4X3GA 5FB1A 2M6MA 3GV4A 4CA1A 3N9MA 3MDBC 4GNEA 3MHSA 4PTBA 2KFTA 1DVPA 4A0CD 2JMDA 2YURA 1FP0A 1WEVA 4L58A 3FM8C 2KWKA 1X4JA 2XEUA 3RTRB 1Z60A 3DPLR 3N9QA 4O64A 1WGMA 2MNZA 4N3WA 2VP7A 2ECGA 3SOXA 4GB0A 3RPGB 4UP5A 1WESA 2K16A 4WA6A 1VFYA 4ZDTA 2XOZA 2HDPA 3HTKC 5B78A 2D8SA 1WIMA 3ZVZB 2ECNA 3O47A 1WEWA 4QF2A 4Z0RA 2YYRA 2L0BA 4UP0A 2CKLA 5G0FA 3GL6A 3L1XA 4ZQLA 3LVRE 4GNDA 5FEYA 4C9ZA 4AUQB 1LDJB 4LJNA 2F6JA 3LVQE 4AYCA 5LKXA 2MD7B 2EXUA 5H1VA 2VPDA 1DCQA 2CSYA 2KREA 4IC3A 5B75A 5DKAA 2VPEA 2M13A 1U6GB 4B86C 2XP0A 3N9NA 2FD4A 4ZUXU 5H1UA 3N9LA 4A4CA 3LQHA 3I2DA 4F52B 4FIPA 4YABA 2Y43A 2YU4A 4AP4A 1JM7A 4WZ3B 2VJEB 2CSZA 3KNVA 5I3LA 2YSMA 2ZETC 1WFKA 2YQLA 5H9MA 1G25A 3IHPA 4IC2A 2JM3A 4AYCB 1T1HA 2E6RA 5TBNA 2CONA 4YC9A 1WEPA 4GNGA 2BAYA 1N87A 3KV6A 3O33A 5LKUA 4R7EA 3HCTA 1Z2QA 5C13A 3FJUB 2LRIC 1CHCA 4YBSA 2E6SA 2EGMA 2M3HA 1V87A 4BHWA 1X4UA 3SHBA 4YBTA 4O62A 2IQJA 4Q6FA 2JUNA 2KGIA 3LQIA 2CRRA 5TABA 3LRQA 3C6WA 5D1LB 3DQVR 4YATA 2CSVA 3L11A 4LK9A 5TDRA 4A4BA
chains in the Genus database with same CATH topology
4MSXA 3T6RA 2K17A 4LADB 4S3OC 2L5UA 2Y1MA 1JOCA 3M62A 3MHHA 2MUMA 4V3LC 1Z6UA 1HYJA 3KV5A 2H0DB 2ECTA 2PNXA 5J3XA 4I7BA 2C2VS 2KWNA 1VD4A 2RSDA 5AIUA 2FSAA 1WEQA 5JG6A 2MA6A 1IYMA 1WE9A 2CKLB 4WZ2A 2C2LA 3NG2A 2KE1A 2F6NA 2LGKA 1HYIA 2L75A 3O35A 2YHOA 4NN2A 2KWOA 3ZTGA 5AITA 4B7YC 4I7DA 2JMIA 4XI1A 2YT5A 5LKZA 1JM7B 2F42A 3O34A 3PURA 2FUIA 4FJCA 2AN6A 3SOUA 4QF3A 2VJEA 2ECVA 3VK6A 4WZ0A 1BORA 4TKPB 1MM3A 2YSJA 3FL2A 2K4DA 5TRBA 4LKAA 2QIZA 3HCUA 2QJ0A 5KH9A 2ECWA 5TDWA 5D1MB 2YUCA 3ZPV1 2IDAA 1WEUA 5FB0A 5KH3A 2XB1A 3LQJA 5D1KB 3U5OA 2KIZA 5LCWB 2HYED 3ASLA 2M85A 2VJFB 1WEEA 2EGPA 3O36A 4GNFA 1WENA 3HCSA 2LGGA 2JMJA 2MT5A 4L7XA 1F62A 2VPBA 3EB6A 2LN0A 2LQ6A 2JRJA 3ZYQA 4UI9B 3V43A 2G43A 3KQIA 4CCGX 3O70A 1VYXA 2ECIA 3O37A 5B79A 2H0DA 5EYAF 3M63A 1WEOA 3PHDA 2LGLA 3ZVYA 3C5KA 4YADA 1WEMA 4YBMA 2ECJA 4A49A 2CT2A 1X4IA 3N9OA 2YHNA 2LXPC 4PPEA 5C11A 2YQMA 5LKTA 1E4UA 4R2YA 2UZGA 3PUQA 1ZBDB 4FO9A 3QZVA 4YAXA 2LGVA 5B77A 2KU3A 2YREA 3ZNIA 2KWJA 4MVTA 2LXHC 1LDKC 2RI7A 4AVXA 