3DQVR

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
b'KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8
publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 7
structure length 86
sequence length 86
chains with identical sequence Y
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3dqvR00
3O35A 2QICA 2RSDA 2MD8C 4I7DA 2LDRA 2FUIA 3U5PA 5AIUA 2F42A 5TDRA 3RPGB 5C13A 1Z6UA 2NAAA 3ZNIA 4A0CD 1DVPA 3DQVR 2PUYA 4I7BA 3N9OA 4N3WA 3I2DA 2VJFB 4UP5A 2XEUA 3NG2A 5B79A 3N9LA 4V3LC 2F6NA 4BHWA 1WEEA 2KWNA 2KWKA 2YU4A 4AP4A 3N9QA 5TDWA 1X4JA 3ZVZB 1LDJB 2MNYA 4X3GA 4WZ3B 2JMDA 5FEYA 2HYED 4CA1A 1MM3A 1JOCA 3MHHA 4AYCA 2JMJA 4O64A 3EB6A 3LRQA 2HDPA 3RTRB 2MT5A 4S3OC 4GNEA 1XWHA 1FBVA 5D1LB 1WEMA 2VNFA 2MUMA 3L1XA 5LKXA 3HCUA 2LGGA 4YBSA 1U6GB 4QF3A 2DX8A 2G45A 3O7AA 5B75A 3M99A 5AITA 3U5OA 5FB1A 2G6QA 1WFKA 2LGLA 4FK5A 1WE9A 3PHDA 5G05B 4YABA 5JG6A 4F52B 4IC2A 2RI7A 4GNDA 4WZ2A 2CT2A 3V43A 5LKUA 1VFYA 2MD7B 2OXQC 5B8DA 2KR4A 4S3OB 2C2LA 2PNXA 3FL2A 3EB5A 2F6JA 5KH3A 3O33A 2YYRA 2VPGA 2LGVA 2H0DA 5C11A 2VJEA 4Q6FA 3N9MA 2MNZA 2YQMA 1WEOA 1WGMA 2LGKA 2CKLA 4LADB 4ZQLA 4R8PK 4FIPA 1IYMA 2BAYA 4A4CA 1JM7B 2LN0A 3C6WA 2LQ6A 5G0FA 2EA6A 3T7LA 3PURA 4YBMA 2VPEA 4PPEA 3O37A 3ASLA 2VPBA 4I7CA 4W4UA 3SOUA 1WILA 2ZETC 2M6MA 2KGGA 5B78A 5LKTA 4QF2A 1LDKC 3U5MA 3M62A 4GB0A 2KE1A 2KWOA 1G25A 2L0BA 2M85A 1N87A 2L43A 2CSYA 2IDAA 1WEPA 4LJNA 4MSXA 3KQIA 3HCSA 4LLBA 1Z2QA 2LXHC 2YQLA 2FUUA 5J3XA 4YC9A 3LQHA 1WEQA 5H1TA 4PTBA 2YURA 1HYIA 2KGIA 4C9ZA 2L75A 2L80A 1RMDA 5I3LA 5LKZA 2M1RA 4CCGX 4R2YA 2G43A 4MVTA 1Z60A 2LV9A 2KWJA 4WA6A 1WEUA 3GL6A 2VJFA 4R7EA 3DPLR 3ZPV1 4ZDTA 1F62A 1VD4A 2EGPA 2MIQA 2YSMA 1WESA 2C2VS 2KREA 2KFTA 5KH7A 3U5NA 3RPGC 4V3KC 4UP0A 4BBQA 5TRBA 3SOWA 4L7XA 5TBNA 2D8SA 2JMIA 2M3HA 4YAXA 3KV6A 4IC3A 1K2FA 5DKAA 3T6RA 1WIMA 5D1MB 5KH9A 4LKAA 5TABA 3M63A 2K1JA 5LCWB 3ZYQA 2MA6A 2Y1MA 4AYCB 2I50A 3QZVA 4AVXA 5G04B 2YHOA 2KIZA 4GNGA 2LRIC 1HYJA 2LXPC 2XB1A 3KNVA 3GV4A 2AN6A 2VPDA 4A4BA 3ZTGA 4ZUXU 4L58A 3LQIA 2KYUA 2K4DA 4YADA 5FERA 4NN2A 1MM2A 3O34A 2YT5A 4LK9A 3HTKC 3HCTA 3IHPA 4WZ0A 2YREA 1CHCA 2ECGA 3MHSA 2UZGA 4A49A 5H1UA 2ECIA 2ECWA 1V87A 4YATA 3O70A 5DINA 1WEWA 4YBTA 2E6SA 2K16A 1FP0A 2E6RA 2EODA 5EYAF 2H0DB 2ECTA 2VJEB 3ZVYA 1X4UA 5FB0A 4P5OB 4GNFA 2L5UA 5D1KB 2YHNA 5B77A 1BORA 2CKLB 4UI9B 1JM7A 3O36A 3VK6A 1T1HA 3L1ZB 2ECJA 1E4UA 2ECVA 2VP7A 2JRJA 3C5KA 5H9MA 4TKPB 3SHBA 4XI1A 4FJCA 3L11A 2QJ0A 2K17A 2YSJA 2CSZA 1ZBDB 2YW8A 3ZPVE 2YUCA 2Y1NA 3SOXA 1VYXA 4N4FA 4B86C 3KV5A 4AUQB 5H1VA 4FO9A 1WEVA 1WENA 3PUQA 4B7YC 5B76A 2Y43A 3LQJA 2ECNA 2FSAA 2MA5A 2QIZA 1X4IA 3N9PA 2KU3A 3N9NA
