3DQVR

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords NEDD8
publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 86
sequence length 86
chains with identical sequence Y
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3dqvR00
1WFKA 2ECTA 4N3WA 2E6RA 2FUIA 4ZDTA 3T6RA 5B77A 4I7DA 5C11A 3EB5A 2KE1A 1F62A 2LXPC 3N9OA 1FP0A 2Y1MA 4LK9A 3N9LA 4R8PK 5H1VA 4R7EA 2KR4A 3O35A 1K2FA 2YQMA 1X4IA 5LKXA 3SOXA 2K4DA 2ECWA 4B7YC 2ECVA 2DX8A 3KV6A 2LRIC 1JOCA 2HYED 2KIZA 1E4UA 5TDWA 2K1JA 3ASLA 2YW8A 1MM3A 5B76A 3LQJA 4FO9A 1WEVA 1WEUA 3L11A 5D1LB 1WGMA 1MM2A 2L75A 2LGLA 3PURA 2BAYA 2G45A 2MT5A 5C13A 3MHHA 2VP7A 2L0BA 4YC9A 2EA6A 4TKPB 5TABA 3HCSA 2MA5A 4ZUXU 4MVTA 3C5KA 5FB1A 3ZPVE 1WEPA 1V87A 4FK5A 3FL2A 3I2DA 2VPEA 5H1TA 3N9QA 4CCGX 4A0CD 3KNVA 3M63A 2MD8C 1FBVA 2MUMA 3O33A 2YSMA 3RPGC 2JMDA 2RSDA 4UP5A 2FSAA 4UI9B 3N9MA 5LCWB 4V3LC 4V3KC 3KQIA 3IHPA 3LQIA 4AYCB 4AYCA 1VYXA 4YBMA 3L1XA 5H1UA 2F6JA 2XEUA 3ZNIA 2MNZA 2UZGA 2YQLA 3NG2A 1VD4A 1WEQA 4X3GA 5D1KB 2MNYA 2Y43A 4PTBA 3SOWA 2I50A 2VJFB 2ZETC 3PUQA 2YHOA 5H9MA 2OXQC 2KGGA 5FERA 5LKZA 5JG6A 3U5OA 3MHSA 4GNGA 4BHWA 4L7XA 4W4UA 5LKUA 4LLBA 4FIPA 2L80A 1WEEA 2YUCA 5G04B 3GL6A 2XB1A 4L58A 2MD7B 1HYJA 1IYMA 3T7LA 4YAXA 3N9NA 4N4FA 2E6SA 3ZTGA 3HCUA 4WZ2A 2YSJA 3U5NA 1Z60A 2K17A 4AVXA 2L5UA 3O7AA 4MSXA 2QICA 2M6MA 4YBSA 4AP4A 4YATA 5FB0A 5AITA 2M1RA 2G6QA 4P5OB 2LN0A 4NN2A 2G43A 3ZVZB 1Z6UA 4WZ0A 2CSYA 4B86C 1N87A 1LDKC 1U6GB 2PUYA 3VK6A 4FJCA 4CA1A 2KWNA 2K16A 2JMJA 2LGGA 3DQVR 4S3OB 2KU3A 5B75A 1WIMA 3ZPV1 2KWOA 4I7BA 2ECJA 4Q6FA 1DVPA 2Y1NA 4QF2A 4F52B 2JMIA 2HDPA 2VJEB 4LKAA 2CKLB 3O70A 2LDRA 2CKLA 2LGKA 2LXHC 5KH9A 2VPBA 4PPEA 4AUQB 2YURA 2F42A 5DKAA 1WEMA 1ZBDB 5KH7A 4GNEA 3M62A 4IC3A 4I7CA 2H0DB 1G25A 2ECIA 3C6WA 1WEWA 3N9PA 4GB0A 4LJNA 4WA6A 3RTRB 2YU4A 5LKTA 4O64A 3SHBA 2EODA 4GNDA 4GNFA 2VNFA 2LGVA 5KH3A 2LV9A 2C2VS 2VJFA 3LRQA 1XWHA 3PHDA 4LADB 3O37A 5J3XA 3HCTA 4YADA 2C2LA 2JRJA 1Z2QA 2KWKA 1X4JA 2KWJA 2ECNA 1WILA 2EGPA 2D8SA 2KFTA 2PNXA 2YT5A 2FUUA 3U5MA 1WE9A 2CT2A 2MA6A 1VFYA 4BBQA 1LDJB 2F6NA 1T1HA 4WZ3B 2AN6A 4YABA 3U5PA 2KREA 1HYIA 2MIQA 5B8DA 3QZVA 5AIUA 5TBNA 2KYUA 1X4UA 1CHCA 2VPDA 2KGIA 3ZVYA 2NAAA 1WENA 2YYRA 1RMDA 2RI7A 4XI1A 2M85A 5B79A 2CSZA 3EB6A 3O34A 2YREA 2VJEA 5FEYA 3RPGB 4ZQLA 5D1MB 5TDRA 4A4CA 5TRBA 4S3OC 4IC2A 4A49A 3L1ZB 2IDAA 2ECGA 3KV5A 4UP0A 5B78A 5G0FA 2LQ6A 1WESA 3O36A 4C9ZA 3LQHA 4R2YA 4YBTA 2L43A 1JM7B 2H0DA 4QF3A 1JM7A 3HTKC 5I3LA 2VPGA 2QIZA 2QJ0A 1WEOA 3ZYQA 3M99A 2YHNA 5EYAF 5DINA 1BORA 3DPLR 3V43A 3SOUA 3GV4A 4A4BA 5G05B 2M3HA
