3ZPVE

Crystal structure of drosophila pygo phd finger in complex with legless hd1 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
AAMAIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evolutionary Adaptation of the Fly Pygo Phd Finger Towards Recognizing Histone H3 Tail Methylated at Arginine 2
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords PROTEIN BCL9 HOMOLOG
total genus 11
structure length 62
sequence length 62
chains with identical sequence O, Y
ec nomenclature
pdb deposition date 2013-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zpvE00
2ECVA 4F52B 5TABA 4YC9A 4LK9A 5LKUA 4N3WA 4A0CD 3ZVZB 2VJFB 1WEWA 5H9MA 2OXQC 1WGMA 3N9MA 1WEEA 4I7BA 3O35A 4C9ZA 2LGVA 3LRQA 3L1XA 3ZPV1 3KNVA 4GNDA 3GV4A 4AYCA 3U5PA 4FJCA 3PUQA 2VPBA 1F62A 2ECJA 2YHNA 4YBMA 3GL6A 5G05B 5KH9A 4WZ3B 1FBVA 2L0BA 5FB1A 2LDRA 5EYAF 4S3OB 2KREA 2HYED 3C5KA 3ASLA 1HYIA 1Z2QA 5KH3A 3U5OA 4B7YC 2MD7B 2M1RA 2KWKA 5JG6A 1T1HA 2ECGA 2MNZA 2M3HA 2YU4A 1LDJB 1VD4A 2VJEA 4BBQA 5I3LA 4GNGA 1WEMA 4WZ2A 4AP4A 5C11A 4ZQLA 1MM3A 3PHDA 2IDAA 3ZYQA 3IHPA 4UP5A 2LN0A 5D1LB 5H1UA 1X4JA 2UZGA 3SOWA 1X4UA 2G6QA 3DQVR 3T7LA 1G25A 1WEQA 5B78A 4QF2A 4UI9B 5TDWA 2K17A 3ZPVE 2KWOA 5B76A 1WFKA 2YSMA 2YW8A 1WILA 2QJ0A 1WENA 2MA5A 3SOXA 3U5MA 2Y1MA 5H1TA 3N9PA 4YABA 3O34A 2JMJA 1Z60A 3RTRB 1RMDA 2HDPA 3O36A 2FSAA 2ECIA 1X4IA 2FUIA 3T6RA 2E6SA 2MIQA 2KU3A 3PURA 3SHBA 5C13A 2EA6A 1LDKC 4LKAA 3ZNIA 4N4FA 1XWHA 2H0DB 2EODA 4V3KC 2XB1A 2D8SA 1ZBDB 5G04B 4MSXA 4AUQB 3LQIA 4QF3A 4S3OC 2YREA 3HCSA 4BHWA 3O37A 5LCWB 5KH7A 1U6GB 3QZVA 2MA6A 3N9NA 3L11A 2KR4A 1WESA 2YURA 3EB6A 3MHHA 2QIZA 3V43A 5FEYA 2VJFA 2KGIA 2LXHC 2LQ6A 3LQJA 3I2DA 1JM7B 2L80A 2KFTA 5B79A 2VPEA 4I7DA 5DKAA 4UP0A 4R8PK 3M99A 2YYRA 2CKLA 2VP7A 1MM2A 2C2VS 2VNFA 3C6WA 4I7CA 4AYCB 4GNEA 2CSZA 3LQHA 5D1MB 2VPGA 4L58A 2MD8C 2CSYA 2ECNA 4FIPA 2LRIC 2JRJA 4YATA 1CHCA 