chains in the Genus database with same CATH superfamily
3O35A 2QICA 2RSDA 2MD8C 4I7DA 2LDRA 3MDBC 2FUIA 3U5PA 5AIUA 5SVIA 2F42A 5TDRA 3RPGB 5C13A 1Z6UA 2NAAA 3ZNIA 4A0CD 1DVPA 3DQVR 2PUYA 4I7BA 2MKEA 3N9OA 4N3WA 3I2DA 2VJFB 4UP5A 2XEUA 3NG2A 5B79A 3N9LA 2EXUA 3FM8C 4V3LC 2F6NA 3M7KA 4BHWA 1WEEA 2KWNA 2KWKA 2YU4A 4Z0RA 4AP4A 3N9QA 5TDWA 1X4JA 3E2DA 3ZVZB 1LDJB 2MNYA 4X3GA 4WZ3B 2JMDA 5FEYA 2HYED 4CA1A 1MM3A 1JOCA 3MHHA 4AYCA 2JMJA 3FAOA 4O64A 3EB6A 3LRQA 2HDPA 3RTRB 2MT5A 4S3OC 4GNEA 1XWHA 1FBVA 2P57A 5D1LB 1WEMA 2KKXA 2VNFA 2MUMA 3L1XA 5LKXA 3HCUA 2LGGA 3FEHA 4YBSA 1U6GB 4QF3A 2DX8A 2CRRA 2G45A 3FJUB 3O7AA 5B75A 3M99A 5AITA 2L7PA 3U5OA 5FB1A 2G6QA 1WFKA 2LGLA 4FK5A 1WE9A 3PHDA 5G05B 3Q1DA 4YABA 5JG6A 4F52B 4IC2A 2RI7A 4GNDA 4WZ2A 2JM3A 2CT2A 3V43A 5LKUA 1VFYA 2MD7B 3O47A 2OXQC 5B8DA 5K3QA 2KR4A 4S3OB 2C2LA 2PNXA 3FL2A 3EB5A 2F6JA 5KH3A 2EGMA 3O33A 2YYRA 2VPGA 2LGVA 2H0DA 5C11A 2VJEA 3N9MA 4Q6FA 2MNZA 2YQMA 1WEOA 1WGMA 2XOZA 2LGKA 2YVRA 2CKLA 4LADB 4ZQLA 4R8PK 4FIPA 1IYMA 2BAYA 4A4CA 1JM7B 2LN0A 3C6WA 2XP0A 2LQ6A 5G0FA 2EA6A 3T7LA 3PURA 4OGCA 2B0OE 4YBMA 2VPEA 4PPEA 3O37A 3ASLA 2VPBA 4I7CA 4W4UA 3SOUA 3JUEA 1WILA 2ZETC 2M6MA 2KGGA 1MBMA 5B78A 5LKTA 4QF2A 1LDKC 3U5MA 3M62A 4GB0A 2CSVA 2KE1A 2KWOA 1G25A 2L0BA 2M85A 1N87A 2L43A 2CSYA 2IDAA 1WEPA 4LJNA 4MSXA 3KQIA 3HCSA 4LLBA 2XOCA 1Z2QA 2LXHC 2YQLA 3LDYA 2XOYA 3LVRE 2FUUA 5J3XA 4YC9A 3LQHA 1WEQA 5H1TA 4PTBA 2IQJA 2YURA 2E61A 1HYIA 2KGIA 4C9ZA 2L75A 2L80A 1RMDA 5I3LA 5LKZA 2M1RA 4CCGX 4R2YA 2G43A 4MVTA 3DDTA 1Z60A 2LV9A 2KWJA 5SVXA 4WA6A 1WEUA 3GL6A 2VJFA 4R7EA 3DPLR 3ZPV1 3SUBA 4ZDTA 1F62A 1VD4A 2EGPA 2MIQA 2YSMA 1WESA 2RR4A 2C2VS 2KREA 2KFTA 4OGEA 5KH7A 3U5NA 5SVYA 3RPGC 4V3KC 4UP0A 4BBQA 5TRBA 3SOWA 3KDEC 4L7XA 5TBNA 2D8SA 2JMIA 2M3HA 4YAXA 3KV6A 4IC3A 4F1PA 1K2FA 5DKAA 3T6RA 1WIMA 5D1MB 5KH9A 4LKAA 5TABA 2KKYA 3M63A 2K1JA 5LCWB 3ZYQA 2MA6A 2Y1MA 4AYCB 2I50A 2D8UA 3QZVA 4AVXA 5G04B 2YHOA 2KIZA 3LVQE 4GNGA 2LRIC 2FD4A 1HYJA 4QQ4A 2LXPC 2XB1A 3KNVA 3GV4A 2AN6A 2VPDA 4A4BA 3ZTGA 4ZUXU 4L58A 3LQIA 2KYUA 2K4DA 4YADA 5FERA 2FFWA 4NN2A 3H7HA 1MM2A 2DSMA 3O34A 2YT5A 