5KH7A 2EODA 3N9PA 2FUUA 1K2FA 3SOWA 2MNYA 4LLBA 4P5OB 3EB5A 5FERA 2LV9A 2M1RA 3U5MA 2MA5A 1FBVA 5G04B 4V3KC 1XWHA 3O7AA 3ZPVE 3U5PA 3U5NA 1WILA 2Y1NA 2G45A 3T7LA 5G05B 2VPGA 2KR4A 2K1JA 2MIQA 4S3OB 2YW8A 2L43A 5H1TA 2DX8A 4N4FA 2KGGA 1MM2A 2MD8C 4I7CA 4FK5A 3L1ZB 2PUYA 5DINA 3RPGC 2KYUA 2VJFA 2G6QA 4W4UA 3M99A 2L80A 5B8DA 2I50A 2OXQC 4BBQA 1RMDA 2EA6A 4R8PK 2VNFA 2LDRA 2NAAA 5B76A 2QICA 4X3GA 5FB1A 2M6MA 3GV4A 4CA1A 3N9MA 4GNEA 3MHSA 4PTBA 2KFTA 1DVPA 4A0CD 2JMDA 2YURA 1FP0A 1WEVA 4L58A 2KWKA 1X4JA 2XEUA 3RTRB 1Z60A 3DPLR 3N9QA 4O64A 1WGMA 2MNZA 4N3WA 2VP7A 2ECGA 3SOXA 4GB0A 3RPGB 4UP5A 1WESA 4WA6A 2K16A 1VFYA 4ZDTA 2HDPA 3HTKC 5B78A 2D8SA 1WIMA 3ZVZB 2ECNA 1WEWA 4QF2A 2YYRA 2L0BA 4UP0A 2CKLA 5G0FA 3GL6A 3L1XA 4ZQLA 4GNDA 5FEYA 4C9ZA 4AUQB 1LDJB 4LJNA 2F6JA 4AYCA 5LKXA 2MD7B 5H1VA 2VPDA 2CSYA 2KREA 4IC3A 5B75A 5DKAA 2VPEA 1U6GB 4B86C 3N9NA 4ZUXU 5H1UA 3N9LA 4A4CA 3LQHA 3I2DA 4F52B 4FIPA 4YABA 2Y43A 2YU4A 4AP4A 1JM7A 4WZ3B 2VJEB 2CSZA 3KNVA 5I3LA 2YSMA 2ZETC 1WFKA 2YQLA 5H9MA 1G25A 3IHPA 4IC2A 4AYCB 1T1HA 2E6RA 5TBNA 4YC9A 1WEPA 4GNGA 2BAYA 1N87A 3KV6A 3O33A 5LKUA 4R7EA 3HCTA 1Z2QA 5C13A 2LRIC 1CHCA 4YBSA 2E6SA 2M3HA 1V87A 4BHWA 1X4UA 3SHBA 4YBTA 4Q6FA 2KGIA 3LQIA 5TABA 3LRQA 3C6WA 5D1LB 3DQVR 4YATA 3L11A 4LK9A 5TDRA 4A4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSX A;  3T6R A;  2K17 A;  4LAD B;  4S3O C;  2L5U A;  2Y1M A;  1JOC A;  3M62 A;  3MHH A;  2MUM A;  4V3L C;  1Z6U A;  1HYJ A;  3KV5 A;  2H0D B;  2ECT A;  2PNX A;  5J3X A;  4I7B A;  2C2V S;  2KWN A;  1VD4 A;  2RSD A;  5AIU A;  2FSA A;  1WEQ A;  5JG6 A;  2MA6 A;  1IYM A;  1WE9 A;  2CKL B;  4WZ2 A;  2C2L A;  3NG2 A;  2KE1 A;  2F6N A;  2LGK A;  1HYI A;  2L75 A;  3O35 A;  2YHO A;  4NN2 A;  2KWO A;  3ZTG A;  5AIT A;  4B7Y C;  4I7D A;  2JMI A;  4XI1 A;  2YT5 A;  5LKZ A;  1JM7 B;  2F42 A;  3O34 A;  3PUR A;  2FUI A;  4FJC A;  2AN6 A;  3SOU A;  4QF3 A;  2VJE A;  2ECV A;  3VK6 A;  4WZ0 A;  1BOR A;  4TKP B;  1MM3 A;  2YSJ A;  3FL2 A;  2K4D A;  5TRB A;  4LKA A;  2QIZ A;  3HCU A;  2QJ0 A;  5KH9 A;  2ECW A;  5TDW A;  5D1M B;  