3DQVR

Structural insights into nedd8 activation of cullin-ring ligases: conformational control of conjugation
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8
publication title Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 7
structure length 86
sequence length 86
chains with identical sequence Y
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3dqvR00
4YATA 2EGPA 3HCUA 4QF3A 2JMIA 2Y43A 3U5MA 2Y1NA 3LQHA 2M6MA 4AYCA 2H0DB 2F6NA 2RSDA 2PUYA 2KYUA 2ZETC 5G0FA 2F6JA 1WFKA 4V3LC 5LKUA 2KWOA 2YQMA 3GV4A 5B8DA 4W4UA 4IC2A 3FL2A 4YBSA 5C11A 2YURA 1XWHA 4LK9A 3N9LA 4O64A 4LLBA 4X3GA 3I2DA 3U5PA 5DINA 2UZGA 3M62A 4AUQB 1K2FA 5EYAF 2K16A 2OXQC 1BORA 3N9OA 2C2LA 2MD7B 4FO9A 4BHWA 2LDRA 2KU3A 2E6SA 4Q6FA 4R2YA 2E6RA 2K1JA 1CHCA 1VYXA 3ASLA 3LQJA 3QZVA 4AYCB 4GNGA 4S3OC 3C6WA 5TABA 1U6GB 3RTRB 4B7YC 2L0BA 3MHSA 4A4CA 1HYJA 3U5OA 2LGLA 4I7BA 4FK5A 3HCTA 2MNZA 1WEPA 3LQIA 3ZPVE 1WEVA 3PHDA 2ECNA 5TRBA 4AP4A 3SOUA 2Y1MA 5KH7A 4N4FA 5TBNA 2LXPC 3SOWA 5B77A 1WEWA 2MA5A 2MIQA 2QICA 4YADA 2G6QA 3DQVR 2VJEA 3O37A 2KWKA 2YREA 2CKLB 4A4BA 2FSAA 2MT5A 3L1XA 3IHPA 3KNVA 4I7DA 2M3HA 4S3OB 1WENA 4I7CA 1ZBDB 2YSJA 5TDRA 4UP5A 5H1TA 3ZTGA 4PTBA 5FEYA 2MUMA 4LADB 4F52B 2LXHC 2ECGA 2LGKA 5FERA 4ZQLA 3O34A 2YHNA 3RPGC 2VJFB 1X4IA 4B86C 3M99A 5D1LB 5FB1A 2LQ6A 3ZNIA 1LDJB 4L58A 1VFYA 1WEOA 5FB0A 5DKAA 2KWJA 3O33A 4YBTA 1Z60A 2XB1A 2YT5A 4A49A 4ZDTA 3LRQA 1F62A 4YABA 5B78A 5AITA 1IYMA 3O7AA 2KE1A 2IDAA 2LGVA 4XI1A 4BBQA 1WIMA 4N3WA 3N9QA 2D8SA 1X4JA 2KGIA 3ZYQA 3O36A 1MM3A 2LN0A 2M85A 2JMJA 2YHOA 5AIUA 1Z6UA 2QJ0A 5LKTA 3T7LA 3C5KA 3RPGB 4QF2A 1G25A 2JMDA 5JG6A 2L43A 2MNYA 2YQLA 3EB6A 2F42A 2H0DA 4P5OB 2KIZA 4V3KC 2MD8C 5G05B 1WGMA 1X4UA 5H1UA 2K4DA 5KH3A 3L1ZB 4YAXA 1T1HA 4GNFA 1LDKC 1WEUA 2VNFA 2MA6A 3DPLR 4WZ3B 5I3LA 1RMDA 2KWNA 2M1RA 2C2VS 2HYED 1WEEA 3MHHA 2FUIA 2EA6A 2LRIC 2KR4A 2VPDA 2FUUA 4LKAA 5B75A 2AN6A 4LJNA 3ZPV1 4R8PK 2QIZA 2LV9A 3VK6A 4UI9B 1N87A 1DVPA 3M63A 1WILA 5KH9A 1JM7A 1WESA 2ECIA 4CCGX 5LKXA 2BAYA 4YC9A 4GNEA 5B79A 1V87A 5G04B 4ZUXU 3EB5A 3T6RA 1FBVA 2YYRA 5LCWB 2K17A 2VPBA 3L11A 5J3XA 5TDWA 3N9MA 2JRJA 4A0CD 3PURA 2ECVA 4L7XA 4CA1A 4WZ0A 3U5NA 2L80A 4C9ZA 3KV6A 5H1VA 4UP0A 2YW8A 2DX8A 2CT2A 3ZVZB 4AVXA 1WEQA 3SHBA 1WE9A 2ECTA 2VJEB 5B76A 2KFTA 3N9PA 2ECJA 2L75A 3O70A 3KV5A 5D1MB 4WA6A 3V43A 1JOCA 2XEUA 2L5UA 2CKLA 4WZ2A 5C13A 4PPEA 1JM7B 4GB0A 2G43A 1Z2QA 4FIPA 2CSYA 2EODA 4R7EA 2VPEA 2HDPA 3NG2A 1VD4A 1E4UA 2NAAA 2KREA 2ECWA 4YBMA 4MVTA 2LGGA 3PUQA 3HTKC 4IC3A 3KQIA 2VPGA 1FP0A 4MSXA 3ZVYA 2VJFA 2VP7A 5LKZA 1HYIA 2YSMA 2CSZA 3HCSA 4NN2A 1WEMA 2YU4A 3O35A 2G45A 3GL6A 2I50A 2RI7A 3N9NA 4GNDA 3SOXA 4TKPB 4FJCA 5D1KB 5H9MA 2KGGA 2YUCA 1MM2A 2PNXA