4LK9A 3HTKC 3HCTA 3IHPA 4WZ0A 1DCQA 2YREA 3FANA 1CHCA 2ECGA 3MHSA 2UZGA 4A49A 5H1UA 2ECIA 2ECWA 1V87A 4YATA 3O70A 5DINA 1WEWA 4YBTA 2E6SA 2K16A 1FP0A 2E6RA 2DJAA 2EODA 5EYAF 2H0DB 2ECTA 2VJEB 3ZVYA 1X4UA 5FB0A 4P5OB 4GNFA 2L5UA 5D1KB 2YHNA 5B77A 5SVIB 1BORA 2CKLB 2M13A 4UI9B 1JM7A 3O36A 3VK6A 1T1HA 2OWAA 3L1ZB 2ECJA 1E4UA 2ECVA 2CONA 2VP7A 2JRJA 3C5KA 5H9MA 3LJUX 3DWDA 4TKPB 3SHBA 4XI1A 4FJCA 3L11A 2QJ0A 2K17A 2YSJA 2CSZA 1ZBDB 2YW8A 3ZPVE 2YUCA 2Y1NA 4Z0OA 3SOXA 1VYXA 4N4FA 3T9KA 4H9DA 3KV5A 4B86C 4AUQB 5H1VA 4FO9A 1WEVA 3PLWA 2CRWA 1WENA 3PUQA 2JUNA 4B7YC 5B76A 2Y43A 4O62A 3LQJA 2ECNA 2FSAA 2MA5A 2LAUA 2QIZA 1X4IA 3N9PA 2KU3A 3N9NA
chains in the Genus database with same CATH topology
3O35A 2QICA 2RSDA 2MD8C 4I7DA 2LDRA 2FUIA 3U5PA 5AIUA 2F42A 5TDRA 3RPGB 5C13A 1Z6UA 2NAAA 3ZNIA 4A0CD 1DVPA 3DQVR 2PUYA 4I7BA 3N9OA 4N3WA 3I2DA 2VJFB 4UP5A 2XEUA 3NG2A 5B79A 3N9LA 4V3LC 2F6NA 4BHWA 1WEEA 2KWNA 2KWKA 2YU4A 4AP4A 3N9QA 5TDWA 1X4JA 3ZVZB 1LDJB 2MNYA 4X3GA 4WZ3B 2JMDA 5FEYA 2HYED 4CA1A 1MM3A 1JOCA 3MHHA 4AYCA 2JMJA 4O64A 3EB6A 3LRQA 2HDPA 3RTRB 2MT5A 4S3OC 4GNEA 1XWHA 1FBVA 5D1LB 1WEMA 2VNFA 2MUMA 3L1XA 5LKXA 3HCUA 2LGGA 4YBSA 1U6GB 4QF3A 2DX8A 2G45A 3O7AA 5B75A 3M99A 5AITA 3U5OA 5FB1A 2G6QA 1WFKA 2LGLA 4FK5A 1WE9A 3PHDA 5G05B 4YABA 5JG6A 4F52B 4IC2A 2RI7A 4GNDA 4WZ2A 2CT2A 3V43A 5LKUA 1VFYA 2MD7B 2OXQC 5B8DA 2KR4A 4S3OB 2C2LA 2PNXA 3FL2A 3EB5A 2F6JA 5KH3A 3O33A 2YYRA 2VPGA 2LGVA 2H0DA 5C11A 2VJEA 4Q6FA 3N9MA 2MNZA 2YQMA 1WEOA 1WGMA 2LGKA 2CKLA 4LADB 4ZQLA 4R8PK 4FIPA 1IYMA 2BAYA 4A4CA 1JM7B 2LN0A 3C6WA 2LQ6A 5G0FA 2EA6A 3T7LA 3PURA 4YBMA 2VPEA 4PPEA 3O37A 3ASLA 2VPBA 4I7CA 4W4UA 3SOUA 1WILA 2ZETC 2M6MA 2KGGA 5B78A 5LKTA 4QF2A 1LDKC 3U5MA 3M62A 4GB0A 2KE1A 2KWOA 1G25A 2L0BA 2M85A 1N87A 2L43A 2CSYA 2IDAA 1WEPA 4LJNA 4MSXA 3KQIA 3HCSA 4LLBA 1Z2QA 2LXHC 2YQLA 2FUUA 5J3XA 4YC9A 3LQHA 1WEQA 5H1TA 4PTBA 2YURA 1HYIA 2KGIA 4C9ZA 2L75A 2L80A 1RMDA 5I3LA 5LKZA 2M1RA 4CCGX 4R2YA 2G43A 4MVTA 1Z60A 2LV9A 2KWJA 4WA6A 1WEUA 3GL6A 2VJFA 4R7EA 3DPLR 3ZPV1 4ZDTA 1F62A 1VD4A 2EGPA 2MIQA 2YSMA 1WESA 2C2VS 2KREA 2KFTA 5KH7A 3U5NA 3RPGC 4V3KC 4UP0A 4BBQA 5TRBA 3SOWA 4L7XA 5TBNA 2D8SA 2JMIA 2M3HA 4YAXA 3KV6A 4IC3A 1K2FA 5DKAA 3T6RA 1WIMA 5D1MB 5KH9A 4LKAA 5TABA 3M63A 2K1JA 5LCWB 3ZYQA 2MA6A 2Y1MA 4AYCB 2I50A 3QZVA 4AVXA 5G04B 2YHOA 2KIZA 4GNGA 2LRIC 1HYJA 2LXPC 2XB1A 3KNVA 3GV4A 