chains in the Genus database with same CATH superfamily
1WFKA 2ECTA 2XP0A 4N3WA 2E6RA 1MBMA 2FUIA 4ZDTA 3T6RA 2XOCA 5B77A 5SVIB 4I7DA 5SVIA 5C11A 3EB5A 2KE1A 1F62A 2LXPC 2YVRA 3N9OA 1FP0A 2Y1MA 4LK9A 3N9LA 4R8PK 5H1VA 4R7EA 2KR4A 3O35A 1K2FA 2YQMA 2JM3A 1X4IA 5LKXA 3SOXA 2K4DA 3FM8C 2ECWA 4B7YC 2EXUA 2ECVA 2DX8A 3KV6A 2LRIC 1JOCA 2HYED 2KIZA 1E4UA 5TDWA 2K1JA 3ASLA 2YW8A 1MM3A 5B76A 3LQJA 4FO9A 4Z0RA 1WEVA 1WEUA 3L11A 5D1LB 1WGMA 1MM2A 3SUBA 2L75A 2LGLA 3PURA 2BAYA 2G45A 2MT5A 3Q1DA 5C13A 3MHHA 2VP7A 2L0BA 4YC9A 2EA6A 4TKPB 5TABA 3HCSA 2MA5A 4ZUXU 4MVTA 5K3QA 3C5KA 5FB1A 3ZPVE 1WEPA 1V87A 4FK5A 3FL2A 3I2DA 2VPEA 5H1TA 3N9QA 4CCGX 4A0CD 3KNVA 3M63A 2MD8C 1FBVA 3M7KA 2MUMA 3O33A 4OGCA 3MDBC 2YSMA 3RPGC 5SVYA 2JMDA 2RSDA 4UP5A 2FSAA 4UI9B 3N9MA 5LCWB 4V3LC 4V3KC 3KQIA 3IHPA 3LQIA 4AYCB 2LAUA 4F1PA 4AYCA 3KDEC 1VYXA 4YBMA 3H7HA 3LDYA 3L1XA 5H1UA 2F6JA 2XEUA 3ZNIA 2MNZA 2UZGA 2YQLA 3NG2A 1VD4A 1WEQA 4X3GA 5D1KB 2MNYA 2FD4A 2Y43A 4PTBA 3SOWA 2I50A 2VJFB 2DJAA 2ZETC 3PUQA 2CONA 2YHOA 5H9MA 2OXQC 2KGGA 5FERA 5LKZA 3O47A 5JG6A 3U5OA 3MHSA 4GNGA 4BHWA 4L7XA 4W4UA 5LKUA 4LLBA 4FIPA 2L80A 1WEEA 2YUCA 5G04B 2B0OE 3GL6A 3JUEA 2CRWA 2XB1A 4L58A 2MD7B 1HYJA 1IYMA 3T7LA 4YAXA 3N9NA 4N4FA 2E6SA 3ZTGA 3HCUA 3LVRE 4WZ2A 2YSJA 3U5NA 1Z60A 2K17A 4AVXA 2L5UA 3O7AA 4MSXA 2QICA 2M6MA 4YBSA 4AP4A 4YATA 5FB0A 3DDTA 5AITA 2M1RA 2G6QA 4P5OB 2LN0A 4NN2A 2G43A 3ZVZB 1Z6UA 4WZ0A 2CSYA 4B86C 2XOYA 1N87A 3LJUX 1LDKC 1U6GB 2PUYA 3VK6A 4FJCA 4CA1A 2KWNA 2K16A 4H9DA 2JMJA 2LGGA 3FAOA 3DQVR 4S3OB 2KU3A 5B75A 1WIMA 3FANA 3ZPV1 2KWOA 4I7BA 2ECJA 4Q6FA 1DVPA 2Y1NA 4QF2A 4F52B 2JMIA 2HDPA 2VJEB 4LKAA 2CKLB 4QQ4A 3O70A 2LDRA 2CKLA 2L7PA 2LGKA 2LXHC 5KH9A 2VPBA 4PPEA 4AUQB 2YURA 2F42A 5DKAA 1WEMA 1ZBDB 5KH7A 2CSVA 4GNEA 4IC3A 3M62A 1DCQA 4I7CA 2H0DB 1G25A 2ECIA 3C6WA 1WEWA 3N9PA 4GB0A 4LJNA 4WA6A 3LVQE 3RTRB 2YU4A 5LKTA 4O64A 3SHBA 2EODA 4GNDA 4GNFA 2XOZA 2VNFA 2LGVA 5KH3A 2LV9A 2C2VS 2VJFA 3LRQA 1XWHA 2KKXA 3PHDA 4LADB 3O37A 5J3XA 3HCTA 4YADA 2C2LA 2JRJA 4O62A 1Z2QA 2CRRA 2P57A 2KWKA 3T9KA 1X4JA 2KWJA 2ECNA 2E61A 1WILA 3FJUB 2EGMA 2EGPA 2D8SA 2KFTA 2PNXA 2MKEA 2YT5A 2FUUA 3U5MA 1WE9A 2CT2A 2MA6A 1VFYA 