3DQVR

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords NEDD8
total genus 7
structure length 86
sequence length 86
chains with identical sequence Y
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3dqvR00
3C5KA 1JOCA 2K16A 1F62A 4AUQB 4UP0A 2EA6A 2YQLA 3GL6A 4WZ3B 2MA5A 2VNFA 3SOWA 2FUIA 1X4JA 5LKXA 4WZ2A 2LXPC 2M1RA 4A4BA 3L1XA 3M62A 2BAYA 1WGMA 3RPGC 5TRBA 5TDWA 4MSXA 2YSMA 2MNYA 5H1TA 3N9PA 2VPBA 1WEPA 2KGIA 3KV5A 3M99A 2ECNA 1HYJA 2KIZA 1MM2A 2K1JA 2MIQA 5KH9A 2HYED 2RSDA 5LKZA 4YAXA 3U5PA 1HYIA 1JM7B 2LGVA 2VPEA 4LLBA 3QZVA 3GV4A 4IC3A 4AP4A 3N9NA 4GNFA 2G6QA 2Y43A 4B86C 4TKPB 3SOXA 3O35A 5EYAF 4XI1A 2CKLB 3HCSA 2FUUA 2LGGA 2ECIA 4YBSA 5B78A 2JMJA 2MD7B 4YATA 3RPGB 1WEUA 5DKAA 1WEVA 5AIUA 4YADA 5FEYA 3C6WA 3MHHA 4LJNA 2YU4A 5B8DA 2XB1A 4GNEA 4AYCA 3FL2A 2YW8A 3N9OA 3DQVR 3ZPVE 4ZDTA 1WIMA 1U6GB 2I50A 4GB0A 5FERA 1K2FA 3U5MA 2M6MA 1CHCA 4LADB 4LKAA 3O33A 2Y1NA 4I7DA 3SHBA 2KGGA 2YURA 3LQJA 2VJFB 1LDJB 2YSJA 3LQIA 2YHOA 4BBQA 4UI9B 3LRQA 1WE9A 2ECJA 1WENA 2KU3A 2YUCA 5KH3A 1VYXA 4LK9A 4R7EA 5B77A 1MM3A 4V3LC 3PUQA 2L0BA 4MVTA 2CSZA 3KV6A 4I7BA 4I7CA 1VFYA 1WEOA 3HTKC 3SOUA 3ZVYA 2FSAA 2ECGA 4QF3A 3KQIA 1ZBDB 3ASLA 4WZ0A 4ZQLA 2KWKA 2MD8C 5C11A 2LGLA 3L11A 2L5UA 2CKLA 2VJEB 1T1HA 2E6SA 2H0DA 4NN2A 1VD4A 2QJ0A 5H1UA 3O70A 4UP5A 2UZGA 1XWHA 2QICA 4PTBA 2JMDA 2M85A 4O64A 3PURA 2KREA 1WEMA 3RTRB 3V43A 5TABA 3DPLR 2VP7A 5D1LB 2ZETC 3O36A 1WEEA 1Z60A 3VK6A 2E6RA 4WA6A 5B79A 4A0CD 4C9ZA 2VPGA 4R8PK 5FB0A 3U5OA 2NAAA 2L80A 1WILA 2F6NA 2OXQC 2ECVA 4BHWA 2L43A 4QF2A 2RI7A 2HDPA 4FK5A 2KR4A 2JMIA 1V87A 3I2DA 2VPDA 5JG6A 4B7YC 2C2VS 2Y1MA 2KYUA 2EODA 2JRJA 3N9LA 1FBVA 3LQHA 2MUMA 4FO9A 4IC2A 2KE1A 3O7AA 2DX8A 3HCTA 4FJCA 5G0FA 2K17A 2MT5A 5H9MA 2LRIC 1Z6UA 3NG2A 1WEQA 4YC9A 4S3OC 3L1ZB 4YABA 2D8SA 4CCGX 5TDRA 2C2LA 3PHDA 4R2YA 2KWOA 3HCUA 1JM7A 2MA6A 3ZNIA 5D1KB 5J3XA 2PNXA 2L75A 3EB6A 4YBTA 4A4CA 1Z2QA 2LQ6A 1LDKC 4P5OB 5H1VA 5D1MB 5G05B 4AVXA 3M63A 2LN0A 4YBMA 2YT5A 2F42A 2LGKA 2EGPA 4V3KC 1N87A 5DINA 4N3WA 2F6JA 2ECWA 2CSYA 4GNGA 5I3LA 2KFTA 2LDRA 1E4UA 4FIPA 4GNDA 4X3GA 1BORA 2KWNA 1WFKA 3O34A 4Q6FA 2AN6A 1WEWA 2YREA 4AYCB 2G45A 2KWJA 3EB5A 1FP0A 5G04B 2QIZA 4S3OB 5KH7A 1WESA 5C13A 2PUYA 2ECTA 1G25A 2VJFA 2M3HA 5B75A 2LXHC 3O37A 5LKTA 5FB1A 2K4DA 5TBNA 2CT2A 2YQMA 2IDAA 2LV9A 5AITA 3ZTGA 1X4IA 4CA1A 4L58A 2XEUA 3KNVA 4A49A 3ZPV1 2YYRA 3ZVZB 5B76A 4PPEA 3MHSA 4W4UA 3T7LA 2YHNA 2G43A 3IHPA 4ZUXU 3N9MA 1X4UA 3ZYQA 1RMDA 1IYMA 1DVPA 2MNZA 2VJEA 4L7XA 5LKUA 3N9QA 2H0DB 4N4FA 3U5NA 4F52B 3T6RA 5LCWB