2AN6A 2VPDA 4A4BA 3ZTGA 4ZUXU 4L58A 3LQIA 2KYUA 2K4DA 4YADA 5FERA 4NN2A 1MM2A 3O34A 2YT5A 4LK9A 3HTKC 3HCTA 3IHPA 4WZ0A 2YREA 1CHCA 2ECGA 3MHSA 2UZGA 4A49A 5H1UA 2ECIA 2ECWA 1V87A 4YATA 3O70A 5DINA 1WEWA 4YBTA 2E6SA 2K16A 1FP0A 2E6RA 2EODA 5EYAF 2H0DB 2ECTA 2VJEB 3ZVYA 1X4UA 5FB0A 4P5OB 4GNFA 2L5UA 5D1KB 2YHNA 5B77A 1BORA 2CKLB 4UI9B 1JM7A 3O36A 3VK6A 1T1HA 3L1ZB 2ECJA 1E4UA 2ECVA 2VP7A 2JRJA 3C5KA 5H9MA 4TKPB 3SHBA 4XI1A 4FJCA 3L11A 2QJ0A 2K17A 2YSJA 2CSZA 1ZBDB 2YW8A 3ZPVE 2YUCA 2Y1NA 3SOXA 1VYXA 4N4FA 4B86C 3KV5A 4AUQB 5H1VA 4FO9A 1WEVA 1WENA 3PUQA 4B7YC 5B76A 2Y43A 3LQJA 2ECNA 2FSAA 2MA5A 2QIZA 1X4IA 3N9PA 2KU3A 3N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O35 A;  2QIC A;  2RSD A;  2MD8 C;  4I7D A;  2LDR A;  2FUI A;  3U5P A;  5AIU A;  2F42 A;  5TDR A;  3RPG B;  5C13 A;  1Z6U A;  2NAA A;  3ZNI A;  4A0C D;  1DVP A;  3DQV R;  2PUY A;  4I7B A;  3N9O A;  4N3W A;  3I2D A;  2VJF B;  4UP5 A;  2XEU A;  3NG2 A;  5B79 A;  3N9L A;  4V3L C;  2F6N A;  4BHW A;  1WEE A;  2KWN A;  2KWK A;  2YU4 A;  4AP4 A;  3N9Q A;  5TDW A;  1X4J A;  3ZVZ B;  1LDJ B;  2MNY A;  4X3G A;  4WZ3 B;  2JMD A;  5FEY A;  2HYE D;  4CA1 A;  1MM3 A;  1JOC A;  3MHH A;  4AYC A;  2JMJ A;  4O64 A;  3EB6 A;  3LRQ A;  2HDP A;  3RTR B;  2MT5 A;  4S3O C;  4GNE A;  1XWH A;  1FBV A;  5D1L B;  1WEM A;  2VNF A;  2MUM A;  3L1X A;  5LKX A;  3HCU A;  2LGG A;  4YBS A;  1U6G B;  4QF3 A;  2DX8 A;  2G45 A;  3O7A A;  5B75 A;  3M99 A;  5AIT A;  3U5O A;  5FB1 A;  2G6Q A;  1WFK A;  2LGL A;  4FK5 A;  1WE9 A;  3PHD A;  5G05 B;  4YAB A;  5JG6 A;  4F52 B;  4IC2 A;  2RI7 A;  4GND A;  4WZ2 A;  2CT2 A;  3V43 A;  5LKU A;  1VFY A;  2MD7 B;  2OXQ C;  5B8D A;  2KR4 A;  4S3O B;  2C2L A;  2PNX A;  3FL2 A;  3EB5 A;  2F6J A;  5KH3 A;  3O33 A;  2YYR A;  2VPG A;  2LGV A;  2H0D A;  5C11 A;  2VJE A;  4Q6F A;  3N9M A;  2MNZ A;  2YQM A;  1WEO A;  1WGM A;  2LGK A;  2CKL A;  4LAD B;  4ZQL A;  4R8P K;  4FIP A;  1IYM A;  2BAY A;  4A4C A;  1JM7 B;  2LN0 A;  3C6W A;  2LQ6 A;  5G0F A;  2EA6 A;  3T7L A;  3PUR A;  4YBM A;  2VPE A;  4PPE A;  3O37 A;  3ASL A;  2VPB A;  4I7C A;  4W4U A;  3SOU A;  1WIL A;  2ZET C;  2M6M A;  2KGG A;  5B78 A;  5LKT A;  4QF2 A;  1LDK C;  3U5M A;  3M62 A;  4GB0 A;  2KE1 A;  2KWO A;  1G25 A;  2L0B A;  2M85 A;  1N87 A;  2L43 A;  2CSY A;  2IDA A;  1WEP A;  4LJN A;  4MSX A;  3KQI A;  3HCS A;  4LLB A;  1Z2Q A;  2LXH