chains in the Genus database with same CATH superfamily
4YATA 2EGPA 3HCUA 4QF3A 3Q1DA 2JMIA 2Y43A 3U5MA 2Y1NA 3DDTA 3LQHA 2M6MA 2B0OE 2XOCA 4AYCA 2DJAA 2H0DB 2F6NA 2RSDA 2PUYA 2KYUA 2ZETC 5G0FA 1WFKA 2F6JA 4V3LC 5LKUA 2KWOA 2YQMA 3GV4A 5B8DA 4Z0OA 4W4UA 2L7PA 4IC2A 3FL2A 4YBSA 5C11A 2YURA 2XOZA 1XWHA 4LK9A 3N9LA 4O62A 4O64A 3JUEA 4LLBA 4X3GA 3I2DA 2CRRA 3U5PA 5DINA 2UZGA 3M62A 4AUQB 1K2FA 5EYAF 2K16A 2OXQC 3LVRE 1BORA 3N9OA 2C2LA 2MD7B 2P57A 4FO9A 4BHWA 2LDRA 2KU3A 2E6SA 4Q6FA 4R2YA 2E6RA 3LJUX 3FAOA 2K1JA 1CHCA 1VYXA 3ASLA 3LQJA 3QZVA 4AYCB 4GNGA 4S3OC 3FEHA 3C6WA 5TABA 1U6GB 3RTRB 4B7YC 2L0BA 3MHSA 4A4CA 1HYJA 3U5OA 2LGLA 4I7BA 4FK5A 3HCTA 2MNZA 1WEPA 3LQIA 3ZPVE 1WEVA 2CRWA 3PHDA 2ECNA 5TRBA 3LDYA 4AP4A 3SOUA 2Y1MA 5KH7A 4N4FA 5TBNA 2LXPC 3SOWA 5B77A 1WEWA 2MA5A 3H7HA 2MIQA 2QICA 3PLWA 4YADA 2G6QA 3DQVR 2VJEA 3O37A 2KWKA 2YREA 2CKLB 5SVIA 4A4BA 2FSAA 2MT5A 3L1XA 3IHPA 3KNVA 4I7DA 2M3HA 2EXUA 4S3OB 1WENA 2EGMA 4I7CA 1ZBDB 2YSJA 5TDRA 4UP5A 5H1TA 3ZTGA 4PTBA 5FEYA 2MUMA 3LVQE 4LADB 4F52B 2LXHC 2ECGA 2LGKA 5FERA 4ZQLA 3O34A 2YHNA 3RPGC 2VJFB 1X4IA 5SVYA 4B86C 3M99A 5D1LB 5FB1A 2LQ6A 3ZNIA 1LDJB 4L58A 1VFYA 1WEOA 5FB0A 3DWDA 5DKAA 2KWJA 3O33A 4YBTA 1Z60A 2XB1A 2YT5A 4OGEA 4A49A 4ZDTA 3LRQA 1F62A 4YABA 3E2DA 5B78A 5AITA 1IYMA 3O7AA 2KE1A 3MDBC 2IDAA 2LGVA 4XI1A 4BBQA 1WIMA 4N3WA 3N9QA 2D8SA 1X4JA 2KGIA 3ZYQA 3O36A 1MM3A 2LN0A 2M85A 2JMJA 2YHOA 4Z0RA 5AIUA 5SVXA 3FJUB 1Z6UA 2QJ0A 5LKTA 3T7LA 3C5KA 3RPGB 4QF2A 1DCQA 2JMDA 1G25A 5JG6A 2L43A 2MNYA 2YQLA 3EB6A 2F42A 2H0DA 2IQJA 4P5OB 2KIZA 4V3KC 2MD8C 5G05B 2XOYA 1WGMA 1X4UA 3KDEC 5H1UA 2K4DA 5KH3A 3L1ZB 4YAXA 1T1HA 4GNFA 1LDKC 1WEUA 2VNFA 2MA6A 3DPLR 4WZ3B 5I3LA 2E61A 1RMDA 2KWNA 2M1RA 3FANA 4QQ4A 2KKYA 2C2VS 2HYED 1WEEA 3MHHA 2FUIA 2EA6A 2LRIC 2LAUA 2KR4A 2VPDA 2FUUA 5K3QA 4LKAA 5B75A 2AN6A 4LJNA 3ZPV1 4R8PK 2QIZA 2LV9A 3VK6A 4UI9B 1N87A 1DVPA 2M13A 3M63A 1WILA 5KH9A 1JM7A 1WESA 2ECIA 2CSVA 1MBMA 4CCGX 5LKXA 2BAYA 4YC9A 4GNEA 4F1PA 5B79A 3SUBA 1V87A 2MKEA 5G04B 4ZUXU 3EB5A 3T6RA 1FBVA 2YYRA 5LCWB 2K17A 2VPBA 3L11A 5J3XA 