chains in the Genus database with same CATH superfamily
3C5KA 1JOCA 2K16A 1F62A 4AUQB 4UP0A 5SVYA 2EA6A 2YQLA 3GL6A 4WZ3B 2MA5A 2VNFA 3SOWA 2FUIA 1X4JA 5LKXA 4WZ2A 2LXPC 2M1RA 2M13A 4A4BA 3L1XA 3M62A 2BAYA 1WGMA 3RPGC 5TRBA 5TDWA 4MSXA 2YSMA 2MNYA 5H1TA 3N9PA 2VPBA 1WEPA 2KGIA 3KV5A 3M99A 2ECNA 1HYJA 2KIZA 1MM2A 2K1JA 2MIQA 5KH9A 2HYED 2CSVA 2RSDA 5LKZA 4YAXA 3U5PA 1HYIA 1JM7B 2LGVA 2VPEA 4LLBA 3QZVA 3GV4A 4IC3A 4AP4A 3N9NA 4GNFA 2G6QA 2Y43A 4B86C 4TKPB 3SOXA 3O35A 3MDBC 5EYAF 4XI1A 2CKLB 3HCSA 2FUUA 1DCQA 2LGGA 2ECIA 4YBSA 5B78A 2JMJA 2MD7B 4YATA 3PLWA 3RPGB 1WEUA 5DKAA 1WEVA 5AIUA 4YADA 5FEYA 3C6WA 3MHHA 4LJNA 2YU4A 5B8DA 2XB1A 4GNEA 4AYCA 3FL2A 2YW8A 3N9OA 3DQVR 3ZPVE 4ZDTA 1WIMA 3DWDA 1U6GB 2I50A 4GB0A 5FERA 1K2FA 3U5MA 2M6MA 1CHCA 4LADB 4LKAA 3O33A 2Y1NA 4I7DA 3SHBA 2KGGA 2YURA 3LQJA 2VJFB 1LDJB 2YSJA 3H7HA 2DJAA 3LQIA 2KKXA 2YHOA 4BBQA 4UI9B 3LRQA 1WE9A 2ECJA 1WENA 2KU3A 2YUCA 5KH3A 1VYXA 4H9DA 4LK9A 4R7EA 5B77A 2CRWA 1MM3A 4V3LC 3PUQA 2L0BA 5SVIA 2LAUA 2XP0A 4MVTA 2CSZA 3KV6A 4I7BA 4I7CA 1VFYA 1WEOA 3HTKC 2XOCA 3SOUA 3ZVYA 2FSAA 2ECGA 4QF3A 3KQIA 1ZBDB 3ASLA 4WZ0A 4ZQLA 2KWKA 2MD8C 5C11A 2LGLA 2IQJA 3L11A 2L5UA 2CKLA 2VJEB 1T1HA 2E6SA 2H0DA 4NN2A 2JUNA 1VD4A 2QJ0A 5H1UA 3O70A 4UP5A 2UZGA 3FEHA 1XWHA 2QICA 4PTBA 2JMDA 2M85A 4O64A 3PURA 4Z0OA 2KREA 1WEMA 3RTRB 3V43A 5TABA 3DPLR 2VP7A 5D1LB 2ZETC 3JUEA 3O36A 1WEEA 1Z60A 3VK6A 2E6RA 4WA6A 5B79A 4A0CD 4C9ZA 2VPGA 4R8PK 5FB0A 3U5OA 2NAAA 5K3QA 2L80A 1WILA 2F6NA 2OXQC 2ECVA 4BHWA 2L43A 4QF2A 2RI7A 2YVRA 2HDPA 4FK5A 2KR4A 2JMIA 1V87A 3I2DA 1MBMA 2VPDA 5JG6A 2C2VS 4B7YC 2E61A 2Y1MA 2KYUA 3FM8C 2EODA 2JM3A 2JRJA 3N9LA 1FBVA 3LQHA 2MUMA 2B0OE 4FO9A 2CONA 4IC2A 2KE1A 3O7AA 2DX8A 2CRRA 3HCTA 4FJCA 5G0FA 2K17A 2MT5A 5H9MA 2LRIC 1Z6UA 3O47A 3NG2A 2FD4A 1WEQA 4YC9A 4S3OC 3L1ZB 3SUBA 4YABA 2D8SA 4CCGX 5TDRA 2C2LA 3PHDA 4R2YA 2KWOA 3HCUA 3FAOA 1JM7A 2MA6A 3ZNIA 3Q1DA 5D1KB 5J3XA 2PNXA 2L75A 3EB6A 4YBTA 4A4CA 2L7PA 1Z2QA 2LQ6A 1LDKC 3LVQE 4P5OB 5H1VA 5D1MB 5G05B 4AVXA 3M63A 2LN0A 4YBMA 2YT5A 2F42A 3LJUX 2LGKA 2EXUA 2MKEA 2XOZA 2EGPA 4F1PA 4V3KC 1N87A 5DINA 4N3WA 2F6JA 2ECWA 2CSYA 4GNGA 5I3LA 2KFTA 2LDRA 1E4UA 4FIPA 2EGMA 4GNDA 4X3GA 1BORA 