C;  2YQL A;  2FUU A;  5J3X A;  4YC9 A;  3LQH A;  1WEQ A;  5H1T A;  4PTB A;  2YUR A;  1HYI A;  2KGI A;  4C9Z A;  2L75 A;  2L80 A;  1RMD A;  5I3L A;  5LKZ A;  2M1R A;  4CCG X;  4R2Y A;  2G43 A;  4MVT A;  1Z60 A;  2LV9 A;  2KWJ A;  4WA6 A;  1WEU A;  3GL6 A;  2VJF A;  4R7E A;  3DPL R;  3ZPV 1;  4ZDT A;  1F62 A;  1VD4 A;  2EGP A;  2MIQ A;  2YSM A;  1WES A;  2C2V S;  2KRE A;  2KFT A;  5KH7 A;  3U5N A;  3RPG C;  4V3K C;  4UP0 A;  4BBQ A;  5TRB A;  3SOW A;  4L7X A;  5TBN A;  2D8S A;  2JMI A;  2M3H A;  4YAX A;  3KV6 A;  4IC3 A;  1K2F A;  5DKA A;  3T6R A;  1WIM A;  5D1M B;  5KH9 A;  4LKA A;  5TAB A;  3M63 A;  2K1J A;  5LCW B;  3ZYQ A;  2MA6 A;  2Y1M A;  4AYC B;  2I50 A;  3QZV A;  4AVX A;  5G04 B;  2YHO A;  2KIZ A;  4GNG A;  2LRI C;  1HYJ A;  2LXP C;  2XB1 A;  3KNV A;  3GV4 A;  2AN6 A;  2VPD A;  4A4B A;  3ZTG A;  4ZUX U;  4L58 A;  3LQI A;  2KYU A;  2K4D A;  4YAD A;  5FER A;  4NN2 A;  1MM2 A;  3O34 A;  2YT5 A;  4LK9 A;  3HTK C;  3HCT A;  3IHP A;  4WZ0 A;  2YRE A;  1CHC A;  2ECG A;  3MHS A;  2UZG A;  4A49 A;  5H1U A;  2ECI A;  2ECW A;  1V87 A;  4YAT A;  3O70 A;  5DIN A;  1WEW A;  4YBT A;  2E6S A;  2K16 A;  1FP0 A;  2E6R A;  2EOD A;  5EYA F;  2H0D B;  2ECT A;  2VJE B;  3ZVY A;  1X4U A;  5FB0 A;  4P5O B;  4GNF A;  2L5U A;  5D1K B;  2YHN A;  5B77 A;  1BOR A;  2CKL B;  4UI9 B;  1JM7 A;  3O36 A;  3VK6 A;  1T1H A;  3L1Z B;  2ECJ A;  1E4U A;  2ECV A;  2VP7 A;  2JRJ A;  3C5K A;  5H9M A;  4TKP B;  3SHB A;  4XI1 A;  4FJC A;  3L11 A;  2QJ0 A;  2K17 A;  2YSJ A;  2CSZ A;  1ZBD B;  2YW8 A;  3ZPV E;  2YUC A;  2Y1N A;  3SOX A;  1VYX A;  4N4F A;  4B86 C;  3KV5 A;  4AUQ B;  5H1V A;  4FO9 A;  1WEV A;  1WEN A;  3PUQ A;  4B7Y C;  5B76 A;  2Y43 A;  3LQJ A;  2ECN A;  2FSA A;  2MA5 A;  2QIZ A;  1X4I A;  3N9P A;  2KU3 A;  3N9N A; 
#chains in the Genus database with same CATH topology
 3O35 A;  2QIC A;  2RSD A;  2MD8 C;  4I7D A;  2LDR A;  3MDB C;  2FUI A;  3U5P A;  5AIU A;  5SVI A;  2F42 A;  5TDR A;  3RPG B;  5C13 A;  1Z6U A;  2NAA A;  3ZNI A;  4A0C D;  1DVP A;  3DQV R;  2PUY A;  4I7B A;  2MKE A;  3N9O A;  4N3W A;  3I2D A;  2VJF B;  4UP5 A;  2XEU A;  3NG2 A;  5B79 A;  3N9L A;  2EXU A;  3FM8 C;  4V3L C;  2F6N A;  3M7K A;  4BHW A;  1WEE A;  2KWN A;  2KWK A;  2YU4 A;  4Z0R A;  4AP4 A;  3N9Q A;  5TDW A;  1X4J A;  3E2D A;  3ZVZ B;  1LDJ B;  2MNY A;  4X3G A;  4WZ3 B;  2JMD A;  5FEY A;  2HYE D;  