4BBQA 1LDJB 2F6NA 1T1HA 2RR4A 4WZ3B 2AN6A 4YABA 3U5PA 2KREA 1HYIA 2MIQA 5B8DA 3QZVA 5AIUA 5TBNA 2KYUA 1X4UA 1CHCA 2D8UA 2VPDA 2DSMA 2KGIA 3ZVYA 2NAAA 2M13A 1WENA 2YYRA 5SVXA 3E2DA 1RMDA 2RI7A 2FFWA 2M85A 4XI1A 5B79A 2CSZA 3EB6A 3O34A 2YREA 2JUNA 2VJEA 5FEYA 3RPGB 4ZQLA 5D1MB 5TDRA 4A4CA 5TRBA 4S3OC 4IC2A 4A49A 3L1ZB 2IDAA 2ECGA 3KV5A 4UP0A 4Z0OA 5B78A 5G0FA 2LQ6A 1WESA 3FEHA 3O36A 4C9ZA 3LQHA 4R2YA 4YBTA 2L43A 1JM7B 2H0DA 4QF3A 1JM7A 3HTKC 5I3LA 2VPGA 2QIZA 3DWDA 2QJ0A 1WEOA 3ZYQA 4OGEA 3M99A 2YHNA 5EYAF 2KKYA 5DINA 3PLWA 1BORA 2IQJA 3DPLR 3V43A 3SOUA 3GV4A 2OWAA 4A4BA 5G05B 2M3HA
chains in the Genus database with same CATH topology
1WFKA 2ECTA 4N3WA 2E6RA 2FUIA 4ZDTA 3T6RA 5B77A 4I7DA 5C11A 3EB5A 2KE1A 1F62A 2LXPC 3N9OA 1FP0A 2Y1MA 4LK9A 3N9LA 4R8PK 5H1VA 4R7EA 2KR4A 3O35A 1K2FA 2YQMA 1X4IA 5LKXA 3SOXA 2K4DA 2ECWA 4B7YC 2ECVA 2DX8A 3KV6A 2LRIC 1JOCA 2HYED 2KIZA 1E4UA 5TDWA 2K1JA 3ASLA 2YW8A 1MM3A 5B76A 3LQJA 4FO9A 1WEVA 1WEUA 3L11A 5D1LB 1WGMA 1MM2A 2L75A 2LGLA 3PURA 2BAYA 2G45A 2MT5A 5C13A 3MHHA 2VP7A 2L0BA 4YC9A 2EA6A 4TKPB 5TABA 3HCSA 2MA5A 4ZUXU 4MVTA 3C5KA 5FB1A 3ZPVE 1WEPA 1V87A 4FK5A 3FL2A 3I2DA 2VPEA 5H1TA 3N9QA 4CCGX 4A0CD 3KNVA 3M63A 2MD8C 1FBVA 2MUMA 3O33A 2YSMA 3RPGC 2JMDA 2RSDA 4UP5A 2FSAA 4UI9B 3N9MA 5LCWB 4V3LC 4V3KC 3KQIA 3IHPA 3LQIA 4AYCB 4AYCA 1VYXA 4YBMA 3L1XA 5H1UA 2F6JA 2XEUA 3ZNIA 2MNZA 2UZGA 2YQLA 3NG2A 1VD4A 1WEQA 4X3GA 5D1KB 2MNYA 2Y43A 4PTBA 3SOWA 2I50A 2VJFB 2ZETC 3PUQA 2YHOA 5H9MA 2OXQC 2KGGA 5FERA 5LKZA 5JG6A 3U5OA 3MHSA 4GNGA 4BHWA 4L7XA 4W4UA 5LKUA 4LLBA 4FIPA 2L80A 1WEEA 2YUCA 5G04B 3GL6A 2XB1A 4L58A 2MD7B 1HYJA 1IYMA 3T7LA 4YAXA 3N9NA 4N4FA 2E6SA 3ZTGA 3HCUA 4WZ2A 2YSJA 3U5NA 1Z60A 2K17A 4AVXA 2L5UA 3O7AA 4MSXA 2QICA 2M6MA 4YBSA 4AP4A 4YATA 5FB0A 5AITA 2M1RA 2G6QA 4P5OB 2LN0A 4NN2A 2G43A 3ZVZB 1Z6UA 4WZ0A 2CSYA 4B86C 1N87A 1LDKC 1U6GB 2PUYA 3VK6A 4FJCA 4CA1A 2KWNA 2K16A 2JMJA 2LGGA 3DQVR 4S3OB 2KU3A 5B75A 1WIMA 3ZPV1 2KWOA 4I7BA 2ECJA 4Q6FA 1DVPA 2Y1NA 4QF2A 4F52B 2JMIA 2HDPA 2VJEB 4LKAA 2CKLB 3O70A 2LDRA 2CKLA 2LGKA 2LXHC 5KH9A 2VPBA 4PPEA 4AUQB 2YURA 2F42A 5DKAA 1WEMA 1ZBDB 5KH7A 4GNEA 3M62A 4IC3A 4I7CA 2H0DB 1G25A 2ECIA 3C6WA 1WEWA 3N9PA 4GB0A 4LJNA 4WA6A 3RTRB 2YU4A 5LKTA 4O64A 3SHBA 2EODA 4GNDA 4GNFA 2VNFA 2LGVA 5KH3A 2LV9A 2C2VS 2VJFA 3LRQA 1XWHA 3PHDA 4LADB 3O37A 5J3XA 3HCTA 4YADA 2C2LA 2JRJA 1Z2QA 