2KWNA 1WFKA 3O34A 4Q6FA 2D8UA 2AN6A 2RR4A 1WEWA 2YREA 3LVRE 4AYCB 3M7KA 2G45A 2KWJA 3EB5A 1FP0A 5G04B 4Z0RA 2QIZA 4S3OB 2FFWA 5KH7A 4QQ4A 1WESA 5C13A 2PUYA 4OGEA 2ECTA 1G25A 2VJFA 2M3HA 5B75A 2LXHC 3O37A 5LKTA 5FB1A 2K4DA 5TBNA 2CT2A 2YQMA 2DSMA 2IDAA 2LV9A 5AITA 3ZTGA 1X4IA 3T9KA 4O62A 4CA1A 4L58A 3KDEC 2XEUA 3KNVA 3LDYA 4A49A 3ZPV1 2YYRA 3ZVZB 5B76A 4PPEA 3DDTA 3MHSA 4W4UA 3T7LA 2YHNA 5SVXA 2G43A 3IHPA 4ZUXU 3N9MA 5SVIB 1X4UA 3ZYQA 1RMDA 2OWAA 4OGCA 1IYMA 2XOYA 1DVPA 2MNZA 2VJEA 4L7XA 5LKUA 2KKYA 3N9QA 3E2DA 3FANA 2P57A 2H0DB 3FJUB 4N4FA 3U5NA 4F52B 3T6RA 5LCWB
chains in the Genus database with same CATH topology
3C5KA 1JOCA 2K16A 1F62A 4AUQB 4UP0A 2EA6A 2YQLA 3GL6A 4WZ3B 2MA5A 2VNFA 3SOWA 2FUIA 1X4JA 5LKXA 4WZ2A 2LXPC 2M1RA 4A4BA 3L1XA 3M62A 2BAYA 1WGMA 3RPGC 5TRBA 5TDWA 4MSXA 2YSMA 2MNYA 5H1TA 3N9PA 2VPBA 1WEPA 2KGIA 3KV5A 3M99A 2ECNA 1HYJA 2KIZA 1MM2A 2K1JA 2MIQA 5KH9A 2HYED 2RSDA 5LKZA 4YAXA 3U5PA 1HYIA 1JM7B 2LGVA 2VPEA 4LLBA 3QZVA 3GV4A 4IC3A 4AP4A 3N9NA 4GNFA 2G6QA 2Y43A 4B86C 4TKPB 3SOXA 3O35A 5EYAF 4XI1A 2CKLB 3HCSA 2FUUA 2LGGA 2ECIA 4YBSA 5B78A 2JMJA 2MD7B 4YATA 3RPGB 1WEUA 5DKAA 1WEVA 5AIUA 4YADA 5FEYA 3C6WA 3MHHA 4LJNA 2YU4A 5B8DA 2XB1A 4GNEA 4AYCA 3FL2A 2YW8A 3N9OA 3DQVR 3ZPVE 4ZDTA 1WIMA 1U6GB 2I50A 4GB0A 5FERA 1K2FA 3U5MA 2M6MA 1CHCA 4LADB 4LKAA 3O33A 2Y1NA 4I7DA 3SHBA 2KGGA 2YURA 3LQJA 2VJFB 1LDJB 2YSJA 3LQIA 2YHOA 4BBQA 4UI9B 3LRQA 1WE9A 2ECJA 1WENA 2KU3A 2YUCA 5KH3A 1VYXA 4LK9A 4R7EA 5B77A 1MM3A 4V3LC 3PUQA 2L0BA 4MVTA 2CSZA 3KV6A 4I7BA 4I7CA 1VFYA 1WEOA 3HTKC 3SOUA 3ZVYA 2FSAA 2ECGA 4QF3A 3KQIA 1ZBDB 3ASLA 4WZ0A 4ZQLA 2KWKA 2MD8C 5C11A 2LGLA 3L11A 2L5UA 2CKLA 2VJEB 1T1HA 2E6SA 2H0DA 4NN2A 1VD4A 2QJ0A 5H1UA 3O70A 4UP5A 2UZGA 1XWHA 2QICA 4PTBA 2JMDA 2M85A 4O64A 3PURA 2KREA 1WEMA 3RTRB 3V43A 5TABA 3DPLR 2VP7A 5D1LB 2ZETC 3O36A 1WEEA 1Z60A 3VK6A 2E6RA 4WA6A 5B79A 4A0CD 4C9ZA 2VPGA 4R8PK 5FB0A 3U5OA 2NAAA 2L80A 1WILA 2F6NA 2OXQC 2ECVA 4BHWA 2L43A 4QF2A 2RI7A 2HDPA 4FK5A 2KR4A 2JMIA 1V87A 3I2DA 2VPDA 5JG6A 4B7YC 2C2VS 2Y1MA 2KYUA 2EODA 2JRJA 3N9LA 1FBVA 3LQHA 2MUMA 4FO9A 4IC2A 2KE1A 3O7AA 2DX8A 3HCTA 4FJCA 5G0FA 2K17A 2MT5A 5H9MA 2LRIC 1Z6UA 3NG2A 1WEQA 4YC9A 4S3OC 3L1ZB 4YABA 2D8SA 4CCGX 5TDRA 2C2LA 3PHDA 4R2YA 2KWOA 3HCUA 1JM7A 2MA6A 3ZNIA 5D1KB 5J3XA 2PNXA 2L75A 3EB6A 4YBTA 4A4CA 1Z2QA 2LQ6A 1LDKC 4P5OB 5H1VA 5D1MB 5G05B 