4CA1 A;  1MM3 A;  1JOC A;  3MHH A;  4AYC A;  2JMJ A;  3FAO A;  4O64 A;  3EB6 A;  3LRQ A;  2HDP A;  3RTR B;  2MT5 A;  4S3O C;  4GNE A;  1XWH A;  1FBV A;  2P57 A;  5D1L B;  1WEM A;  2KKX A;  2VNF A;  2MUM A;  3L1X A;  5LKX A;  3HCU A;  2LGG A;  3FEH A;  4YBS A;  1U6G B;  4QF3 A;  2DX8 A;  2CRR A;  2G45 A;  3FJU B;  3O7A A;  5B75 A;  3M99 A;  5AIT A;  2L7P A;  3U5O A;  5FB1 A;  2G6Q A;  1WFK A;  2LGL A;  4FK5 A;  1WE9 A;  3PHD A;  5G05 B;  3Q1D A;  4YAB A;  5JG6 A;  4F52 B;  4IC2 A;  2RI7 A;  4GND A;  4WZ2 A;  2JM3 A;  2CT2 A;  3V43 A;  5LKU A;  1VFY A;  2MD7 B;  3O47 A;  2OXQ C;  5B8D A;  5K3Q A;  2KR4 A;  4S3O B;  2C2L A;  2PNX A;  3FL2 A;  3EB5 A;  2F6J A;  5KH3 A;  2EGM A;  3O33 A;  2YYR A;  2VPG A;  2LGV A;  2H0D A;  5C11 A;  2VJE A;  3N9M A;  4Q6F A;  2MNZ A;  2YQM A;  1WEO A;  1WGM A;  2XOZ A;  2LGK A;  2YVR A;  2CKL A;  4LAD B;  4ZQL A;  4R8P K;  4FIP A;  1IYM A;  2BAY A;  4A4C A;  1JM7 B;  2LN0 A;  3C6W A;  2XP0 A;  2LQ6 A;  5G0F A;  2EA6 A;  3T7L A;  3PUR A;  4OGC A;  2B0O E;  4YBM A;  2VPE A;  4PPE A;  3O37 A;  3ASL A;  2VPB A;  4I7C A;  4W4U A;  3SOU A;  3JUE A;  1WIL A;  2ZET C;  2M6M A;  2KGG A;  1MBM A;  5B78 A;  5LKT A;  4QF2 A;  1LDK C;  3U5M A;  3M62 A;  4GB0 A;  2CSV A;  2KE1 A;  2KWO A;  1G25 A;  2L0B A;  2M85 A;  1N87 A;  2L43 A;  2CSY A;  2IDA A;  1WEP A;  4LJN A;  4MSX A;  3KQI A;  3HCS A;  4LLB A;  2XOC A;  1Z2Q A;  2LXH C;  2YQL A;  3LDY A;  2XOY A;  3LVR E;  2FUU A;  5J3X A;  4YC9 A;  3LQH A;  1WEQ A;  5H1T A;  4PTB A;  2IQJ A;  2YUR A;  2E61 A;  1HYI A;  2KGI A;  4C9Z A;  2L75 A;  2L80 A;  1RMD A;  5I3L A;  5LKZ A;  2M1R A;  4CCG X;  4R2Y A;  2G43 A;  4MVT A;  3DDT A;  1Z60 A;  2LV9 A;  2KWJ A;  5SVX A;  4WA6 A;  1WEU A;  3GL6 A;  2VJF A;  4R7E A;  3DPL R;  3ZPV 1;  3SUB A;  4ZDT A;  1F62 A;  1VD4 A;  2EGP A;  2MIQ A;  2YSM A;  1WES A;  2RR4 A;  2C2V S;  2KRE A;  2KFT A;  4OGE A;  5KH7 A;  3U5N A;  5SVY A;  3RPG C;  4V3K C;  4UP0 A;  4BBQ A;  5TRB A;  3SOW A;  3KDE C;  4L7X A;  5TBN A;  2D8S A;  2JMI A;  2M3H A;  4YAX A;  3KV6 A;  4IC3 A;  4F1P A;  1K2F A;  5DKA A;  3T6R A;  1WIM A;  5D1M B;  5KH9 A;  4LKA A;  5TAB A;  2KKY A;  3M63 A;  2K1J A;  5LCW B;  3ZYQ A;  2MA6 A;  2Y1M A;  4AYC B;  2I50 A;  2D8U A;  3QZV A;  4AVX A;  5G04 B;  2YHO A;  2KIZ A;  3LVQ E;  4GNG A;  2LRI C;  2FD4 A;  1HYJ A;  4QQ4 A;  2LXP C;  2XB1 A;  3KNV