4MVTA 2RI7A 2CT2A 2PNXA 2MUMA 2K4DA 4GB0A 4W4UA 3KQIA 3HCUA 1WEOA 2KE1A 2EGPA 2F6JA 2M6MA 3HCTA 4IC2A 4PPEA 3VK6A 1JOCA 1VFYA 2YSJA 5B77A 5D1KB 4R2YA 2K16A 1WEVA 2ECWA 1V87A 5FERA 1VYXA 2KYUA 1BORA 2LXPC 4LJNA 2JMDA 4YAXA 2E6RA 2K1JA 2AN6A 2NAAA 4YBTA 4PTBA 3EB5A 3N9LA 2KWNA 3KV6A 2CKLB 2YT5A 3ZVYA 3DPLR 5J3XA 2LV9A 4A4BA 4A4CA 5B8DA 2PUYA 1WEUA 2DX8A 5AITA 4FO9A 4XI1A 1E4UA 2BAYA 2LGKA 4GNFA 1IYMA 3NG2A 5TBNA 2Y1NA 2L43A 5AIUA 3O33A 1WE9A 1FP0A 5LKXA 2JMIA 1WEPA 2YQLA 4TKPB 3U5NA 2Y43A 2KWJA 3O70A 4LADB 2KIZA 2VPDA 4YADA 2C2LA 2YUCA 3RPGC 2YQMA 2RSDA 2QICA 2MT5A 3O7AA 2H0DA 4CA1A 1HYJA 2MNYA 1DVPA 1WIMA 3HTKC 3M63A 2I50A 3ZTGA 2ECTA 4YBSA 3N9OA 4Q6FA 4ZUXU 2KGGA 5FB0A 4B86C 4L7XA 4WZ0A 2YHOA 5G0FA 4X3GA 3FL2A 4IC3A 4V3LC 4P5OB 1N87A 2FUUA 2L75A 4O64A 4CCGX 5DINA 5B75A 3KV5A 1JM7A 4FK5A 3RPGB 5H1VA 2ZETC 5LKZA 2LGGA 1Z6UA 4ZDTA 4AVXA 5TDRA 3L1ZB 4NN2A 4LLBA 4WA6A 3N9QA 3M62A 2LGLA 2XEUA 2G45A 3MHSA 2F6NA 4A49A 2M85A 4R7EA 2F42A 2L5UA 2G43A 2VJEB 1K2FA 3SOUA 5TRBA 5LKTA
chains in the Genus database with same CATH superfamily
2ECVA 4F1PA 4F52B 5TABA 4YC9A 2KKXA 4LK9A 5LKUA 4N3WA 4A0CD 2B0OE 3ZVZB 2VJFB 1WEWA 5H9MA 2OXQC 2P57A 3N9MA 1WGMA 1WEEA 4I7BA 3T9KA 3O35A 4C9ZA 2IQJA 2LGVA 3LRQA 3L1XA 3ZPV1 3M7KA 3KNVA 4GNDA 2E61A 3GV4A 4AYCA 3U5PA 3LDYA 4FJCA 2FFWA 3PUQA 2VPBA 4O62A 1F62A 3Q1DA 2ECJA 2YHNA 4YBMA 3GL6A 5G05B 5KH9A 4WZ3B 1FBVA 2L0BA 5FB1A 2LDRA 5EYAF 4S3OB 2KREA 3FANA 2HYED 3C5KA 3ASLA 1HYIA 1Z2QA 5KH3A 3U5OA 4B7YC 2MD7B 2M1RA 2KWKA 5JG6A 1T1HA 2ECGA 2MNZA 2M3HA 2YU4A 1LDJB 1VD4A 2VJEA 4BBQA 5I3LA 4GNGA 1WEMA 4WZ2A 4AP4A 5C11A 4ZQLA 1MM3A 3FEHA 3PHDA 2IDAA 3ZYQA 3IHPA 4UP5A 2LN0A 5D1LB 5H1UA 1X4JA 2UZGA 3SUBA 3SOWA 1X4UA 4H9DA 2G6QA 3DQVR 3H7HA 3LVQE 3T7LA 1G25A 1WEQA 5B78A 4QF2A 4UI9B 5TDWA 2K17A 3ZPVE 2KWOA 5B76A 1WFKA 2YSMA 2YW8A 1WILA 2QJ0A 2XOYA 1WENA 2MA5A 3SOXA 3KDEC 3U5MA 2JUNA 2Y1MA 5H1TA 3N9PA 2DJAA 4YABA 3O34A 3E2DA 2JMJA 1Z60A 3RTRB 1RMDA 2HDPA 3O36A 2FSAA 2ECIA 1X4IA 2FUIA 3T6RA 2E6SA 2MIQA 2KU3A 3DDTA 3PURA 3SHBA 5C13A 2EA6A 1LDKC 4LKAA 3ZNIA 2CSVA 4N4FA 1XWHA 2H0DB 2EODA 2JM3A 4V3KC 2M13A 2XB1A 2D8SA 2CRRA 2EXUA 2MKEA 1ZBDB 5G04B 4MSXA 4AUQB 3LQIA 4QF3A 4S3OC 2YREA 3HCSA 4BHWA 3O37A 5LCWB 5KH7A 1U6GB 2YVRA 3QZVA 2MA6A 3N9NA 3L11A 2RR4A 2KR4A 1WESA 2YURA 3EB6A 3MHHA 2QIZA 3V43A 5FEYA 2VJFA 2KGIA 2LXHC 2XOCA 2LQ6A 3LQJA 3I2DA 1JM7B 2L80A 2KFTA 5B79A 2VPEA 4I7DA 5DKAA 4UP0A 4R8PK 3M99A 2YYRA 2CKLA 2VP7A 1MM2A 2C2VS 2VNFA 3C6WA 4I7CA 2CONA 4AYCB 4GNEA 4Z0OA 2CSZA 3LQHA 5D1MB 2VPGA 4L58A 2MD8C 5SVIA 2CSYA 2ECNA 4FIPA 2LRIC 2JRJA 4YATA 1CHCA 4MVTA 2RI7A 2CT2A 2PNXA 2MUMA 2K4DA 4GB0A 4W4UA 3KQIA 3HCUA 1WEOA 2KE1A 2EGPA 2F6JA 2M6MA 3HCTA 4IC2A 4PPEA 3FJUB 3VK6A 1JOCA 2KKYA 3O47A 1VFYA 2YSJA 5B77A 5D1KB 4R2YA 2K16A 1WEVA 2ECWA 1V87A 5FERA 1VYXA 2KYUA 1BORA 2LXPC 4LJNA 2JMDA 4YAXA 2D8UA 4QQ4A 2XOZA 2E6RA 2K1JA 2AN6A 2NAAA 4YBTA 4PTBA 3EB5A 3N9LA 2KWNA 3KV6A 2CKLB 3LJUX 2YT5A 2EGMA 3ZVYA 3DPLR 5J3XA 2LV9A 4A4BA 4A4CA 5B8DA 2PUYA 5K3QA 1WEUA 2DX8A 2L7PA 5AITA 4FO9A 4XI1A 1E4UA 2BAYA 2LGKA 4GNFA 1IYMA 3NG2A 5TBNA 2Y1NA 2L43A 5AIUA 3O33A 1WE9A 1FP0A 5LKXA 2JMIA 1WEPA 2YQLA 4TKPB 3U5NA 2Y43A 2KWJA 3O70A 4LADB 2KIZA 2VPDA 4YADA 2C2LA 2YUCA 3RPGC 2FD4A 2YQMA 2RSDA 2QICA 2MT5A 3O7AA 2H0DA 4Z0RA 4CA1A 3FM8C 1HYJA 2MNYA 1DVPA 1WIMA 3DWDA 3HTKC 2XP0A 3M63A 1MBMA 2I50A 3ZTGA 2ECTA 2OWAA 4YBSA 3N9OA 4Q6FA 4ZUXU 4OGCA 2DSMA 2KGGA 5FB0A 4B86C 4L7XA 5SVYA 4WZ0A 1DCQA 2YHOA 5G0FA 4X3GA 3FL2A 4IC3A 2LAUA 2CRWA 4OGEA 4V3LC 4P5OB 1N87A 2FUUA 2L75A 4O64A 4CCGX 5DINA 3JUEA 5B75A 3KV5A 1JM7A 4FK5A 3RPGB 3FAOA 3LVRE 5H1VA 2ZETC 5LKZA 2LGGA 1Z6UA 4ZDTA 4AVXA 5TDRA 3L1ZB 4NN2A 4LLBA 4WA6A 3N9QA 3M62A 2LGLA 2XEUA 5SVIB 2G45A 3MHSA 2F6NA 4A49A 2M85A 4R7EA 2F42A 2L5UA 3MDBC 3PLWA 2G43A 5SVXA 2VJEB 1K2FA 3SOUA 5TRBA 5LKTA