2YUC A;  3ZPV 1;  2IDA A;  1WEU A;  5FB0 A;  5KH3 A;  2XB1 A;  3LQJ A;  5D1K B;  3U5O A;  2KIZ A;  5LCW B;  2HYE D;  3ASL A;  2M85 A;  2VJF B;  1WEE A;  2EGP A;  3O36 A;  4GNF A;  1WEN A;  3HCS A;  2LGG A;  2JMJ A;  2MT5 A;  4L7X A;  1F62 A;  2VPB A;  3EB6 A;  2LN0 A;  2LQ6 A;  2JRJ A;  3ZYQ A;  4UI9 B;  3V43 A;  2G43 A;  3KQI A;  4CCG X;  3O70 A;  1VYX A;  2ECI A;  3O37 A;  5B79 A;  2H0D A;  5EYA F;  3M63 A;  1WEO A;  3PHD A;  2LGL A;  3ZVY A;  3C5K A;  4YAD A;  1WEM A;  4YBM A;  2ECJ A;  4A49 A;  2CT2 A;  1X4I A;  3N9O A;  2YHN A;  2LXP C;  4PPE A;  5C11 A;  2YQM A;  5LKT A;  1E4U A;  4R2Y A;  2UZG A;  3PUQ A;  1ZBD B;  4FO9 A;  3QZV A;  4YAX A;  2LGV A;  5B77 A;  2KU3 A;  2YRE A;  3ZNI A;  2KWJ A;  4MVT A;  2LXH C;  1LDK C;  2RI7 A;  4AVX A;  5KH7 A;  2EOD A;  3N9P A;  2FUU A;  1K2F A;  3SOW A;  2MNY A;  4LLB A;  4P5O B;  3EB5 A;  5FER A;  2LV9 A;  2M1R A;  3U5M A;  2MA5 A;  1FBV A;  5G04 B;  4V3K C;  1XWH A;  3O7A A;  3ZPV E;  3U5P A;  3U5N A;  1WIL A;  2Y1N A;  2G45 A;  3T7L A;  5G05 B;  2VPG A;  2KR4 A;  2K1J A;  2MIQ A;  4S3O B;  2YW8 A;  2L43 A;  5H1T A;  2DX8 A;  4N4F A;  2KGG A;  1MM2 A;  2MD8 C;  4I7C A;  4FK5 A;  3L1Z B;  2PUY A;  5DIN A;  3RPG C;  2KYU A;  2VJF A;  2G6Q A;  4W4U A;  3M99 A;  2L80 A;  5B8D A;  2I50 A;  2OXQ C;  4BBQ A;  1RMD A;  2EA6 A;  4R8P K;  2VNF A;  2LDR A;  2NAA A;  5B76 A;  2QIC A;  4X3G A;  5FB1 A;  2M6M A;  3GV4 A;  4CA1 A;  3N9M A;  4GNE A;  3MHS A;  4PTB A;  2KFT A;  1DVP A;  4A0C D;  2JMD A;  2YUR A;  1FP0 A;  1WEV A;  4L58 A;  2KWK A;  1X4J A;  2XEU A;  3RTR B;  1Z60 A;  3DPL R;  3N9Q A;  4O64 A;  1WGM A;  2MNZ A;  4N3W A;  2VP7 A;  2ECG A;  3SOX A;  4GB0 A;  3RPG B;  4UP5 A;  1WES A;  4WA6 A;  2K16 A;  1VFY A;  4ZDT A;  2HDP A;  3HTK C;  5B78 A;  2D8S A;  1WIM A;  3ZVZ B;  2ECN A;  1WEW A;  4QF2 A;  2YYR A;  2L0B A;  4UP0 A;  2CKL A;  5G0F A;  3GL6 A;  3L1X A;  4ZQL A;  4GND A;  5FEY A;  4C9Z A;  4AUQ B;  1LDJ B;  4LJN A;  2F6J A;  4AYC A;  5LKX A;  2MD7 B;  5H1V A;  2VPD A;  2CSY A;  2KRE A;  4IC3 A;  5B75 A;  5DKA A;  2VPE A;  1U6G