5TDWA 3N9MA 2JRJA 4OGCA 4A0CD 3PURA 2ECVA 4L7XA 4CA1A 4WZ0A 3U5NA 2FFWA 2XP0A 2L80A 4C9ZA 3KV6A 5H1VA 4UP0A 2YW8A 2DX8A 2DSMA 2CT2A 3ZVZB 4AVXA 1WEQA 2YVRA 3SHBA 1WE9A 2ECTA 2VJEB 2KKXA 5B76A 2KFTA 5SVIB 3N9PA 2FD4A 4H9DA 2ECJA 2L75A 3O70A 3KV5A 5D1MB 4WA6A 3V43A 1JOCA 2XEUA 2L5UA 2CKLA 4WZ2A 3FM8C 5C13A 4PPEA 1JM7B 2JM3A 4GB0A 2G43A 1Z2QA 4FIPA 2CSYA 4R7EA 2EODA 2VPEA 2HDPA 3NG2A 1VD4A 1E4UA 2NAAA 2KREA 2ECWA 4YBMA 3O47A 3T9KA 4MVTA 2LGGA 3PUQA 3HTKC 4IC3A 3KQIA 2VPGA 1FP0A 4MSXA 3ZVYA 2VJFA 2VP7A 5LKZA 1HYIA 2YSMA 2CSZA 3HCSA 4NN2A 1WEMA 2YU4A 3O35A 3M7KA 2G45A 3GL6A 2I50A 2RI7A 3N9NA 4GNDA 3SOXA 4TKPB 4FJCA 5D1KB 2RR4A 5H9MA 2KGGA 2OWAA 2YUCA 1MM2A 2PNXA 2CONA 2JUNA 2D8UA
chains in the Genus database with same CATH topology
4YATA 2EGPA 3HCUA 4QF3A 2JMIA 2Y43A 3U5MA 2Y1NA 3LQHA 2M6MA 4AYCA 2H0DB 2F6NA 2RSDA 2PUYA 2KYUA 2ZETC 5G0FA 2F6JA 1WFKA 4V3LC 5LKUA 2KWOA 2YQMA 3GV4A 5B8DA 4W4UA 4IC2A 3FL2A 4YBSA 5C11A 2YURA 1XWHA 4LK9A 3N9LA 4O64A 4LLBA 4X3GA 3I2DA 3U5PA 5DINA 2UZGA 3M62A 4AUQB 1K2FA 5EYAF 2K16A 2OXQC 1BORA 3N9OA 2C2LA 2MD7B 4FO9A 4BHWA 2LDRA 2KU3A 2E6SA 4Q6FA 4R2YA 2E6RA 2K1JA 1CHCA 1VYXA 3ASLA 3LQJA 3QZVA 4AYCB 4GNGA 4S3OC 3C6WA 5TABA 1U6GB 3RTRB 4B7YC 2L0BA 3MHSA 4A4CA 1HYJA 3U5OA 2LGLA 4I7BA 4FK5A 3HCTA 2MNZA 1WEPA 3LQIA 3ZPVE 1WEVA 3PHDA 2ECNA 5TRBA 4AP4A 3SOUA 2Y1MA 5KH7A 4N4FA 5TBNA 2LXPC 3SOWA 5B77A 1WEWA 2MA5A 2MIQA 2QICA 4YADA 2G6QA 3DQVR 2VJEA 3O37A 2KWKA 2YREA 2CKLB 4A4BA 2FSAA 2MT5A 3L1XA 3IHPA 3KNVA 4I7DA 2M3HA 4S3OB 1WENA 4I7CA 1ZBDB 2YSJA 5TDRA 4UP5A 5H1TA 3ZTGA 4PTBA 5FEYA 2MUMA 4LADB 4F52B 2LXHC 2ECGA 2LGKA 5FERA 4ZQLA 3O34A 2YHNA 3RPGC 2VJFB 1X4IA 4B86C 3M99A 5D1LB 5FB1A 2LQ6A 3ZNIA 1LDJB 4L58A 1VFYA 1WEOA 5FB0A 5DKAA 2KWJA 3O33A 4YBTA 1Z60A 2XB1A 2YT5A 4A49A 4ZDTA 3LRQA 1F62A 4YABA 5B78A 5AITA 1IYMA 3O7AA 2KE1A 2IDAA 2LGVA 4XI1A 4BBQA 1WIMA 4N3WA 3N9QA 2D8SA 1X4JA 2KGIA 3ZYQA 3O36A 1MM3A 2LN0A 2M85A 2JMJA 2YHOA 5AIUA 1Z6UA 2QJ0A 5LKTA 3T7LA 3C5KA 3RPGB 4QF2A 1G25A 2JMDA 5JG6A 2L43A 2MNYA 2YQLA 3EB6A 2F42A 2H0DA 4P5OB 2KIZA 4V3KC 2MD8C 5G05B 1WGMA 1X4UA 5H1UA 2K4DA 5KH3A 3L1ZB 4YAXA 1T1HA 4GNFA 1LDKC 1WEUA 2VNFA 2MA6A 3DPLR 4WZ3B 5I3LA 1RMDA 2KWNA 2M1RA 2C2VS 2HYED 1WEEA 3MHHA 2FUIA 2EA6A 2LRIC 2KR4A 2VPDA 2FUUA 4LKAA 5B75A 2AN6A 4LJNA 3ZPV1 4R8PK 2QIZA 2LV9A 3VK6A 4UI9B 1N87A 1DVPA 3M63A 1WILA 5KH9A 1JM7A 1WESA 2ECIA 4CCGX 5LKXA 