A;  3GV4 A;  2AN6 A;  2VPD A;  4A4B A;  3ZTG A;  4ZUX U;  4L58 A;  3LQI A;  2KYU A;  2K4D A;  4YAD A;  5FER A;  2FFW A;  4NN2 A;  3H7H A;  1MM2 A;  2DSM A;  3O34 A;  2YT5 A;  4LK9 A;  3HTK C;  3HCT A;  3IHP A;  4WZ0 A;  1DCQ A;  2YRE A;  3FAN A;  1CHC A;  2ECG A;  3MHS A;  2UZG A;  4A49 A;  5H1U A;  2ECI A;  2ECW A;  1V87 A;  4YAT A;  3O70 A;  5DIN A;  1WEW A;  4YBT A;  2E6S A;  2K16 A;  1FP0 A;  2E6R A;  2DJA A;  2EOD A;  5EYA F;  2H0D B;  2ECT A;  2VJE B;  3ZVY A;  1X4U A;  5FB0 A;  4P5O B;  4GNF A;  2L5U A;  5D1K B;  2YHN A;  5B77 A;  5SVI B;  1BOR A;  2CKL B;  2M13 A;  4UI9 B;  1JM7 A;  3O36 A;  3VK6 A;  1T1H A;  2OWA A;  3L1Z B;  2ECJ A;  1E4U A;  2ECV A;  2CON A;  2VP7 A;  2JRJ A;  3C5K A;  5H9M A;  3LJU X;  3DWD A;  4TKP B;  3SHB A;  4XI1 A;  4FJC A;  3L11 A;  2QJ0 A;  2K17 A;  2YSJ A;  2CSZ A;  1ZBD B;  2YW8 A;  3ZPV E;  2YUC A;  2Y1N A;  4Z0O A;  3SOX A;  1VYX A;  4N4F A;  3T9K A;  4H9D A;  3KV5 A;  4B86 C;  4AUQ B;  5H1V A;  4FO9 A;  1WEV A;  3PLW A;  2CRW A;  1WEN A;  3PUQ A;  2JUN A;  4B7Y C;  5B76 A;  2Y43 A;  4O62 A;  3LQJ A;  2ECN A;  2FSA A;  2MA5 A;  2LAU A;  2QIZ A;  1X4I A;  3N9P A;  2KU3 A;  3N9N A; 
#chains in the Genus database with same CATH homology
 3O35 A;  2QIC A;  2RSD A;  2MD8 C;  4I7D A;  2LDR A;  2FUI A;  3U5P A;  5AIU A;  2F42 A;  5TDR A;  3RPG B;  5C13 A;  1Z6U A;  2NAA A;  3ZNI A;  4A0C D;  1DVP A;  3DQV R;  2PUY A;  4I7B A;  3N9O A;  4N3W A;  3I2D A;  2VJF B;  4UP5 A;  2XEU A;  3NG2 A;  5B79 A;  3N9L A;  4V3L C;  2F6N A;  4BHW A;  1WEE A;  2KWN A;  2KWK A;  2YU4 A;  4AP4 A;  3N9Q A;  5TDW A;  1X4J A;  3ZVZ B;  1LDJ B;  2MNY A;  4X3G A;  4WZ3 B;  2JMD A;  5FEY A;  2HYE D;  4CA1 A;  1MM3 A;  1JOC A;  3MHH A;  4AYC A;  2JMJ A;  4O64 A;  3EB6 A;  3LRQ A;  2HDP A;  3RTR B;  2MT5 A;  4S3O C;  4GNE A;  1XWH A;  1FBV A;  5D1L B;  1WEM A;  2VNF A;  2MUM A;  3L1X A;  5LKX A;  3HCU A;  2LGG A;  4YBS A;  1U6G B;  4QF3 A;  2DX8 A;  2G45 A;  3O7A A;  5B75 A;  3M99 A;  5AIT A;  3U5O A;  5FB1 A;  2G6Q A;  1WFK A;  2LGL A;  4FK5 A;  1WE9 A;  3PHD A;  5G05 B;  4YAB A;  5JG6 A;  4F52 B;  4IC2 A;  2RI7 A;  4GND A;  4WZ2 A;  2CT2 A;  3V43 A;  5LKU A;  1VFY A;  2MD7 B;  2OXQ C;  5B8D A;  2KR4 A;  4S3O B;  2C2L A;  2PNX A;  3FL2 A;  3EB5 A;  2F6J A;  5KH3 A;  3O33 A;  2YYR A;  2VPG A;  2LGV A;  2H0D A;  5C11 A;  2VJE A;  4Q6F A;  3N9M A;  