B;  4B86 C;  3N9N A;  4ZUX U;  5H1U A;  3N9L A;  4A4C A;  3LQH A;  3I2D A;  4F52 B;  4FIP A;  4YAB A;  2Y43 A;  2YU4 A;  4AP4 A;  1JM7 A;  4WZ3 B;  2VJE B;  2CSZ A;  3KNV A;  5I3L A;  2YSM A;  2ZET C;  1WFK A;  2YQL A;  5H9M A;  1G25 A;  3IHP A;  4IC2 A;  4AYC B;  1T1H A;  2E6R A;  5TBN A;  4YC9 A;  1WEP A;  4GNG A;  2BAY A;  1N87 A;  3KV6 A;  3O33 A;  5LKU A;  4R7E A;  3HCT A;  1Z2Q A;  5C13 A;  2LRI C;  1CHC A;  4YBS A;  2E6S A;  2M3H A;  1V87 A;  4BHW A;  1X4U A;  3SHB A;  4YBT A;  4Q6F A;  2KGI A;  3LQI A;  5TAB A;  3LRQ A;  3C6W A;  5D1L B;  3DQV R;  4YAT A;  3L11 A;  4LK9 A;  5TDR A;  4A4B A; 
#chains in the Genus database with same CATH topology
 4MSX A;  3T6R A;  2K17 A;  4LAD B;  4S3O C;  4Z0O A;  2RR4 A;  2L5U A;  2Y1M A;  1JOC A;  3T9K A;  3M62 A;  2XOY A;  2MKE A;  3MHH A;  2MUM A;  4V3L C;  1Z6U A;  1HYJ A;  3KV5 A;  2H0D B;  2ECT A;  2PNX A;  3FAO A;  5J3X A;  2XOC A;  4I7B A;  2C2V S;  2KWN A;  1VD4 A;  2RSD A;  2YVR A;  5AIU A;  2FSA A;  1WEQ A;  5JG6 A;  2MA6 A;  1IYM A;  1WE9 A;  2CKL B;  4WZ2 A;  2C2L A;  3NG2 A;  2KE1 A;  2F6N A;  2LGK A;  1HYI A;  2L75 A;  3O35 A;  2YHO A;  4NN2 A;  5SVI B;  2KWO A;  3M7K A;  3ZTG A;  5AIT A;  4B7Y C;  4I7D A;  2JMI A;  4XI1 A;  2YT5 A;  5LKZ A;  1JM7 B;  2F42 A;  3O34 A;  3PUR A;  2FUI A;  4FJC A;  2AN6 A;  3SOU A;  4QF3 A;  2VJE A;  2ECV A;  3VK6 A;  4WZ0 A;  4OGC A;  1BOR A;  4TKP B;  1MM3 A;  2YSJ A;  3FL2 A;  3DDT A;  5SVI A;  2K4D A;  5TRB A;  4LKA A;  2QIZ A;  3HCU A;  2QJ0 A;  5KH9 A;  2ECW A;  5TDW A;  5D1M B;  2YUC A;  2CRW A;  3ZPV 1;  2IDA A;  2P57 A;  1WEU A;  5FB0 A;  5KH3 A;  2XB1 A;  3LQJ A;  5D1K B;  3U5O A;  2KIZ A;  5LCW B;  2HYE D;  3ASL A;  2M85 A;  2VJF B;  1WEE A;  2EGP A;  3O36 A;  4GNF A;  1WEN A;  3HCS A;  2LGG A;  2JMJ A;  2MT5 A;  4L7X A;  1F62 A;  2VPB A;  3EB6 A;  2LN0 A;  2LQ6 A;  2JRJ A;  3ZYQ A;  4UI9 B;  3V43 A;  3JUE A;  2G43 A;  3KQI A;  4CCG X;  3O70 A;  1VYX A;  2ECI A;  3O37 A;  5B79 A;  2H0D A;  5EYA F;  3M63 A;  1WEO A;  3PHD A;  2LGL A;  3ZVY A;  4F1P A;  3C5K A;  3PLW A;  4YAD A;  