2BAYA 4YC9A 4GNEA 5B79A 1V87A 5G04B 4ZUXU 3EB5A 3T6RA 1FBVA 2YYRA 5LCWB 2K17A 2VPBA 3L11A 5J3XA 5TDWA 3N9MA 2JRJA 4A0CD 3PURA 2ECVA 4L7XA 4CA1A 4WZ0A 3U5NA 2L80A 4C9ZA 3KV6A 5H1VA 4UP0A 2YW8A 2DX8A 2CT2A 3ZVZB 4AVXA 1WEQA 3SHBA 1WE9A 2ECTA 2VJEB 5B76A 2KFTA 3N9PA 2ECJA 2L75A 3O70A 3KV5A 5D1MB 4WA6A 3V43A 1JOCA 2XEUA 2L5UA 2CKLA 4WZ2A 5C13A 4PPEA 1JM7B 4GB0A 2G43A 1Z2QA 4FIPA 2CSYA 2EODA 4R7EA 2VPEA 2HDPA 3NG2A 1VD4A 1E4UA 2NAAA 2KREA 2ECWA 4YBMA 4MVTA 2LGGA 3PUQA 3HTKC 4IC3A 3KQIA 2VPGA 1FP0A 4MSXA 3ZVYA 2VJFA 2VP7A 5LKZA 1HYIA 2YSMA 2CSZA 3HCSA 4NN2A 1WEMA 2YU4A 3O35A 2G45A 3GL6A 2I50A 2RI7A 3N9NA 4GNDA 3SOXA 4TKPB 4FJCA 5D1KB 5H9MA 2KGGA 2YUCA 1MM2A 2PNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAT A;  2EGP A;  3HCU A;  4QF3 A;  2JMI A;  2Y43 A;  3U5M A;  2Y1N A;  3LQH A;  2M6M A;  4AYC A;  2H0D B;  2F6N A;  2RSD A;  2PUY A;  2KYU A;  2ZET C;  5G0F A;  2F6J A;  1WFK A;  4V3L C;  5LKU A;  2KWO A;  2YQM A;  3GV4 A;  5B8D A;  4W4U A;  4IC2 A;  3FL2 A;  4YBS A;  5C11 A;  2YUR A;  1XWH A;  4LK9 A;  3N9L A;  4O64 A;  4LLB A;  4X3G A;  3I2D A;  3U5P A;  5DIN A;  2UZG A;  3M62 A;  4AUQ B;  1K2F A;  5EYA F;  2K16 A;  2OXQ C;  1BOR A;  3N9O A;  2C2L A;  2MD7 B;  4FO9 A;  4BHW A;  2LDR A;  2KU3 A;  2E6S A;  4Q6F A;  4R2Y A;  2E6R A;  2K1J A;  1CHC A;  1VYX A;  3ASL A;  3LQJ A;  3QZV A;  4AYC B;  4GNG A;  4S3O C;  3C6W A;  5TAB A;  1U6G B;  3RTR B;  4B7Y C;  2L0B A;  3MHS A;  4A4C A;  1HYJ A;  3U5O A;  2LGL A;  4I7B A;  4FK5 A;  3HCT A;  2MNZ A;  1WEP A;  3LQI A;  3ZPV E;  1WEV A;  3PHD A;  2ECN A;  5TRB A;  4AP4 A;  3SOU A;  2Y1M A;  5KH7 A;  4N4F A;  5TBN A;  2LXP C;  3SOW A;  5B77 A;  1WEW A;  2MA5 A;  2MIQ A;  2QIC A;  4YAD A;  2G6Q A;  3DQV R;  2VJE A;  3O37 A;  2KWK A;  2YRE A;  2CKL B;  4A4B A;  2FSA A;  2MT5 A;  3L1X A;  3IHP A;  3KNV A;  4I7D A;  2M3H A;  4S3O B;  1WEN A;  4I7C A;  1ZBD B;  2YSJ A;  5TDR A;  4UP5 A;  5H1T A;  3ZTG A;  4PTB A;  5FEY A;  2MUM A;  4LAD B;  4F52 B;  2LXH C;  2ECG A;  2LGK A;  5FER A;  4ZQL A;  3O34 A;  2YHN A;  3RPG C;  2VJF B;  1X4I A;  4B86 C;  3M99 A;  5D1L B;  5FB1 A;  2LQ6 A;  3ZNI A;  1LDJ B;  4L58 A;  1VFY A;  1WEO A;  5FB0 A;  5DKA A;  2KWJ A;  3O33 A;  4YBT A;  1Z60 A;  2XB1 A;  2YT5 A;  4A49 A;  4ZDT A;  3LRQ A;  1F62 A;  4YAB A;  5B78 A;  5AIT A;  1IYM A;  3O7A A;  2KE1 A;  2IDA A;  2LGV A;  4XI1 A;  4BBQ A;  