4AVXA 3M63A 2LN0A 4YBMA 2YT5A 2F42A 2LGKA 2EGPA 4V3KC 1N87A 5DINA 4N3WA 2F6JA 2ECWA 2CSYA 4GNGA 5I3LA 2KFTA 2LDRA 1E4UA 4FIPA 4GNDA 4X3GA 1BORA 2KWNA 1WFKA 3O34A 4Q6FA 2AN6A 1WEWA 2YREA 4AYCB 2G45A 2KWJA 3EB5A 1FP0A 5G04B 2QIZA 4S3OB 5KH7A 1WESA 5C13A 2PUYA 2ECTA 1G25A 2VJFA 2M3HA 5B75A 2LXHC 3O37A 5LKTA 5FB1A 2K4DA 5TBNA 2CT2A 2YQMA 2IDAA 2LV9A 5AITA 3ZTGA 1X4IA 4CA1A 4L58A 2XEUA 3KNVA 4A49A 3ZPV1 2YYRA 3ZVZB 5B76A 4PPEA 3MHSA 4W4UA 3T7LA 2YHNA 2G43A 3IHPA 4ZUXU 3N9MA 1X4UA 3ZYQA 1RMDA 1IYMA 1DVPA 2MNZA 2VJEA 4L7XA 5LKUA 3N9QA 2H0DB 4N4FA 3U5NA 4F52B 3T6RA 5LCWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5K A;  1JOC A;  2K16 A;  1F62 A;  4AUQ B;  4UP0 A;  2EA6 A;  2YQL A;  3GL6 A;  4WZ3 B;  2MA5 A;  2VNF A;  3SOW A;  2FUI A;  1X4J A;  5LKX A;  4WZ2 A;  2LXP C;  2M1R A;  4A4B A;  3L1X A;  3M62 A;  2BAY A;  1WGM A;  3RPG C;  5TRB A;  5TDW A;  4MSX A;  2YSM A;  2MNY A;  5H1T A;  3N9P A;  2VPB A;  1WEP A;  2KGI A;  3KV5 A;  3M99 A;  2ECN A;  1HYJ A;  2KIZ A;  1MM2 A;  2K1J A;  2MIQ A;  5KH9 A;  2HYE D;  2RSD A;  5LKZ A;  4YAX A;  3U5P A;  1HYI A;  1JM7 B;  2LGV A;  2VPE A;  4LLB A;  3QZV A;  3GV4 A;  4IC3 A;  4AP4 A;  3N9N A;  4GNF A;  2G6Q A;  2Y43 A;  4B86 C;  4TKP B;  3SOX A;  3O35 A;  5EYA F;  4XI1 A;  2CKL B;  3HCS A;  2FUU A;  2LGG A;  2ECI A;  4YBS A;  5B78 A;  2JMJ A;  2MD7 B;  4YAT A;  3RPG B;  1WEU A;  5DKA A;  1WEV A;  5AIU A;  4YAD A;  5FEY A;  3C6W A;  3MHH A;  4LJN A;  2YU4 A;  5B8D A;  2XB1 A;  4GNE A;  4AYC A;  3FL2 A;  2YW8 A;  3N9O A;  3DQV R;  3ZPV E;  4ZDT A;  1WIM A;  1U6G B;  2I50 A;  4GB0 A;  5FER A;  1K2F A;  3U5M A;  2M6M A;  1CHC A;  4LAD B;  4LKA A;  3O33 A;  2Y1N A;  4I7D A;  3SHB A;  2KGG A;  2YUR A;  3LQJ A;  2VJF B;  1LDJ B;  2YSJ A;  3LQI A;  2YHO A;  4BBQ A;  4UI9 B;  3LRQ A;  1WE9 A;  2ECJ A;  1WEN A;  2KU3 A;  2YUC A;  5KH3 A;  1VYX A;  4LK9 A;  4R7E A;  5B77 A;  1MM3 A;  4V3L C;  3PUQ A;  2L0B A;  4MVT A;  2CSZ A;  3KV6 A;  4I7B A;  4I7C A;  1VFY A;  1WEO A;  3HTK C;  3SOU A;  3ZVY A;  2FSA A;  2ECG A;  4QF3 A;  3KQI A;  1ZBD B;  3ASL A;  4WZ0 A;  4ZQL A;  2KWK A;  2MD8 C;  5C11 A;  2LGL A;  3L11 A;  2L5U A;  2CKL A;  2VJE B;  1T1H A;  2E6S A;  2H0D A;  4NN2 A;  1VD4 A;  2QJ0 A;  5H1U A;  3O70 A;  4UP5 A;  2UZG A;  1XWH A;  2QIC A;  4PTB A;  2JMD A;  2M85 A;  4O64 A;  3PUR A;  2KRE A;  1WEM A;  3RTR