2MNZ A;  2YQM A;  1WEO A;  1WGM A;  2LGK A;  2CKL A;  4LAD B;  4ZQL A;  4R8P K;  4FIP A;  1IYM A;  2BAY A;  4A4C A;  1JM7 B;  2LN0 A;  3C6W A;  2LQ6 A;  5G0F A;  2EA6 A;  3T7L A;  3PUR A;  4YBM A;  2VPE A;  4PPE A;  3O37 A;  3ASL A;  2VPB A;  4I7C A;  4W4U A;  3SOU A;  1WIL A;  2ZET C;  2M6M A;  2KGG A;  5B78 A;  5LKT A;  4QF2 A;  1LDK C;  3U5M A;  3M62 A;  4GB0 A;  2KE1 A;  2KWO A;  1G25 A;  2L0B A;  2M85 A;  1N87 A;  2L43 A;  2CSY A;  2IDA A;  1WEP A;  4LJN A;  4MSX A;  3KQI A;  3HCS A;  4LLB A;  1Z2Q A;  2LXH C;  2YQL A;  2FUU A;  5J3X A;  4YC9 A;  3LQH A;  1WEQ A;  5H1T A;  4PTB A;  2YUR A;  1HYI A;  2KGI A;  4C9Z A;  2L75 A;  2L80 A;  1RMD A;  5I3L A;  5LKZ A;  2M1R A;  4CCG X;  4R2Y A;  2G43 A;  4MVT A;  1Z60 A;  2LV9 A;  2KWJ A;  4WA6 A;  1WEU A;  3GL6 A;  2VJF A;  4R7E A;  3DPL R;  3ZPV 1;  4ZDT A;  1F62 A;  1VD4 A;  2EGP A;  2MIQ A;  2YSM A;  1WES A;  2C2V S;  2KRE A;  2KFT A;  5KH7 A;  3U5N A;  3RPG C;  4V3K C;  4UP0 A;  4BBQ A;  5TRB A;  3SOW A;  4L7X A;  5TBN A;  2D8S A;  2JMI A;  2M3H A;  4YAX A;  3KV6 A;  4IC3 A;  1K2F A;  5DKA A;  3T6R A;  1WIM A;  5D1M B;  5KH9 A;  4LKA A;  5TAB A;  3M63 A;  2K1J A;  5LCW B;  3ZYQ A;  2MA6 A;  2Y1M A;  4AYC B;  2I50 A;  3QZV A;  4AVX A;  5G04 B;  2YHO A;  2KIZ A;  4GNG A;  2LRI C;  1HYJ A;  2LXP C;  2XB1 A;  3KNV A;  3GV4 A;  2AN6 A;  2VPD A;  4A4B A;  3ZTG A;  4ZUX U;  4L58 A;  3LQI A;  2KYU A;  2K4D A;  4YAD A;  5FER A;  4NN2 A;  1MM2 A;  3O34 A;  2YT5 A;  4LK9 A;  3HTK C;  3HCT A;  3IHP A;  4WZ0 A;  2YRE A;  1CHC A;  2ECG A;  3MHS A;  2UZG A;  4A49 A;  5H1U A;  2ECI A;  2ECW A;  1V87 A;  4YAT A;  3O70 A;  5DIN A;  1WEW A;  4YBT A;  2E6S A;  2K16 A;  1FP0 A;  2E6R A;  2EOD A;  5EYA F;  2H0D B;  2ECT A;  2VJE B;  3ZVY A;  1X4U A;  5FB0 A;  4P5O B;  4GNF A;  2L5U A;  5D1K B;  2YHN A;  5B77 A;  1BOR A;  2CKL B;  4UI9 B;  1JM7 A;  3O36 A;  3VK6 A;  1T1H A;  3L1Z B;  2ECJ A;  1E4U A;  2ECV A;  2VP7 A;  2JRJ A;  3C5K A;  5H9M A;  4TKP B;  3SHB A;  4XI1 A;  4FJC A;  3L11 A;  2QJ0 A;  2K17 A;  2YSJ A;  2CSZ A;  1ZBD B;  2YW8 A;  3ZPV E;  2YUC A;  2Y1N A;  3SOX A;  1VYX A;  4N4F A;  4B86 C;  3KV5 A;  4AUQ B;  5H1V A;  4FO9 A;  1WEV A;  1WEN A;  3PUQ A;  4B7Y C;  5B76 A;  2Y43 A;  3LQJ A;  2ECN A;  2FSA A;  2MA5 A;  2QIZ A;  1X4I A;  3N9P A;  2KU3 A;  3N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...