1WIM A;  4N3W A;  3N9Q A;  2D8S A;  1X4J A;  2KGI A;  3ZYQ A;  3O36 A;  1MM3 A;  2LN0 A;  2M85 A;  2JMJ A;  2YHO A;  5AIU A;  1Z6U A;  2QJ0 A;  5LKT A;  3T7L A;  3C5K A;  3RPG B;  4QF2 A;  1G25 A;  2JMD A;  5JG6 A;  2L43 A;  2MNY A;  2YQL A;  3EB6 A;  2F42 A;  2H0D A;  4P5O B;  2KIZ A;  4V3K C;  2MD8 C;  5G05 B;  1WGM A;  1X4U A;  5H1U A;  2K4D A;  5KH3 A;  3L1Z B;  4YAX A;  1T1H A;  4GNF A;  1LDK C;  1WEU A;  2VNF A;  2MA6 A;  3DPL R;  4WZ3 B;  5I3L A;  1RMD A;  2KWN A;  2M1R A;  2C2V S;  2HYE D;  1WEE A;  3MHH A;  2FUI A;  2EA6 A;  2LRI C;  2KR4 A;  2VPD A;  2FUU A;  4LKA A;  5B75 A;  2AN6 A;  4LJN A;  3ZPV 1;  4R8P K;  2QIZ A;  2LV9 A;  3VK6 A;  4UI9 B;  1N87 A;  1DVP A;  3M63 A;  1WIL A;  5KH9 A;  1JM7 A;  1WES A;  2ECI A;  4CCG X;  5LKX A;  2BAY A;  4YC9 A;  4GNE A;  5B79 A;  1V87 A;  5G04 B;  4ZUX U;  3EB5 A;  3T6R A;  1FBV A;  2YYR A;  5LCW B;  2K17 A;  2VPB A;  3L11 A;  5J3X A;  5TDW A;  3N9M A;  2JRJ A;  4A0C D;  3PUR A;  2ECV A;  4L7X A;  4CA1 A;  4WZ0 A;  3U5N A;  2L80 A;  4C9Z A;  3KV6 A;  5H1V A;  4UP0 A;  2YW8 A;  2DX8 A;  2CT2 A;  3ZVZ B;  4AVX A;  1WEQ A;  3SHB A;  1WE9 A;  2ECT A;  2VJE B;  5B76 A;  2KFT A;  3N9P A;  2ECJ A;  2L75 A;  3O70 A;  3KV5 A;  5D1M B;  4WA6 A;  3V43 A;  1JOC A;  2XEU A;  2L5U A;  2CKL A;  4WZ2 A;  5C13 A;  4PPE A;  1JM7 B;  4GB0 A;  2G43 A;  1Z2Q A;  4FIP A;  2CSY A;  2EOD A;  4R7E A;  2VPE A;  2HDP A;  3NG2 A;  1VD4 A;  1E4U A;  2NAA A;  2KRE A;  2ECW A;  4YBM A;  4MVT A;  2LGG A;  3PUQ A;  3HTK C;  4IC3 A;  3KQI A;  2VPG A;  1FP0 A;  4MSX A;  3ZVY A;  2VJF A;  2VP7 A;  5LKZ A;  1HYI A;  2YSM A;  2CSZ A;  3HCS A;  4NN2 A;  1WEM A;  2YU4 A;  3O35 A;  2G45 A;  3GL6 A;  2I50 A;  2RI7 A;  3N9N A;  4GND A;  3SOX A;  4TKP B;  4FJC A;  5D1K B;  5H9M A;  2KGG A;  2YUC A;  1MM2 A;  2PNX A; 
#chains in the Genus database with same CATH topology
 4YAT A;  2EGP A;  3HCU A;  4QF3 A;  3Q1D A;  2JMI A;  2Y43 A;  3U5M A;  2Y1N A;  3DDT A;  3LQH A;  2M6M A;  2B0O E;  2XOC A;  4AYC A;  2DJA A;  2H0D B;  2F6N A;  2RSD A;  2PUY A;  2KYU A;  2ZET C;  5G0F A;  1WFK A;  2F6J A;  4V3L C;  5LKU A;  2KWO A;  2YQM A;  3GV4 A;  5B8D A;  4Z0O A;  4W4U A;  2L7P A;  4IC2 A;  3FL2 A;  4YBS A;  5C11 A;  2YUR A;  2XOZ A;  1XWH A;  4LK9 A;  3N9L A;  4O62 A;  4O64 A;  3JUE A;  4LLB A;  4X3G A;  3I2D A;  2CRR A;  3U5P A;  5DIN A;  2UZG A;  3M62 A;  4AUQ B;  1K2F A;  5EYA F;  2K16 A;  2OXQ C;  3LVR E;  1BOR A;  3N9O A;  2C2L A;  2MD7 B;  2P57 A;  4FO9 A;  4BHW A;  2LDR A;  2KU3 A;  2E6S A;  4Q6F A;  4R2Y A;  2E6R A;  3LJU X;  3FAO A;  2K1J A;  1CHC A;  1VYX A;  3ASL A;  3LQJ A;  3QZV A;  4AYC B;  4GNG A;  4S3O C;  3FEH A;  3C6W A;  5TAB A;  1U6G B;  3RTR B;  4B7Y C;  2L0B A;  3MHS A;  4A4C A;  1HYJ A;  3U5O A;  2LGL A;  4I7B A;  4FK5 A;  3HCT A;  2MNZ A;  1WEP A;  3LQI A;  3ZPV E;  1WEV A;  2CRW A;  3PHD A;  2ECN A;  5TRB A;  3LDY A;  4AP4 A;  3SOU A;  2Y1M A;  5KH7 A;  4N4F A;  5TBN A;  2LXP C;  3SOW A;  5B77 A;  1WEW A;  2MA5 A;  3H7H A;  2MIQ A;  2QIC A;  3PLW A;  4YAD A;  2G6Q A;  3DQV R;  2VJE A;  3O37 A;  2KWK A;  2YRE A;  2CKL B;  5SVI A;  4A4B A;  2FSA A;  2MT5 A;  3L1X A;  3IHP A;  3KNV A;  4I7D A;  2M3H A;  2EXU A;  4S3O B;  1WEN A;  2EGM A;  4I7C A;  1ZBD B;  2YSJ A;  5TDR A;  4UP5 A;  5H1T A;  3ZTG A;  4PTB A;  5FEY A;  2MUM A;  3LVQ E;  4LAD B;  4F52 B;  2LXH C;  2ECG A;  2LGK A;  5FER A;  4ZQL A;  3O34 A;  2YHN A;  3RPG C;  2VJF B;  1X4I A;  5SVY A;  4B86 C;  3M99 A;  5D1L B;  5FB1 A;  2LQ6 A;  3ZNI A;  1LDJ B;  4L58 A;  1VFY A;  1WEO A;  5FB0 A;  3DWD A;  5DKA A;  2KWJ A;  3O33 A;  4YBT A;  1Z60 A;  2XB1 A;  2YT5 A;  4OGE A;  4A49 A;  4ZDT A;  3LRQ A;  1F62 A;  4YAB A;  3E2D A;  5B78 A;  5AIT A;  1IYM A;  3O7A A;  2KE1 A;  3MDB C;  2IDA A;  2LGV A;  4XI1 A;  4BBQ A;  1WIM A;  4N3W A;  3N9Q A;  2D8S A;  1X4J A;  2KGI A;  3ZYQ A;  3O36 A;  1MM3 A;  2LN0 A;  2M85 A;  2JMJ A;  2YHO A;  4Z0R A;  5AIU A;  5SVX A;  3FJU B;  1Z6U A;  2QJ0 A;  5LKT A;  3T7L A;  3C5K A;  3RPG B;  4QF2 A;  1DCQ A;  2JMD A;  1G25 A;  5JG6 A;  2L43 A;  2MNY A;  2YQL A;  3EB6 A;  2F42 A;  2H0D A;  2IQJ A;  4P5O B;  2KIZ A;  4V3K C;  2MD8 C;  5G05 B;  2XOY A;  1WGM A;  1X4U A;  3KDE C;  5H1U A;  2K4D A;  5KH3 A;  3L1Z B;  4YAX A;  1T1H A;  4GNF A;  1LDK C;  1WEU A;  2VNF A;  2MA6 A;  3DPL R;  4WZ3 B;  5I3L A;  2E61 A;  1RMD A;  2KWN A;  2M1R A;  3FAN A;  4QQ4 A;  2KKY A;  2C2V S;  2HYE D;  1WEE A;  3MHH A;  2FUI A;  2EA6 A;  2LRI C;  2LAU A;  2KR4 A;  2VPD A;  2FUU A;  5K3Q A;  4LKA A;  5B75 A;  2AN6 A;  4LJN A;  3ZPV 1;  4R8P K;  2QIZ A;  2LV9 A;  3VK6 A;  4UI9 B;  1N87 A;  1DVP A;  2M13 A;  3M63 A;  1WIL A;  5KH9 A;  1JM7 A;  1WES A;  2ECI A;  2CSV A;  1MBM A;  4CCG X;  5LKX A;  2BAY A;  4YC9 A;  4GNE A;  4F1P A;  5B79 A;  