B;  3V43 A;  5TAB A;  3DPL R;  2VP7 A;  5D1L B;  2ZET C;  3O36 A;  1WEE A;  1Z60 A;  3VK6 A;  2E6R A;  4WA6 A;  5B79 A;  4A0C D;  4C9Z A;  2VPG A;  4R8P K;  5FB0 A;  3U5O A;  2NAA A;  2L80 A;  1WIL A;  2F6N A;  2OXQ C;  2ECV A;  4BHW A;  2L43 A;  4QF2 A;  2RI7 A;  2HDP A;  4FK5 A;  2KR4 A;  2JMI A;  1V87 A;  3I2D A;  2VPD A;  5JG6 A;  4B7Y C;  2C2V S;  2Y1M A;  2KYU A;  2EOD A;  2JRJ A;  3N9L A;  1FBV A;  3LQH A;  2MUM A;  4FO9 A;  4IC2 A;  2KE1 A;  3O7A A;  2DX8 A;  3HCT A;  4FJC A;  5G0F A;  2K17 A;  2MT5 A;  5H9M A;  2LRI C;  1Z6U A;  3NG2 A;  1WEQ A;  4YC9 A;  4S3O C;  3L1Z B;  4YAB A;  2D8S A;  4CCG X;  5TDR A;  2C2L A;  3PHD A;  4R2Y A;  2KWO A;  3HCU A;  1JM7 A;  2MA6 A;  3ZNI A;  5D1K B;  5J3X A;  2PNX A;  2L75 A;  3EB6 A;  4YBT A;  4A4C A;  1Z2Q A;  2LQ6 A;  1LDK C;  4P5O B;  5H1V A;  5D1M B;  5G05 B;  4AVX A;  3M63 A;  2LN0 A;  4YBM A;  2YT5 A;  2F42 A;  2LGK A;  2EGP A;  4V3K C;  1N87 A;  5DIN A;  4N3W A;  2F6J A;  2ECW A;  2CSY A;  4GNG A;  5I3L A;  2KFT A;  2LDR A;  1E4U A;  4FIP A;  4GND A;  4X3G A;  1BOR A;  2KWN A;  1WFK A;  3O34 A;  4Q6F A;  2AN6 A;  1WEW A;  2YRE A;  4AYC B;  2G45 A;  2KWJ A;  3EB5 A;  1FP0 A;  5G04 B;  2QIZ A;  4S3O B;  5KH7 A;  1WES A;  5C13 A;  2PUY A;  2ECT A;  1G25 A;  2VJF A;  2M3H A;  5B75 A;  2LXH C;  3O37 A;  5LKT A;  5FB1 A;  2K4D A;  5TBN A;  2CT2 A;  2YQM A;  2IDA A;  2LV9 A;  5AIT A;  3ZTG A;  1X4I A;  4CA1 A;  4L58 A;  2XEU A;  3KNV A;  4A49 A;  3ZPV 1;  2YYR A;  3ZVZ B;  5B76 A;  4PPE A;  3MHS A;  4W4U A;  3T7L A;  2YHN A;  2G43 A;  3IHP A;  4ZUX U;  3N9M A;  1X4U A;  3ZYQ A;  1RMD A;  1IYM A;  1DVP A;  2MNZ A;  2VJE A;  4L7X A;  5LKU A;  3N9Q A;  2H0D B;  4N4F A;  3U5N A;  4F52 B;  3T6R A;  5LCW B; 
#chains in the Genus database with same CATH topology
 3C5K A;  1JOC A;  2K16 A;  1F62 A;  4AUQ B;  4UP0 A;  5SVY A;  2EA6 A;  2YQL A;  3GL6 A;  4WZ3 B;  2MA5 A;  2VNF A;  3SOW A;  2FUI A;  1X4J A;  5LKX A;  4WZ2 A;  2LXP C;  2M1R A;  2M13 A;  4A4B A;  3L1X A;  3M62 A;  2BAY A;  1WGM A;  3RPG C;  5TRB A;  5TDW A;  4MSX A;  2YSM A;  2MNY A;  5H1T A;  3N9P A;  2VPB A;  1WEP A;  2KGI A;  3KV5 A;  3M99 A;  2ECN A;  1HYJ A;  2KIZ A;  1MM2 A;  2K1J A;  2MIQ A;  5KH9 A;  2HYE D;  2CSV A;  2RSD A;  5LKZ A;  4YAX A;  3U5P A;  1HYI A;  1JM7 B;  2LGV A;  2VPE A;  4LLB A;  3QZV A;  3GV4 A;  4IC3 A;  4AP4 A;  