chains in the Genus database with same CATH topology
2ECVA 4F52B 5TABA 4YC9A 4LK9A 5LKUA 4N3WA 4A0CD 3ZVZB 2VJFB 1WEWA 5H9MA 2OXQC 1WGMA 3N9MA 1WEEA 4I7BA 3O35A 4C9ZA 2LGVA 3LRQA 3L1XA 3ZPV1 3KNVA 4GNDA 3GV4A 4AYCA 3U5PA 4FJCA 3PUQA 2VPBA 1F62A 2ECJA 2YHNA 4YBMA 3GL6A 5G05B 5KH9A 4WZ3B 1FBVA 2L0BA 5FB1A 2LDRA 5EYAF 4S3OB 2KREA 2HYED 3C5KA 3ASLA 1HYIA 1Z2QA 5KH3A 3U5OA 4B7YC 2MD7B 2M1RA 2KWKA 5JG6A 1T1HA 2ECGA 2MNZA 2M3HA 2YU4A 1LDJB 1VD4A 2VJEA 4BBQA 5I3LA 4GNGA 1WEMA 4WZ2A 4AP4A 5C11A 4ZQLA 1MM3A 3PHDA 2IDAA 3ZYQA 3IHPA 4UP5A 2LN0A 5D1LB 5H1UA 1X4JA 2UZGA 3SOWA 1X4UA 2G6QA 3DQVR 3T7LA 1G25A 1WEQA 5B78A 4QF2A 4UI9B 5TDWA 2K17A 3ZPVE 2KWOA 5B76A 1WFKA 2YSMA 2YW8A 1WILA 2QJ0A 1WENA 2MA5A 3SOXA 3U5MA 2Y1MA 5H1TA 3N9PA 4YABA 3O34A 2JMJA 1Z60A 3RTRB 1RMDA 2HDPA 3O36A 2FSAA 2ECIA 1X4IA 2FUIA 3T6RA 2E6SA 2MIQA 2KU3A 3PURA 3SHBA 5C13A 2EA6A 1LDKC 4LKAA 3ZNIA 4N4FA 1XWHA 2H0DB 2EODA 4V3KC 2XB1A 2D8SA 1ZBDB 5G04B 4MSXA 4AUQB 3LQIA 4QF3A 4S3OC 2YREA 3HCSA 4BHWA 3O37A 5LCWB 5KH7A 1U6GB 3QZVA 2MA6A 3N9NA 3L11A 2KR4A 1WESA 2YURA 3EB6A 3MHHA 2QIZA 3V43A 5FEYA 2VJFA 2KGIA 2LXHC 2LQ6A 3LQJA 3I2DA 1JM7B 2L80A 2KFTA 5B79A 2VPEA 4I7DA 5DKAA 4UP0A 4R8PK 3M99A 2YYRA 2CKLA 2VP7A 1MM2A 2C2VS 2VNFA 3C6WA 4I7CA 4AYCB 4GNEA 2CSZA 3LQHA 5D1MB 2VPGA 4L58A 2MD8C 2CSYA 2ECNA 4FIPA 2LRIC 2JRJA 4YATA 1CHCA 4MVTA 2RI7A 2CT2A 2PNXA 2MUMA 2K4DA 4GB0A 4W4UA 3KQIA 3HCUA 1WEOA 2KE1A 2EGPA 2F6JA 2M6MA 3HCTA 4IC2A 4PPEA 3VK6A 1JOCA 1VFYA 2YSJA 5B77A 5D1KB 4R2YA 2K16A 1WEVA 2ECWA 1V87A 5FERA 1VYXA 2KYUA 1BORA 2LXPC 4LJNA 2JMDA 4YAXA 2E6RA 2K1JA 2AN6A 2NAAA 4YBTA 4PTBA 3EB5A 3N9LA 2KWNA 3KV6A 2CKLB 2YT5A 3ZVYA 3DPLR 5J3XA 2LV9A 4A4BA 4A4CA 5B8DA 2PUYA 1WEUA 2DX8A 5AITA 4FO9A 4XI1A 1E4UA 2BAYA 2LGKA 4GNFA 1IYMA 3NG2A 5TBNA 2Y1NA 2L43A 5AIUA 3O33A 1WE9A 1FP0A 5LKXA 2JMIA 1WEPA 2YQLA 4TKPB 3U5NA 2Y43A 2KWJA 