3SUB A;  1V87 A;  2MKE A;  5G04 B;  4ZUX U;  3EB5 A;  3T6R A;  1FBV A;  2YYR A;  5LCW B;  2K17 A;  2VPB A;  3L11 A;  5J3X A;  5TDW A;  3N9M A;  2JRJ A;  4OGC A;  4A0C D;  3PUR A;  2ECV A;  4L7X A;  4CA1 A;  4WZ0 A;  3U5N A;  2FFW A;  2XP0 A;  2L80 A;  4C9Z A;  3KV6 A;  5H1V A;  4UP0 A;  2YW8 A;  2DX8 A;  2DSM A;  2CT2 A;  3ZVZ B;  4AVX A;  1WEQ A;  2YVR A;  3SHB A;  1WE9 A;  2ECT A;  2VJE B;  2KKX A;  5B76 A;  2KFT A;  5SVI B;  3N9P A;  2FD4 A;  4H9D A;  2ECJ A;  2L75 A;  3O70 A;  3KV5 A;  5D1M B;  4WA6 A;  3V43 A;  1JOC A;  2XEU A;  2L5U A;  2CKL A;  4WZ2 A;  3FM8 C;  5C13 A;  4PPE A;  1JM7 B;  2JM3 A;  4GB0 A;  2G43 A;  1Z2Q A;  4FIP A;  2CSY A;  4R7E A;  2EOD A;  2VPE A;  2HDP A;  3NG2 A;  1VD4 A;  1E4U A;  2NAA A;  2KRE A;  2ECW A;  4YBM A;  3O47 A;  3T9K A;  4MVT A;  2LGG A;  3PUQ A;  3HTK C;  4IC3 A;  3KQI A;  2VPG A;  1FP0 A;  4MSX A;  3ZVY A;  2VJF A;  2VP7 A;  5LKZ A;  1HYI A;  2YSM A;  2CSZ A;  3HCS A;  4NN2 A;  1WEM A;  2YU4 A;  3O35 A;  3M7K A;  2G45 A;  3GL6 A;  2I50 A;  2RI7 A;  3N9N A;  4GND A;  3SOX A;  4TKP B;  4FJC A;  5D1K B;  2RR4 A;  5H9M A;  2KGG A;  2OWA A;  2YUC A;  1MM2 A;  2PNX A;  2CON A;  2JUN A;  2D8U A; 
#chains in the Genus database with same CATH homology
 4YAT A;  2EGP A;  3HCU A;  4QF3 A;  2JMI A;  2Y43 A;  3U5M A;  2Y1N A;  3LQH A;  2M6M A;  4AYC A;  2H0D B;  2F6N A;  2RSD A;  2PUY A;  2KYU A;  2ZET C;  5G0F A;  2F6J A;  1WFK A;  4V3L C;  5LKU A;  2KWO A;  2YQM A;  3GV4 A;  5B8D A;  4W4U A;  4IC2 A;  3FL2 A;  4YBS A;  5C11 A;  2YUR A;  1XWH A;  4LK9 A;  3N9L A;  4O64 A;  4LLB A;  4X3G A;  3I2D A;  3U5P A;  5DIN A;  2UZG A;  3M62 A;  4AUQ B;  1K2F A;  5EYA F;  2K16 A;  2OXQ C;  1BOR A;  3N9O A;  2C2L A;  2MD7 B;  4FO9 A;  4BHW A;  2LDR A;  2KU3 A;  2E6S A;  4Q6F A;  4R2Y A;  2E6R A;  2K1J A;  1CHC A;  1VYX A;  3ASL A;  3LQJ A;  3QZV A;  4AYC B;  4GNG A;  4S3O C;  3C6W A;  5TAB A;  1U6G B;  3RTR B;  4B7Y C;  2L0B A;  3MHS A;  4A4C A;  1HYJ A;  3U5O A;  2LGL A;  4I7B A;  4FK5 A;  3HCT A;  2MNZ A;  1WEP A;  3LQI A;  3ZPV E;  1WEV A;  3PHD A;  2ECN A;  5TRB A;  4AP4 A;  3SOU A;  2Y1M A;  5KH7 A;  4N4F A;  5TBN A;  2LXP C;  3SOW A;  5B77 A;  1WEW A;  2MA5 A;  2MIQ A;  2QIC A;  4YAD A;  2G6Q A;  3DQV R;  2VJE A;  3O37 A;  2KWK A;  2YRE A;  2CKL B;  4A4B A;  2FSA A;  2MT5 A;  3L1X A;  3IHP A;  3KNV A;  4I7D A;  2M3H A;  4S3O B;  