1WEM A;  4YBM A;  2ECJ A;  4A49 A;  2CT2 A;  1X4I A;  3N9O A;  2YHN A;  2LXP C;  3FEH A;  4PPE A;  5C11 A;  2YQM A;  5LKT A;  1E4U A;  4R2Y A;  4QQ4 A;  2UZG A;  3PUQ A;  1ZBD B;  2DSM A;  4FO9 A;  3QZV A;  4YAX A;  2LGV A;  5B77 A;  2KU3 A;  2YRE A;  3ZNI A;  2KWJ A;  3LDY A;  3H7H A;  4MVT A;  2LXH C;  1LDK C;  2RI7 A;  2E61 A;  2LAU A;  4AVX A;  5KH7 A;  2EOD A;  3N9P A;  2FUU A;  1K2F A;  3SOW A;  2MNY A;  4LLB A;  2FFW A;  4P5O B;  3EB5 A;  2B0O E;  5FER A;  2LV9 A;  2M1R A;  3U5M A;  2MA5 A;  1FBV A;  5G04 B;  4V3K C;  1XWH A;  3KDE C;  3O7A A;  3ZPV E;  3U5P A;  3U5N A;  1WIL A;  2Y1N A;  2KKX A;  2G45 A;  2D8U A;  5SVX A;  3T7L A;  5G05 B;  2VPG A;  2KR4 A;  4H9D A;  2K1J A;  2MIQ A;  4S3O B;  5K3Q A;  2YW8 A;  2L43 A;  5H1T A;  2DX8 A;  4N4F A;  2L7P A;  2KGG A;  1MM2 A;  2MD8 C;  4I7C A;  4FK5 A;  1MBM A;  3LJU X;  5SVY A;  2DJA A;  3SUB A;  3L1Z B;  2PUY A;  5DIN A;  3E2D A;  3RPG C;  2KYU A;  2VJF A;  2G6Q A;  3FAN A;  4OGE A;  2OWA A;  3Q1D A;  4W4U A;  3M99 A;  2L80 A;  5B8D A;  2I50 A;  2OXQ C;  4BBQ A;  1RMD A;  2EA6 A;  4R8P K;  2VNF A;  2LDR A;  2NAA A;  3DWD A;  5B76 A;  2KKY A;  2QIC A;  4X3G A;  5FB1 A;  2M6M A;  3GV4 A;  4CA1 A;  3N9M A;  3MDB C;  4GNE A;  3MHS A;  4PTB A;  2KFT A;  1DVP A;  4A0C D;  2JMD A;  2YUR A;  1FP0 A;  1WEV A;  4L58 A;  3FM8 C;  2KWK A;  1X4J A;  2XEU A;  3RTR B;  1Z60 A;  3DPL R;  3N9Q A;  4O64 A;  1WGM A;  2MNZ A;  4N3W A;  2VP7 A;  2ECG A;  3SOX A;  4GB0 A;  3RPG B;  4UP5 A;  1WES A;  2K16 A;  4WA6 A;  1VFY A;  4ZDT A;  2XOZ A;  2HDP A;  3HTK C;  5B78 A;  2D8S A;  1WIM A;  3ZVZ B;  2ECN A;  3O47 A;  1WEW A;  4QF2 A;  4Z0R A;  2YYR A;  2L0B A;  4UP0 A;  2CKL A;  5G0F A;  3GL6 A;  3L1X A;  4ZQL A;  3LVR E;  4GND A;  5FEY A;  4C9Z A;  4AUQ B;  1LDJ B;  4LJN A;  2F6J A;  3LVQ E;  4AYC A;  5LKX A;  2MD7 B;  2EXU A;  5H1V A;  2VPD A;  1DCQ A;  2CSY A;  2KRE A;  4IC3 A;  5B75 A;  5DKA A;  2VPE A;  2M13 A;  1U6G B;  4B86 C;  2XP0 A;  3N9N A;  2FD4 A;  4ZUX U;  5H1U A;  3N9L A;  4A4C A;  3LQH A;  3I2D A;  4F52 B;  4FIP A;  4YAB A;  2Y43 