2KWKA 1X4JA 2KWJA 2ECNA 1WILA 2EGPA 2D8SA 2KFTA 2PNXA 2YT5A 2FUUA 3U5MA 1WE9A 2CT2A 2MA6A 1VFYA 4BBQA 1LDJB 2F6NA 1T1HA 4WZ3B 2AN6A 4YABA 3U5PA 2KREA 1HYIA 2MIQA 5B8DA 3QZVA 5AIUA 5TBNA 2KYUA 1X4UA 1CHCA 2VPDA 2KGIA 3ZVYA 2NAAA 1WENA 2YYRA 1RMDA 2RI7A 4XI1A 2M85A 5B79A 2CSZA 3EB6A 3O34A 2YREA 2VJEA 5FEYA 3RPGB 4ZQLA 5D1MB 5TDRA 4A4CA 5TRBA 4S3OC 4IC2A 4A49A 3L1ZB 2IDAA 2ECGA 3KV5A 4UP0A 5B78A 5G0FA 2LQ6A 1WESA 3O36A 4C9ZA 3LQHA 4R2YA 4YBTA 2L43A 1JM7B 2H0DA 4QF3A 1JM7A 3HTKC 5I3LA 2VPGA 2QIZA 2QJ0A 1WEOA 3ZYQA 3M99A 2YHNA 5EYAF 5DINA 1BORA 3DPLR 3V43A 3SOUA 3GV4A 4A4BA 5G05B 2M3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFK A;  2ECT A;  4N3W A;  2E6R A;  2FUI A;  4ZDT A;  3T6R A;  5B77 A;  4I7D A;  5C11 A;  3EB5 A;  2KE1 A;  1F62 A;  2LXP C;  3N9O A;  1FP0 A;  2Y1M A;  4LK9 A;  3N9L A;  4R8P K;  5H1V A;  4R7E A;  2KR4 A;  3O35 A;  1K2F A;  2YQM A;  1X4I A;  5LKX A;  3SOX A;  2K4D A;  2ECW A;  4B7Y C;  2ECV A;  2DX8 A;  3KV6 A;  2LRI C;  1JOC A;  2HYE D;  2KIZ A;  1E4U A;  5TDW A;  2K1J A;  3ASL A;  2YW8 A;  1MM3 A;  5B76 A;  3LQJ A;  4FO9 A;  1WEV A;  1WEU A;  3L11 A;  5D1L B;  1WGM A;  1MM2 A;  2L75 A;  2LGL A;  3PUR A;  2BAY A;  2G45 A;  2MT5 A;  5C13 A;  3MHH A;  2VP7 A;  2L0B A;  4YC9 A;  2EA6 A;  4TKP B;  5TAB A;  3HCS A;  2MA5 A;  4ZUX U;  4MVT A;  3C5K A;  5FB1 A;  3ZPV E;  1WEP A;  1V87 A;  4FK5 A;  3FL2 A;  3I2D A;  2VPE A;  5H1T A;  3N9Q A;  4CCG X;  4A0C D;  3KNV A;  3M63 A;  2MD8 C;  1FBV A;  2MUM A;  3O33 A;  2YSM A;  3RPG C;  2JMD A;  2RSD A;  4UP5 A;  2FSA A;  4UI9 B;  3N9M A;  5LCW B;  4V3L C;  4V3K C;  3KQI A;  3IHP A;  3LQI A;  4AYC B;  4AYC A;  1VYX A;  4YBM A;  3L1X A;  5H1U A;  2F6J A;  2XEU A;  3ZNI A;  2MNZ A;  2UZG A;  2YQL A;  3NG2 A;  1VD4 A;  1WEQ A;  4X3G A;  5D1K B;  2MNY A;  2Y43 A;  4PTB A;  3SOW A;  2I50 A;  2VJF B;  2ZET C;  3PUQ A;  2YHO A;  5H9M A;  2OXQ C;  2KGG A;  5FER A;  5LKZ A;  5JG6 A;  3U5O A;  3MHS A;  4GNG A;  4BHW A;  4L7X A;  4W4U A;  5LKU A;  4LLB A;  4FIP A;  2L80 A;  1WEE A;  2YUC A;  5G04 B;  3GL6 A;  2XB1 A;  4L58 A;  2MD7 B;  1HYJ A;  1IYM A;  3T7L A;  4YAX A;  3N9N A;  4N4F A;  2E6S A;  3ZTG A;  3HCU A;  4WZ2 A;  2YSJ A;  3U5N A;  1Z60 A;  2K17 A;  4AVX A;  2L5U A;  3O7A A;  4MSX A;  2QIC A;  2M6M A;  4YBS A;  4AP4 A;  4YAT A;  5FB0 A;  5AIT A;  2M1R A;  2G6Q A;  4P5O B;  2LN0 A;  