3N9N A;  4GNF A;  2G6Q A;  2Y43 A;  4B86 C;  4TKP B;  3SOX A;  3O35 A;  3MDB C;  5EYA F;  4XI1 A;  2CKL B;  3HCS A;  2FUU A;  1DCQ A;  2LGG A;  2ECI A;  4YBS A;  5B78 A;  2JMJ A;  2MD7 B;  4YAT A;  3PLW A;  3RPG B;  1WEU A;  5DKA A;  1WEV A;  5AIU A;  4YAD A;  5FEY A;  3C6W A;  3MHH A;  4LJN A;  2YU4 A;  5B8D A;  2XB1 A;  4GNE A;  4AYC A;  3FL2 A;  2YW8 A;  3N9O A;  3DQV R;  3ZPV E;  4ZDT A;  1WIM A;  3DWD A;  1U6G B;  2I50 A;  4GB0 A;  5FER A;  1K2F A;  3U5M A;  2M6M A;  1CHC A;  4LAD B;  4LKA A;  3O33 A;  2Y1N A;  4I7D A;  3SHB A;  2KGG A;  2YUR A;  3LQJ A;  2VJF B;  1LDJ B;  2YSJ A;  3H7H A;  2DJA A;  3LQI A;  2KKX A;  2YHO A;  4BBQ A;  4UI9 B;  3LRQ A;  1WE9 A;  2ECJ A;  1WEN A;  2KU3 A;  2YUC A;  5KH3 A;  1VYX A;  4H9D A;  4LK9 A;  4R7E A;  5B77 A;  2CRW A;  1MM3 A;  4V3L C;  3PUQ A;  2L0B A;  5SVI A;  2LAU A;  2XP0 A;  4MVT A;  2CSZ A;  3KV6 A;  4I7B A;  4I7C A;  1VFY A;  1WEO A;  3HTK C;  2XOC A;  3SOU A;  3ZVY A;  2FSA A;  2ECG A;  4QF3 A;  3KQI A;  1ZBD B;  3ASL A;  4WZ0 A;  4ZQL A;  2KWK A;  2MD8 C;  5C11 A;  2LGL A;  2IQJ A;  3L11 A;  2L5U A;  2CKL A;  2VJE B;  1T1H A;  2E6S A;  2H0D A;  4NN2 A;  2JUN A;  1VD4 A;  2QJ0 A;  5H1U A;  3O70 A;  4UP5 A;  2UZG A;  3FEH A;  1XWH A;  2QIC A;  4PTB A;  2JMD A;  2M85 A;  4O64 A;  3PUR A;  4Z0O A;  2KRE A;  1WEM A;  3RTR B;  3V43 A;  5TAB A;  3DPL R;  2VP7 A;  5D1L B;  2ZET C;  3JUE A;  3O36 A;  1WEE A;  1Z60 A;  3VK6 A;  2E6R A;  4WA6 A;  5B79 A;  4A0C D;  4C9Z A;  2VPG A;  4R8P K;  5FB0 A;  3U5O A;  2NAA A;  5K3Q A;  2L80 A;  1WIL A;  2F6N A;  2OXQ C;  2ECV A;  4BHW A;  2L43 A;  4QF2 A;  2RI7 A;  2YVR A;  2HDP A;  4FK5 A;  2KR4 A;  2JMI A;  1V87 A;  3I2D A;  1MBM A;  2VPD A;  5JG6 A;  2C2V S;  4B7Y C;  2E61 A;  2Y1M A;  2KYU A;  3FM8 C;  2EOD A;  2JM3 A;  2JRJ A;  3N9L A;  1FBV A;  3LQH A;  2MUM A;  2B0O E;  4FO9 A;  2CON A;  4IC2 A;  2KE1 A;  3O7A A;  2DX8 A;  2CRR A;  3HCT A;  4FJC A;  5G0F A;  2K17 A;  2MT5 A;  5H9M A;  2LRI C;  1Z6U A;  3O47 A;  3NG2 A;  2FD4 A;  1WEQ A;  4YC9 A;  4S3O C;  3L1Z B;  3SUB A;  4YAB A;  2D8S A;  4CCG X;  5TDR A;  2C2L A;  3PHD A;  4R2Y A;  2KWO A;  3HCU A;  3FAO A;  1JM7 A;  2MA6 A;  3ZNI A;  3Q1D A;  5D1K B;  5J3X A;  2PNX A;  2L75 A;  3EB6 A;  4YBT A;  4A4C A;  2L7P A;  1Z2Q A;  2LQ6 A;  1LDK C;  3LVQ E;  4P5O B;  5H1V A;  5D1M B;  5G05 B;  4AVX A;  