1WEN A;  4I7C A;  1ZBD B;  2YSJ A;  5TDR A;  4UP5 A;  5H1T A;  3ZTG A;  4PTB A;  5FEY A;  2MUM A;  4LAD B;  4F52 B;  2LXH C;  2ECG A;  2LGK A;  5FER A;  4ZQL A;  3O34 A;  2YHN A;  3RPG C;  2VJF B;  1X4I A;  4B86 C;  3M99 A;  5D1L B;  5FB1 A;  2LQ6 A;  3ZNI A;  1LDJ B;  4L58 A;  1VFY A;  1WEO A;  5FB0 A;  5DKA A;  2KWJ A;  3O33 A;  4YBT A;  1Z60 A;  2XB1 A;  2YT5 A;  4A49 A;  4ZDT A;  3LRQ A;  1F62 A;  4YAB A;  5B78 A;  5AIT A;  1IYM A;  3O7A A;  2KE1 A;  2IDA A;  2LGV A;  4XI1 A;  4BBQ A;  1WIM A;  4N3W A;  3N9Q A;  2D8S A;  1X4J A;  2KGI A;  3ZYQ A;  3O36 A;  1MM3 A;  2LN0 A;  2M85 A;  2JMJ A;  2YHO A;  5AIU A;  1Z6U A;  2QJ0 A;  5LKT A;  3T7L A;  3C5K A;  3RPG B;  4QF2 A;  1G25 A;  2JMD A;  5JG6 A;  2L43 A;  2MNY A;  2YQL A;  3EB6 A;  2F42 A;  2H0D A;  4P5O B;  2KIZ A;  4V3K C;  2MD8 C;  5G05 B;  1WGM A;  1X4U A;  5H1U A;  2K4D A;  5KH3 A;  3L1Z B;  4YAX A;  1T1H A;  4GNF A;  1LDK C;  1WEU A;  2VNF A;  2MA6 A;  3DPL R;  4WZ3 B;  5I3L A;  1RMD A;  2KWN A;  2M1R A;  2C2V S;  2HYE D;  1WEE A;  3MHH A;  2FUI A;  2EA6 A;  2LRI C;  2KR4 A;  2VPD A;  2FUU A;  4LKA A;  5B75 A;  2AN6 A;  4LJN A;  3ZPV 1;  4R8P K;  2QIZ A;  2LV9 A;  3VK6 A;  4UI9 B;  1N87 A;  1DVP A;  3M63 A;  1WIL A;  5KH9 A;  1JM7 A;  1WES A;  2ECI A;  4CCG X;  5LKX A;  2BAY A;  4YC9 A;  4GNE A;  5B79 A;  1V87 A;  5G04 B;  4ZUX U;  3EB5 A;  3T6R A;  1FBV A;  2YYR A;  5LCW B;  2K17 A;  2VPB A;  3L11 A;  5J3X A;  5TDW A;  3N9M A;  2JRJ A;  4A0C D;  3PUR A;  2ECV A;  4L7X A;  4CA1 A;  4WZ0 A;  3U5N A;  2L80 A;  4C9Z A;  3KV6 A;  5H1V A;  4UP0 A;  2YW8 A;  2DX8 A;  2CT2 A;  3ZVZ B;  4AVX A;  1WEQ A;  3SHB A;  1WE9 A;  2ECT A;  2VJE B;  5B76 A;  2KFT A;  3N9P A;  2ECJ A;  2L75 A;  3O70 A;  3KV5 A;  5D1M B;  4WA6 A;  3V43 A;  1JOC A;  2XEU A;  2L5U A;  2CKL A;  4WZ2 A;  5C13 A;  4PPE A;  1JM7 B;  4GB0 A;  2G43 A;  1Z2Q A;  4FIP A;  2CSY A;  2EOD A;  4R7E A;  2VPE A;  2HDP A;  3NG2 A;  1VD4 A;  1E4U A;  2NAA A;  2KRE A;  2ECW A;  4YBM A;  4MVT A;  2LGG A;  3PUQ A;  3HTK C;  4IC3 A;  3KQI A;  2VPG A;  1FP0 A;  4MSX A;  3ZVY A;  2VJF A;  2VP7 A;  5LKZ A;  1HYI A;  2YSM A;  2CSZ A;  3HCS A;  4NN2 A;  1WEM A;  2YU4 A;  3O35 A;  2G45 A;  3GL6 A;  2I50 A;  2RI7 A;  3N9N A;  4GND A;  3SOX A;  4TKP B;  4FJC A;  5D1K B;  5H9M A;  2KGG A;  2YUC A;  1MM2 A;  2PNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...