4NN2 A;  2G43 A;  3ZVZ B;  1Z6U A;  4WZ0 A;  2CSY A;  4B86 C;  1N87 A;  1LDK C;  1U6G B;  2PUY A;  3VK6 A;  4FJC A;  4CA1 A;  2KWN A;  2K16 A;  2JMJ A;  2LGG A;  3DQV R;  4S3O B;  2KU3 A;  5B75 A;  1WIM A;  3ZPV 1;  2KWO A;  4I7B A;  2ECJ A;  4Q6F A;  1DVP A;  2Y1N A;  4QF2 A;  4F52 B;  2JMI A;  2HDP A;  2VJE B;  4LKA A;  2CKL B;  3O70 A;  2LDR A;  2CKL A;  2LGK A;  2LXH C;  5KH9 A;  2VPB A;  4PPE A;  4AUQ B;  2YUR A;  2F42 A;  5DKA A;  1WEM A;  1ZBD B;  5KH7 A;  4GNE A;  3M62 A;  4IC3 A;  4I7C A;  2H0D B;  1G25 A;  2ECI A;  3C6W A;  1WEW A;  3N9P A;  4GB0 A;  4LJN A;  4WA6 A;  3RTR B;  2YU4 A;  5LKT A;  4O64 A;  3SHB A;  2EOD A;  4GND A;  4GNF A;  2VNF A;  2LGV A;  5KH3 A;  2LV9 A;  2C2V S;  2VJF A;  3LRQ A;  1XWH A;  3PHD A;  4LAD B;  3O37 A;  5J3X A;  3HCT A;  4YAD A;  2C2L A;  2JRJ A;  1Z2Q A;  2KWK A;  1X4J A;  2KWJ A;  2ECN A;  1WIL A;  2EGP A;  2D8S A;  2KFT A;  2PNX A;  2YT5 A;  2FUU A;  3U5M A;  1WE9 A;  2CT2 A;  2MA6 A;  1VFY A;  4BBQ A;  1LDJ B;  2F6N A;  1T1H A;  4WZ3 B;  2AN6 A;  4YAB A;  3U5P A;  2KRE A;  1HYI A;  2MIQ A;  5B8D A;  3QZV A;  5AIU A;  5TBN A;  2KYU A;  1X4U A;  1CHC A;  2VPD A;  2KGI A;  3ZVY A;  2NAA A;  1WEN A;  2YYR A;  1RMD A;  2RI7 A;  4XI1 A;  2M85 A;  5B79 A;  2CSZ A;  3EB6 A;  3O34 A;  2YRE A;  2VJE A;  5FEY A;  3RPG B;  4ZQL A;  5D1M B;  5TDR A;  4A4C A;  5TRB A;  4S3O C;  4IC2 A;  4A49 A;  3L1Z B;  2IDA A;  2ECG A;  3KV5 A;  4UP0 A;  5B78 A;  5G0F A;  2LQ6 A;  1WES A;  3O36 A;  4C9Z A;  3LQH A;  4R2Y A;  4YBT A;  2L43 A;  1JM7 B;  2H0D A;  4QF3 A;  1JM7 A;  3HTK C;  5I3L A;  2VPG A;  2QIZ A;  2QJ0 A;  1WEO A;  3ZYQ A;  3M99 A;  2YHN A;  5EYA F;  5DIN A;  1BOR A;  3DPL R;  3V43 A;  3SOU A;  3GV4 A;  4A4B A;  5G05 B;  2M3H A; 
#chains in the Genus database with same CATH topology
 1WFK A;  2ECT A;  2XP0 A;  4N3W A;  2E6R A;  1MBM A;  2FUI A;  4ZDT A;  3T6R A;  2XOC A;  5B77 A;  5SVI B;  4I7D A;  5SVI A;  5C11 A;  3EB5 A;  2KE1 A;  1F62 A;  2LXP C;  2YVR A;  3N9O A;  1FP0 A;  2Y1M A;  4LK9 A;  3N9L A;  4R8P K;  5H1V A;  4R7E A;  2KR4 A;  3O35 A;  1K2F A;  2YQM A;  2JM3 A;  1X4I A;  5LKX A;  3SOX A;  2K4D A;  3FM8 C;  2ECW A;  4B7Y C;  2EXU A;  2ECV A;  2DX8 A;  3KV6 A;  2LRI C;  1JOC A;  2HYE D;  2KIZ A;  1E4U A;  5TDW A;  2K1J A;  3ASL A;  2YW8 A;  1MM3 A;  5B76 A;  3LQJ A;  4FO9 A;  4Z0R A;  1WEV A;  1WEU