3M63 A;  2LN0 A;  4YBM A;  2YT5 A;  2F42 A;  3LJU X;  2LGK A;  2EXU A;  2MKE A;  2XOZ A;  2EGP A;  4F1P A;  4V3K C;  1N87 A;  5DIN A;  4N3W A;  2F6J A;  2ECW A;  2CSY A;  4GNG A;  5I3L A;  2KFT A;  2LDR A;  1E4U A;  4FIP A;  2EGM A;  4GND A;  4X3G A;  1BOR A;  2KWN A;  1WFK A;  3O34 A;  4Q6F A;  2D8U A;  2AN6 A;  2RR4 A;  1WEW A;  2YRE A;  3LVR E;  4AYC B;  3M7K A;  2G45 A;  2KWJ A;  3EB5 A;  1FP0 A;  5G04 B;  4Z0R A;  2QIZ A;  4S3O B;  2FFW A;  5KH7 A;  4QQ4 A;  1WES A;  5C13 A;  2PUY A;  4OGE A;  2ECT A;  1G25 A;  2VJF A;  2M3H A;  5B75 A;  2LXH C;  3O37 A;  5LKT A;  5FB1 A;  2K4D A;  5TBN A;  2CT2 A;  2YQM A;  2DSM A;  2IDA A;  2LV9 A;  5AIT A;  3ZTG A;  1X4I A;  3T9K A;  4O62 A;  4CA1 A;  4L58 A;  3KDE C;  2XEU A;  3KNV A;  3LDY A;  4A49 A;  3ZPV 1;  2YYR A;  3ZVZ B;  5B76 A;  4PPE A;  3DDT A;  3MHS A;  4W4U A;  3T7L A;  2YHN A;  5SVX A;  2G43 A;  3IHP A;  4ZUX U;  3N9M A;  5SVI B;  1X4U A;  3ZYQ A;  1RMD A;  2OWA A;  4OGC A;  1IYM A;  2XOY A;  1DVP A;  2MNZ A;  2VJE A;  4L7X A;  5LKU A;  2KKY A;  3N9Q A;  3E2D A;  3FAN A;  2P57 A;  2H0D B;  3FJU B;  4N4F A;  3U5N A;  4F52 B;  3T6R A;  5LCW B; 
#chains in the Genus database with same CATH homology
 3C5K A;  1JOC A;  2K16 A;  1F62 A;  4AUQ B;  4UP0 A;  2EA6 A;  2YQL A;  3GL6 A;  4WZ3 B;  2MA5 A;  2VNF A;  3SOW A;  2FUI A;  1X4J A;  5LKX A;  4WZ2 A;  2LXP C;  2M1R A;  4A4B A;  3L1X A;  3M62 A;  2BAY A;  1WGM A;  3RPG C;  5TRB A;  5TDW A;  4MSX A;  2YSM A;  2MNY A;  5H1T A;  3N9P A;  2VPB A;  1WEP A;  2KGI A;  3KV5 A;  3M99 A;  2ECN A;  1HYJ A;  2KIZ A;  1MM2 A;  2K1J A;  2MIQ A;  5KH9 A;  2HYE D;  2RSD A;  5LKZ A;  4YAX A;  3U5P A;  1HYI A;  1JM7 B;  2LGV A;  2VPE A;  4LLB A;  3QZV A;  3GV4 A;  4IC3 A;  4AP4 A;  3N9N A;  4GNF A;  2G6Q A;  2Y43 A;  4B86 C;  4TKP B;  3SOX A;  3O35 A;  5EYA F;  4XI1 A;  2CKL B;  3HCS A;  2FUU A;  2LGG A;  2ECI A;  4YBS A;  5B78 A;  2JMJ A;  2MD7 B;  4YAT A;  3RPG B;  1WEU A;  5DKA A;  1WEV A;  5AIU A;  4YAD A;  5FEY A;  3C6W A;  3MHH A;  4LJN A;  2YU4 A;  5B8D A;  2XB1 A;  4GNE A;  4AYC A;  3FL2 A;  2YW8 A;  3N9O A;  3DQV R;  3ZPV E;  4ZDT A;  1WIM A;  1U6G B;  2I50 A;  4GB0 A;  5FER A;  1K2F A;  3U5M A;  2M6M A;  1CHC A;  4LAD B;  4LKA A;  3O33 A;  2Y1N A;  4I7D A;  3SHB A;  2KGG A;  2YUR A;  3LQJ A;  2VJF B;  1LDJ B;  2YSJ A;  3LQI A;  2YHO A;  4BBQ A;  4UI9 