A;  2YU4 A;  4AP4 A;  1JM7 A;  4WZ3 B;  2VJE B;  2CSZ A;  3KNV A;  5I3L A;  2YSM A;  2ZET C;  1WFK A;  2YQL A;  5H9M A;  1G25 A;  3IHP A;  4IC2 A;  2JM3 A;  4AYC B;  1T1H A;  2E6R A;  5TBN A;  2CON A;  4YC9 A;  1WEP A;  4GNG A;  2BAY A;  1N87 A;  3KV6 A;  3O33 A;  5LKU A;  4R7E A;  3HCT A;  1Z2Q A;  5C13 A;  3FJU B;  2LRI C;  1CHC A;  4YBS A;  2E6S A;  2EGM A;  2M3H A;  1V87 A;  4BHW A;  1X4U A;  3SHB A;  4YBT A;  4O62 A;  2IQJ A;  4Q6F A;  2JUN A;  2KGI A;  3LQI A;  2CRR A;  5TAB A;  3LRQ A;  3C6W A;  5D1L B;  3DQV R;  4YAT A;  2CSV A;  3L11 A;  4LK9 A;  5TDR A;  4A4B A; 
#chains in the Genus database with same CATH homology
 4MSX A;  3T6R A;  2K17 A;  4LAD B;  4S3O C;  2L5U A;  2Y1M A;  1JOC A;  3M62 A;  3MHH A;  2MUM A;  4V3L C;  1Z6U A;  1HYJ A;  3KV5 A;  2H0D B;  2ECT A;  2PNX A;  5J3X A;  4I7B A;  2C2V S;  2KWN A;  1VD4 A;  2RSD A;  5AIU A;  2FSA A;  1WEQ A;  5JG6 A;  2MA6 A;  1IYM A;  1WE9 A;  2CKL B;  4WZ2 A;  2C2L A;  3NG2 A;  2KE1 A;  2F6N A;  2LGK A;  1HYI A;  2L75 A;  3O35 A;  2YHO A;  4NN2 A;  2KWO A;  3ZTG A;  5AIT A;  4B7Y C;  4I7D A;  2JMI A;  4XI1 A;  2YT5 A;  5LKZ A;  1JM7 B;  2F42 A;  3O34 A;  3PUR A;  2FUI A;  4FJC A;  2AN6 A;  3SOU A;  4QF3 A;  2VJE A;  2ECV A;  3VK6 A;  4WZ0 A;  1BOR A;  4TKP B;  1MM3 A;  2YSJ A;  3FL2 A;  2K4D A;  5TRB A;  4LKA A;  2QIZ A;  3HCU A;  2QJ0 A;  5KH9 A;  2ECW A;  5TDW A;  5D1M B;  2YUC A;  3ZPV 1;  2IDA A;  1WEU A;  5FB0 A;  5KH3 A;  2XB1 A;  3LQJ A;  5D1K B;  3U5O A;  2KIZ A;  5LCW B;  2HYE D;  3ASL A;  2M85 A;  2VJF B;  1WEE A;  2EGP A;  3O36 A;  4GNF A;  1WEN A;  3HCS A;  2LGG A;  2JMJ A;  2MT5 A;  4L7X A;  1F62 A;  2VPB A;  3EB6 A;  2LN0 A;  2LQ6 A;  2JRJ A;  3ZYQ A;  4UI9 B;  3V43 A;  2G43 A;  3KQI A;  4CCG X;  3O70 A;  1VYX A;  2ECI A;  3O37 A;  5B79 A;  2H0D A;  5EYA F;  3M63 A;  1WEO A;  3PHD A;  2LGL A;  3ZVY A;  3C5K A;  4YAD A;  1WEM A;  4YBM A;  2ECJ A;  4A49 A;  2CT2 A;  1X4I A;  3N9O A;  2YHN A;  2LXP C;  4PPE A;  5C11 A;  2YQM A;  5LKT A;  1E4U A;  4R2Y A;  2UZG A;  3PUQ A;  1ZBD B;  4FO9 A;  3QZV A;  4YAX A;  