A;  3L11 A;  5D1L B;  1WGM A;  1MM2 A;  3SUB A;  2L75 A;  2LGL A;  3PUR A;  2BAY A;  2G45 A;  2MT5 A;  3Q1D A;  5C13 A;  3MHH A;  2VP7 A;  2L0B A;  4YC9 A;  2EA6 A;  4TKP B;  5TAB A;  3HCS A;  2MA5 A;  4ZUX U;  4MVT A;  5K3Q A;  3C5K A;  5FB1 A;  3ZPV E;  1WEP A;  1V87 A;  4FK5 A;  3FL2 A;  3I2D A;  2VPE A;  5H1T A;  3N9Q A;  4CCG X;  4A0C D;  3KNV A;  3M63 A;  2MD8 C;  1FBV A;  3M7K A;  2MUM A;  3O33 A;  4OGC A;  3MDB C;  2YSM A;  3RPG C;  5SVY A;  2JMD A;  2RSD A;  4UP5 A;  2FSA A;  4UI9 B;  3N9M A;  5LCW B;  4V3L C;  4V3K C;  3KQI A;  3IHP A;  3LQI A;  4AYC B;  2LAU A;  4F1P A;  4AYC A;  3KDE C;  1VYX A;  4YBM A;  3H7H A;  3LDY A;  3L1X A;  5H1U A;  2F6J A;  2XEU A;  3ZNI A;  2MNZ A;  2UZG A;  2YQL A;  3NG2 A;  1VD4 A;  1WEQ A;  4X3G A;  5D1K B;  2MNY A;  2FD4 A;  2Y43 A;  4PTB A;  3SOW A;  2I50 A;  2VJF B;  2DJA A;  2ZET C;  3PUQ A;  2CON A;  2YHO A;  5H9M A;  2OXQ C;  2KGG A;  5FER A;  5LKZ A;  3O47 A;  5JG6 A;  3U5O A;  3MHS A;  4GNG A;  4BHW A;  4L7X A;  4W4U A;  5LKU A;  4LLB A;  4FIP A;  2L80 A;  1WEE A;  2YUC A;  5G04 B;  2B0O E;  3GL6 A;  3JUE A;  2CRW A;  2XB1 A;  4L58 A;  2MD7 B;  1HYJ A;  1IYM A;  3T7L A;  4YAX A;  3N9N A;  4N4F A;  2E6S A;  3ZTG A;  3HCU A;  3LVR E;  4WZ2 A;  2YSJ A;  3U5N A;  1Z60 A;  2K17 A;  4AVX A;  2L5U A;  3O7A A;  4MSX A;  2QIC A;  2M6M A;  4YBS A;  4AP4 A;  4YAT A;  5FB0 A;  3DDT A;  5AIT A;  2M1R A;  2G6Q A;  4P5O B;  2LN0 A;  4NN2 A;  2G43 A;  3ZVZ B;  1Z6U A;  4WZ0 A;  2CSY A;  4B86 C;  2XOY A;  1N87 A;  3LJU X;  1LDK C;  1U6G B;  2PUY A;  3VK6 A;  4FJC A;  4CA1 A;  2KWN A;  2K16 A;  4H9D A;  2JMJ A;  2LGG A;  3FAO A;  3DQV R;  4S3O B;  2KU3 A;  5B75 A;  1WIM A;  3FAN A;  3ZPV 1;  2KWO A;  4I7B A;  2ECJ A;  4Q6F A;  1DVP A;  2Y1N A;  4QF2 A;  4F52 B;  2JMI A;  2HDP A;  2VJE B;  4LKA A;  2CKL B;  4QQ4 A;  3O70 A;  2LDR A;  2CKL A;  2L7P A;  2LGK A;  2LXH C;  5KH9 A;  2VPB A;  4PPE A;  4AUQ B;  2YUR A;  2F42 A;  5DKA A;  1WEM A;  1ZBD B;  5KH7 A;  2CSV A;  4GNE A;  4IC3 A;  3M62 A;  1DCQ A;  4I7C A;  2H0D B;  1G25 A;  2ECI A;  3C6W A;  1WEW A;  3N9P A;  4GB0 A;  4LJN A;  4WA6 A;  3LVQ E;  3RTR B;  2YU4 A;  5LKT A;  4O64 A;  3SHB A;  2EOD A;  4GND A;  4GNF A;  2XOZ A;  2VNF A;  2LGV A;  5KH3 A;  2LV9 A;  2C2V S;  2VJF A;  3LRQ A;  1XWH A;  2KKX A;  3PHD A;  4LAD B;  3O37 A;  5J3X A;  3HCT A;  4YAD A;  2C2L