3O70A 4LADB 2KIZA 2VPDA 4YADA 2C2LA 2YUCA 3RPGC 2YQMA 2RSDA 2QICA 2MT5A 3O7AA 2H0DA 4CA1A 1HYJA 2MNYA 1DVPA 1WIMA 3HTKC 3M63A 2I50A 3ZTGA 2ECTA 4YBSA 3N9OA 4Q6FA 4ZUXU 2KGGA 5FB0A 4B86C 4L7XA 4WZ0A 2YHOA 5G0FA 4X3GA 3FL2A 4IC3A 4V3LC 4P5OB 1N87A 2FUUA 2L75A 4O64A 4CCGX 5DINA 5B75A 3KV5A 1JM7A 4FK5A 3RPGB 5H1VA 2ZETC 5LKZA 2LGGA 1Z6UA 4ZDTA 4AVXA 5TDRA 3L1ZB 4NN2A 4LLBA 4WA6A 3N9QA 3M62A 2LGLA 2XEUA 2G45A 3MHSA 2F6NA 4A49A 2M85A 4R7EA 2F42A 2L5UA 2G43A 2VJEB 1K2FA 3SOUA 5TRBA 5LKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECV A;  4F52 B;  5TAB A;  4YC9 A;  4LK9 A;  5LKU A;  4N3W A;  4A0C D;  3ZVZ B;  2VJF B;  1WEW A;  5H9M A;  2OXQ C;  1WGM A;  3N9M A;  1WEE A;  4I7B A;  3O35 A;  4C9Z A;  2LGV A;  3LRQ A;  3L1X A;  3ZPV 1;  3KNV A;  4GND A;  3GV4 A;  4AYC A;  3U5P A;  4FJC A;  3PUQ A;  2VPB A;  1F62 A;  2ECJ A;  2YHN A;  4YBM A;  3GL6 A;  5G05 B;  5KH9 A;  4WZ3 B;  1FBV A;  2L0B A;  5FB1 A;  2LDR A;  5EYA F;  4S3O B;  2KRE A;  2HYE D;  3C5K A;  3ASL A;  1HYI A;  1Z2Q A;  5KH3 A;  3U5O A;  4B7Y C;  2MD7 B;  2M1R A;  2KWK A;  5JG6 A;  1T1H A;  2ECG A;  2MNZ A;  2M3H A;  2YU4 A;  1LDJ B;  1VD4 A;  2VJE A;  4BBQ A;  5I3L A;  4GNG A;  1WEM A;  4WZ2 A;  4AP4 A;  5C11 A;  4ZQL A;  1MM3 A;  3PHD A;  2IDA A;  3ZYQ A;  3IHP A;  4UP5 A;  2LN0 A;  5D1L B;  5H1U A;  1X4J A;  2UZG A;  3SOW A;  1X4U A;  2G6Q A;  3DQV R;  3T7L A;  1G25 A;  1WEQ A;  5B78 A;  4QF2 A;  4UI9 B;  5TDW A;  2K17 A;  3ZPV E;  2KWO A;  5B76 A;  1WFK A;  2YSM A;  2YW8 A;  1WIL A;  2QJ0 A;  1WEN A;  2MA5 A;  3SOX A;  3U5M A;  2Y1M A;  5H1T A;  3N9P A;  4YAB A;  3O34 A;  2JMJ A;  1Z60 A;  3RTR B;  1RMD A;  2HDP A;  3O36 A;  2FSA A;  2ECI A;  1X4I A;  2FUI A;  3T6R A;  2E6S A;  2MIQ A;  2KU3 A;  3PUR A;  3SHB A;  5C13 A;  2EA6 A;  1LDK C;  4LKA A;  3ZNI A;  4N4F A;  1XWH A;  2H0D B;  2EOD A;  4V3K C;  2XB1 A;  2D8S A;  1ZBD B;  