2LGV A;  5B77 A;  2KU3 A;  2YRE A;  3ZNI A;  2KWJ A;  4MVT A;  2LXH C;  1LDK C;  2RI7 A;  4AVX A;  5KH7 A;  2EOD A;  3N9P A;  2FUU A;  1K2F A;  3SOW A;  2MNY A;  4LLB A;  4P5O B;  3EB5 A;  5FER A;  2LV9 A;  2M1R A;  3U5M A;  2MA5 A;  1FBV A;  5G04 B;  4V3K C;  1XWH A;  3O7A A;  3ZPV E;  3U5P A;  3U5N A;  1WIL A;  2Y1N A;  2G45 A;  3T7L A;  5G05 B;  2VPG A;  2KR4 A;  2K1J A;  2MIQ A;  4S3O B;  2YW8 A;  2L43 A;  5H1T A;  2DX8 A;  4N4F A;  2KGG A;  1MM2 A;  2MD8 C;  4I7C A;  4FK5 A;  3L1Z B;  2PUY A;  5DIN A;  3RPG C;  2KYU A;  2VJF A;  2G6Q A;  4W4U A;  3M99 A;  2L80 A;  5B8D A;  2I50 A;  2OXQ C;  4BBQ A;  1RMD A;  2EA6 A;  4R8P K;  2VNF A;  2LDR A;  2NAA A;  5B76 A;  2QIC A;  4X3G A;  5FB1 A;  2M6M A;  3GV4 A;  4CA1 A;  3N9M A;  4GNE A;  3MHS A;  4PTB A;  2KFT A;  1DVP A;  4A0C D;  2JMD A;  2YUR A;  1FP0 A;  1WEV A;  4L58 A;  2KWK A;  1X4J A;  2XEU A;  3RTR B;  1Z60 A;  3DPL R;  3N9Q A;  4O64 A;  1WGM A;  2MNZ A;  4N3W A;  2VP7 A;  2ECG A;  3SOX A;  4GB0 A;  3RPG B;  4UP5 A;  1WES A;  4WA6 A;  2K16 A;  1VFY A;  4ZDT A;  2HDP A;  3HTK C;  5B78 A;  2D8S A;  1WIM A;  3ZVZ B;  2ECN A;  1WEW A;  4QF2 A;  2YYR A;  2L0B A;  4UP0 A;  2CKL A;  5G0F A;  3GL6 A;  3L1X A;  4ZQL A;  4GND A;  5FEY A;  4C9Z A;  4AUQ B;  1LDJ B;  4LJN A;  2F6J A;  4AYC A;  5LKX A;  2MD7 B;  5H1V A;  2VPD A;  2CSY A;  2KRE A;  4IC3 A;  5B75 A;  5DKA A;  2VPE A;  1U6G B;  4B86 C;  3N9N A;  4ZUX U;  5H1U A;  3N9L A;  4A4C A;  3LQH A;  3I2D A;  4F52 B;  4FIP A;  4YAB A;  2Y43 A;  2YU4 A;  4AP4 A;  1JM7 A;  4WZ3 B;  2VJE B;  2CSZ A;  3KNV A;  5I3L A;  2YSM A;  2ZET C;  1WFK A;  2YQL A;  5H9M A;  1G25 A;  3IHP A;  4IC2 A;  4AYC B;  1T1H A;  2E6R A;  5TBN A;  4YC9 A;  1WEP A;  4GNG A;  2BAY A;  1N87 A;  3KV6 A;  3O33 A;  5LKU A;  4R7E A;  3HCT A;  1Z2Q A;  5C13 A;  2LRI C;  1CHC A;  4YBS A;  2E6S A;  2M3H A;  1V87 A;  4BHW A;  1X4U A;  3SHB A;  4YBT A;  4Q6F A;  2KGI A;  3LQI A;  5TAB A;  3LRQ A;  3C6W A;  5D1L B;  3DQV R;  4YAT A;  3L11 A;  4LK9 A;  5TDR A;  4A4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...