A;  2JRJ A;  4O62 A;  1Z2Q A;  2CRR A;  2P57 A;  2KWK A;  3T9K A;  1X4J A;  2KWJ A;  2ECN A;  2E61 A;  1WIL A;  3FJU B;  2EGM A;  2EGP A;  2D8S A;  2KFT A;  2PNX A;  2MKE A;  2YT5 A;  2FUU A;  3U5M A;  1WE9 A;  2CT2 A;  2MA6 A;  1VFY A;  4BBQ A;  1LDJ B;  2F6N A;  1T1H A;  2RR4 A;  4WZ3 B;  2AN6 A;  4YAB A;  3U5P A;  2KRE A;  1HYI A;  2MIQ A;  5B8D A;  3QZV A;  5AIU A;  5TBN A;  2KYU A;  1X4U A;  1CHC A;  2D8U A;  2VPD A;  2DSM A;  2KGI A;  3ZVY A;  2NAA A;  2M13 A;  1WEN A;  2YYR A;  5SVX A;  3E2D A;  1RMD A;  2RI7 A;  2FFW A;  2M85 A;  4XI1 A;  5B79 A;  2CSZ A;  3EB6 A;  3O34 A;  2YRE A;  2JUN A;  2VJE A;  5FEY A;  3RPG B;  4ZQL A;  5D1M B;  5TDR A;  4A4C A;  5TRB A;  4S3O C;  4IC2 A;  4A49 A;  3L1Z B;  2IDA A;  2ECG A;  3KV5 A;  4UP0 A;  4Z0O A;  5B78 A;  5G0F A;  2LQ6 A;  1WES A;  3FEH A;  3O36 A;  4C9Z A;  3LQH A;  4R2Y A;  4YBT A;  2L43 A;  1JM7 B;  2H0D A;  4QF3 A;  1JM7 A;  3HTK C;  5I3L A;  2VPG A;  2QIZ A;  3DWD A;  2QJ0 A;  1WEO A;  3ZYQ A;  4OGE A;  3M99 A;  2YHN A;  5EYA F;  2KKY A;  5DIN A;  3PLW A;  1BOR A;  2IQJ A;  3DPL R;  3V43 A;  3SOU A;  3GV4 A;  2OWA A;  4A4B A;  5G05 B;  2M3H A; 
#chains in the Genus database with same CATH homology
 1WFK A;  2ECT A;  4N3W A;  2E6R A;  2FUI A;  4ZDT A;  3T6R A;  5B77 A;  4I7D A;  5C11 A;  3EB5 A;  2KE1 A;  1F62 A;  2LXP C;  3N9O A;  1FP0 A;  2Y1M A;  4LK9 A;  3N9L A;  4R8P K;  5H1V A;  4R7E A;  2KR4 A;  3O35 A;  1K2F A;  2YQM A;  1X4I A;  5LKX A;  3SOX A;  2K4D A;  2ECW A;  4B7Y C;  2ECV A;  2DX8 A;  3KV6 A;  2LRI C;  1JOC A;  2HYE D;  2KIZ A;  1E4U A;  5TDW A;  2K1J A;  3ASL A;  2YW8 A;  1MM3 A;  5B76 A;  3LQJ A;  4FO9 A;  1WEV A;  1WEU A;  3L11 A;  5D1L B;  1WGM A;  1MM2 A;  2L75 A;  2LGL A;  3PUR A;  2BAY A;  2G45 A;  2MT5 A;  5C13 A;  3MHH A;  2VP7 A;  2L0B A;  4YC9 A;  2EA6 A;  4TKP B;  5TAB A;  3HCS A;  2MA5 A;  4ZUX U;  4MVT A;  3C5K A;  5FB1 A;  3ZPV E;  1WEP A;  1V87 A;  4FK5 A;  3FL2 A;  3I2D A;  2VPE A;  5H1T A;  3N9Q A;  4CCG X;  4A0C D;  3KNV A;  3M63 A;  2MD8 C;  1FBV A;  2MUM A;  3O33 A;  2YSM A;  3RPG C;  2JMD A;  2RSD A;  4UP5 A;  2FSA A;  4UI9 B;  3N9M A;  5LCW B;  4V3L C;  4V3K C;  3KQI A;  3IHP A;  3LQI A;  4AYC B;  4AYC A;  1VYX A;  4YBM A;  3L1X A;  5H1U A;  2F6J A;  2XEU A;  3ZNI A;  2MNZ A;  2UZG A;  2YQL A;  3NG2 A;  1VD4 A;  1WEQ A;  4X3G A;  5D1K B;  2MNY A;  