5G04 B;  4MSX A;  4AUQ B;  3LQI A;  4QF3 A;  4S3O C;  2YRE A;  3HCS A;  4BHW A;  3O37 A;  5LCW B;  5KH7 A;  1U6G B;  3QZV A;  2MA6 A;  3N9N A;  3L11 A;  2KR4 A;  1WES A;  2YUR A;  3EB6 A;  3MHH A;  2QIZ A;  3V43 A;  5FEY A;  2VJF A;  2KGI A;  2LXH C;  2LQ6 A;  3LQJ A;  3I2D A;  1JM7 B;  2L80 A;  2KFT A;  5B79 A;  2VPE A;  4I7D A;  5DKA A;  4UP0 A;  4R8P K;  3M99 A;  2YYR A;  2CKL A;  2VP7 A;  1MM2 A;  2C2V S;  2VNF A;  3C6W A;  4I7C A;  4AYC B;  4GNE A;  2CSZ A;  3LQH A;  5D1M B;  2VPG A;  4L58 A;  2MD8 C;  2CSY A;  2ECN A;  4FIP A;  2LRI C;  2JRJ A;  4YAT A;  1CHC A;  4MVT A;  2RI7 A;  2CT2 A;  2PNX A;  2MUM A;  2K4D A;  4GB0 A;  4W4U A;  3KQI A;  3HCU A;  1WEO A;  2KE1 A;  2EGP A;  2F6J A;  2M6M A;  3HCT A;  4IC2 A;  4PPE A;  3VK6 A;  1JOC A;  1VFY A;  2YSJ A;  5B77 A;  5D1K B;  4R2Y A;  2K16 A;  1WEV A;  2ECW A;  1V87 A;  5FER A;  1VYX A;  2KYU A;  1BOR A;  2LXP C;  4LJN A;  2JMD A;  4YAX A;  2E6R A;  2K1J A;  2AN6 A;  2NAA A;  4YBT A;  4PTB A;  3EB5 A;  3N9L A;  2KWN A;  3KV6 A;  2CKL B;  2YT5 A;  3ZVY A;  3DPL R;  5J3X A;  2LV9 A;  4A4B A;  4A4C A;  5B8D A;  2PUY A;  1WEU A;  2DX8 A;  5AIT A;  4FO9 A;  4XI1 A;  1E4U A;  2BAY A;  2LGK A;  4GNF A;  1IYM A;  3NG2 A;  5TBN A;  2Y1N A;  2L43 A;  5AIU A;  3O33 A;  1WE9 A;  1FP0 A;  5LKX A;  2JMI A;  1WEP A;  2YQL A;  4TKP B;  3U5N A;  2Y43 A;  2KWJ A;  3O70 A;  4LAD B;  2KIZ A;  2VPD A;  4YAD A;  2C2L A;  2YUC A;  3RPG C;  2YQM A;  2RSD A;  2QIC A;  2MT5 A;  3O7A A;  2H0D A;  4CA1 A;  1HYJ A;  2MNY A;  1DVP A;  1WIM A;  3HTK C;  3M63 A;  2I50 A;  3ZTG A;  2ECT A;  4YBS A;  3N9O A;  4Q6F A;  4ZUX U;  2KGG A;  5FB0 A;  4B86 C;  4L7X A;  4WZ0 A;  2YHO A;  5G0F A;  4X3G A;  3FL2 A;  4IC3 A;  4V3L C;  4P5O B;  1N87 A;  2FUU A;  2L75 A;  4O64 A;  4CCG X;  5DIN A;  5B75 A;  3KV5 A;  1JM7 A;  4FK5 A;  3RPG B;  5H1V A;  2ZET C;  5LKZ A;  2LGG A;  1Z6U A;  4ZDT A;  4AVX A;  5TDR A;  3L1Z B;  4NN2 A;  4LLB A;  4WA6 A;  3N9Q A;  3M62 A;  2LGL A;  2XEU A;  2G45 A;  3MHS A;  2F6N A;  4A49 A;  2M85 A;  4R7E A;  2F42 A;  2L5U A;  2G43 A;  2VJE B;  1K2F A;  3SOU A;  5TRB A;  5LKT A; 