B;  3LRQ A;  1WE9 A;  2ECJ A;  1WEN A;  2KU3 A;  2YUC A;  5KH3 A;  1VYX A;  4LK9 A;  4R7E A;  5B77 A;  1MM3 A;  4V3L C;  3PUQ A;  2L0B A;  4MVT A;  2CSZ A;  3KV6 A;  4I7B A;  4I7C A;  1VFY A;  1WEO A;  3HTK C;  3SOU A;  3ZVY A;  2FSA A;  2ECG A;  4QF3 A;  3KQI A;  1ZBD B;  3ASL A;  4WZ0 A;  4ZQL A;  2KWK A;  2MD8 C;  5C11 A;  2LGL A;  3L11 A;  2L5U A;  2CKL A;  2VJE B;  1T1H A;  2E6S A;  2H0D A;  4NN2 A;  1VD4 A;  2QJ0 A;  5H1U A;  3O70 A;  4UP5 A;  2UZG A;  1XWH A;  2QIC A;  4PTB A;  2JMD A;  2M85 A;  4O64 A;  3PUR A;  2KRE A;  1WEM A;  3RTR B;  3V43 A;  5TAB A;  3DPL R;  2VP7 A;  5D1L B;  2ZET C;  3O36 A;  1WEE A;  1Z60 A;  3VK6 A;  2E6R A;  4WA6 A;  5B79 A;  4A0C D;  4C9Z A;  2VPG A;  4R8P K;  5FB0 A;  3U5O A;  2NAA A;  2L80 A;  1WIL A;  2F6N A;  2OXQ C;  2ECV A;  4BHW A;  2L43 A;  4QF2 A;  2RI7 A;  2HDP A;  4FK5 A;  2KR4 A;  2JMI A;  1V87 A;  3I2D A;  2VPD A;  5JG6 A;  4B7Y C;  2C2V S;  2Y1M A;  2KYU A;  2EOD A;  2JRJ A;  3N9L A;  1FBV A;  3LQH A;  2MUM A;  4FO9 A;  4IC2 A;  2KE1 A;  3O7A A;  2DX8 A;  3HCT A;  4FJC A;  5G0F A;  2K17 A;  2MT5 A;  5H9M A;  2LRI C;  1Z6U A;  3NG2 A;  1WEQ A;  4YC9 A;  4S3O C;  3L1Z B;  4YAB A;  2D8S A;  4CCG X;  5TDR A;  2C2L A;  3PHD A;  4R2Y A;  2KWO A;  3HCU A;  1JM7 A;  2MA6 A;  3ZNI A;  5D1K B;  5J3X A;  2PNX A;  2L75 A;  3EB6 A;  4YBT A;  4A4C A;  1Z2Q A;  2LQ6 A;  1LDK C;  4P5O B;  5H1V A;  5D1M B;  5G05 B;  4AVX A;  3M63 A;  2LN0 A;  4YBM A;  2YT5 A;  2F42 A;  2LGK A;  2EGP A;  4V3K C;  1N87 A;  5DIN A;  4N3W A;  2F6J A;  2ECW A;  2CSY A;  4GNG A;  5I3L A;  2KFT A;  2LDR A;  1E4U A;  4FIP A;  4GND A;  4X3G A;  1BOR A;  2KWN A;  1WFK A;  3O34 A;  4Q6F A;  2AN6 A;  1WEW A;  2YRE A;  4AYC B;  2G45 A;  2KWJ A;  3EB5 A;  1FP0 A;  5G04 B;  2QIZ A;  4S3O B;  5KH7 A;  1WES A;  5C13 A;  2PUY A;  2ECT A;  1G25 A;  2VJF A;  2M3H A;  5B75 A;  2LXH C;  3O37 A;  5LKT A;  5FB1 A;  2K4D A;  5TBN A;  2CT2 A;  2YQM A;  2IDA A;  2LV9 A;  5AIT A;  3ZTG A;  1X4I A;  4CA1 A;  4L58 A;  2XEU A;  3KNV A;  4A49 A;  3ZPV 1;  2YYR A;  3ZVZ B;  5B76 A;  4PPE A;  3MHS A;  4W4U A;  3T7L A;  2YHN A;  2G43 A;  3IHP A;  4ZUX U;  3N9M A;  1X4U A;  3ZYQ A;  1RMD A;  1IYM A;  1DVP A;  2MNZ A;  2VJE A;  4L7X A;  5LKU A;  3N9Q A;  2H0D B;  4N4F A;  3U5N A;  4F52 B;  3T6R A;  5LCW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...