2Y43 A;  4PTB A;  3SOW A;  2I50 A;  2VJF B;  2ZET C;  3PUQ A;  2YHO A;  5H9M A;  2OXQ C;  2KGG A;  5FER A;  5LKZ A;  5JG6 A;  3U5O A;  3MHS A;  4GNG A;  4BHW A;  4L7X A;  4W4U A;  5LKU A;  4LLB A;  4FIP A;  2L80 A;  1WEE A;  2YUC A;  5G04 B;  3GL6 A;  2XB1 A;  4L58 A;  2MD7 B;  1HYJ A;  1IYM A;  3T7L A;  4YAX A;  3N9N A;  4N4F A;  2E6S A;  3ZTG A;  3HCU A;  4WZ2 A;  2YSJ A;  3U5N A;  1Z60 A;  2K17 A;  4AVX A;  2L5U A;  3O7A A;  4MSX A;  2QIC A;  2M6M A;  4YBS A;  4AP4 A;  4YAT A;  5FB0 A;  5AIT A;  2M1R A;  2G6Q A;  4P5O B;  2LN0 A;  4NN2 A;  2G43 A;  3ZVZ B;  1Z6U A;  4WZ0 A;  2CSY A;  4B86 C;  1N87 A;  1LDK C;  1U6G B;  2PUY A;  3VK6 A;  4FJC A;  4CA1 A;  2KWN A;  2K16 A;  2JMJ A;  2LGG A;  3DQV R;  4S3O B;  2KU3 A;  5B75 A;  1WIM A;  3ZPV 1;  2KWO A;  4I7B A;  2ECJ A;  4Q6F A;  1DVP A;  2Y1N A;  4QF2 A;  4F52 B;  2JMI A;  2HDP A;  2VJE B;  4LKA A;  2CKL B;  3O70 A;  2LDR A;  2CKL A;  2LGK A;  2LXH C;  5KH9 A;  2VPB A;  4PPE A;  4AUQ B;  2YUR A;  2F42 A;  5DKA A;  1WEM A;  1ZBD B;  5KH7 A;  4GNE A;  3M62 A;  4IC3 A;  4I7C A;  2H0D B;  1G25 A;  2ECI A;  3C6W A;  1WEW A;  3N9P A;  4GB0 A;  4LJN A;  4WA6 A;  3RTR B;  2YU4 A;  5LKT A;  4O64 A;  3SHB A;  2EOD A;  4GND A;  4GNF A;  2VNF A;  2LGV A;  5KH3 A;  2LV9 A;  2C2V S;  2VJF A;  3LRQ A;  1XWH A;  3PHD A;  4LAD B;  3O37 A;  5J3X A;  3HCT A;  4YAD A;  2C2L A;  2JRJ A;  1Z2Q A;  2KWK A;  1X4J A;  2KWJ A;  2ECN A;  1WIL A;  2EGP A;  2D8S A;  2KFT A;  2PNX A;  2YT5 A;  2FUU A;  3U5M A;  1WE9 A;  2CT2 A;  2MA6 A;  1VFY A;  4BBQ A;  1LDJ B;  2F6N A;  1T1H A;  4WZ3 B;  2AN6 A;  4YAB A;  3U5P A;  2KRE A;  1HYI A;  2MIQ A;  5B8D A;  3QZV A;  5AIU A;  5TBN A;  2KYU A;  1X4U A;  1CHC A;  2VPD A;  2KGI A;  3ZVY A;  2NAA A;  1WEN A;  2YYR A;  1RMD A;  2RI7 A;  4XI1 A;  2M85 A;  5B79 A;  2CSZ A;  3EB6 A;  3O34 A;  2YRE A;  2VJE A;  5FEY A;  3RPG B;  4ZQL A;  5D1M B;  5TDR A;  4A4C A;  5TRB A;  4S3O C;  4IC2 A;  4A49 A;  3L1Z B;  2IDA A;  2ECG A;  3KV5 A;  4UP0 A;  5B78 A;  5G0F A;  2LQ6 A;  1WES A;  3O36 A;  4C9Z A;  3LQH A;  4R2Y A;  4YBT A;  2L43 A;  1JM7 B;  2H0D A;  4QF3 A;  1JM7 A;  3HTK C;  5I3L A;  2VPG A;  2QIZ A;  2QJ0 A;  1WEO A;  3ZYQ A;  3M99 A;  2YHN A;  5EYA F;  5DIN A;  1BOR A;  3DPL R;  3V43 A;  3SOU A;  3GV4 A;  4A4B A;  5G05 B;  2M3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...