#chains in the Genus database with same CATH topology
 2ECV A;  4F1P A;  4F52 B;  5TAB A;  4YC9 A;  2KKX A;  4LK9 A;  5LKU A;  4N3W A;  4A0C D;  2B0O E;  3ZVZ B;  2VJF B;  1WEW A;  5H9M A;  2OXQ C;  2P57 A;  3N9M A;  1WGM A;  1WEE A;  4I7B A;  3T9K A;  3O35 A;  4C9Z A;  2IQJ A;  2LGV A;  3LRQ A;  3L1X A;  3ZPV 1;  3M7K A;  3KNV A;  4GND A;  2E61 A;  3GV4 A;  4AYC A;  3U5P A;  3LDY A;  4FJC A;  2FFW A;  3PUQ A;  2VPB A;  4O62 A;  1F62 A;  3Q1D A;  2ECJ A;  2YHN A;  4YBM A;  3GL6 A;  5G05 B;  5KH9 A;  4WZ3 B;  1FBV A;  2L0B A;  5FB1 A;  2LDR A;  5EYA F;  4S3O B;  2KRE A;  3FAN A;  2HYE D;  3C5K A;  3ASL A;  1HYI A;  1Z2Q A;  5KH3 A;  3U5O A;  4B7Y C;  2MD7 B;  2M1R A;  2KWK A;  5JG6 A;  1T1H A;  2ECG A;  2MNZ A;  2M3H A;  2YU4 A;  1LDJ B;  1VD4 A;  2VJE A;  4BBQ A;  5I3L A;  4GNG A;  1WEM A;  4WZ2 A;  4AP4 A;  5C11 A;  4ZQL A;  1MM3 A;  3FEH A;  3PHD A;  2IDA A;  3ZYQ A;  3IHP A;  4UP5 A;  2LN0 A;  5D1L B;  5H1U A;  1X4J A;  2UZG A;  3SUB A;  3SOW A;  1X4U A;  4H9D A;  2G6Q A;  3DQV R;  3H7H A;  3LVQ E;  3T7L A;  1G25 A;  1WEQ A;  5B78 A;  4QF2 A;  4UI9 B;  5TDW A;  2K17 A;  3ZPV E;  2KWO A;  5B76 A;  1WFK A;  2YSM A;  2YW8 A;  1WIL A;  2QJ0 A;  2XOY A;  1WEN A;  2MA5 A;  3SOX A;  3KDE C;  3U5M A;  2JUN A;  2Y1M A;  5H1T A;  3N9P A;  2DJA A;  4YAB A;  3O34 A;  3E2D A;  2JMJ A;  1Z60 A;  3RTR B;  1RMD A;  2HDP A;  3O36 A;  2FSA A;  2ECI A;  1X4I A;  2FUI A;  3T6R A;  2E6S A;  2MIQ A;  2KU3 A;  3DDT A;  3PUR A;  3SHB A;  5C13 A;  2EA6 A;  1LDK C;  4LKA A;  3ZNI A;  2CSV A;  4N4F A;  1XWH A;  2H0D B;  2EOD A;  2JM3 A;  4V3K C;  2M13 A;  2XB1 A;  2D8S A;  2CRR A;  2EXU A;  2MKE A;  1ZBD B;  5G04 B;  4MSX A;  4AUQ B;  3LQI A;  4QF3 A;  4S3O C;  2YRE A;  3HCS A;  4BHW A;  3O37 A;  5LCW B;  5KH7 A;  1U6G B;  2YVR A;  3QZV A;  2MA6 A;  3N9N A;  3L11 A;  2RR4 A;  2KR4 A;  1WES A;  2YUR A;  3EB6 A;  3MHH A;  2QIZ A;  3V43 A;  5FEY A;  2VJF A;  2KGI A;  2LXH C;  2XOC A;  2LQ6 A;  3LQJ A;  3I2D A;  1JM7 B;  2L80 A;  2KFT A;  5B79 A;  2VPE A;  4I7D A;  5DKA A;  4UP0 A;  4R8P K;  3M99 A;  2YYR A;  2CKL A;  2VP7 A;  1MM2 A;  2C2V S;  2VNF A;  3C6W A;  4I7C A;  2CON A;  4AYC B;  4GNE A;  4Z0O A;  2CSZ A;  3LQH A;  5D1M B;  2VPG A;  4L58 A;  2MD8 C;  5SVI A;  2CSY A;  2ECN A;  4FIP A;  2LRI C;  2JRJ A;  4YAT A;  1CHC A;  4MVT A;  2RI7 A;  2CT2 A;  2PNX A;  2MUM A;  2K4D A;  4GB0 A;  4W4U A;  3KQI A;  3HCU A;  1WEO A;  2KE1 A;  2EGP A;  2F6J A;  2M6M A;  3HCT A;  4IC2 A;  4PPE A;  3FJU B;  3VK6 A;  1JOC A;  2KKY A;  3O47 A;  1VFY A;  2YSJ A;  5B77 A;  5D1K B;  4R2Y A;  2K16 A;  1WEV A;  2ECW A;  1V87 A;  5FER A;  1VYX A;  2KYU A;  1BOR A;  2LXP C;  4LJN A;  2JMD A;  4YAX A;  2D8U A;  4QQ4 A;  2XOZ A;  2E6R A;  2K1J A;  2AN6 A;  2NAA A;  4YBT A;  4PTB A;  3EB5 A;  3N9L A;  2KWN A;  3KV6 A;  2CKL B;  3LJU X;  2YT5 A;  2EGM A;  3ZVY A;  3DPL R;  5J3X A;  2LV9 A;  4A4B A;  4A4C A;  5B8D A;  2PUY A;  5K3Q A;  1WEU A;  2DX8 A;  2L7P A;  5AIT A;  4FO9 A;  4XI1 A;  1E4U A;  2BAY A;  2LGK A;  4GNF A;  1IYM A;  3NG2 A;  5TBN A;  2Y1N A;  2L43 A;  5AIU A;  3O33 A;  1WE9 A;  1FP0 A;  5LKX A;  2JMI A;  1WEP A;  2YQL A;  4TKP B;  3U5N A;  2Y43 A;  2KWJ A;  3O70 A;  4LAD B;  2KIZ A;  2VPD A;  4YAD A;  2C2L A;  2YUC A;  3RPG C;  2FD4 A;  2YQM A;  2RSD A;  2QIC A;  2MT5 A;  3O7A A;  2H0D A;  4Z0R A;  4CA1 A;  3FM8 C;  1HYJ A;  2MNY A;  1DVP A;  1WIM A;  3DWD A;  3HTK C;  2XP0 A;  3M63 A;  1MBM A;  2I50 A;  3ZTG A;  2ECT A;  2OWA A;  4YBS A;  3N9O A;  4Q6F A;  4ZUX U;  4OGC A;  2DSM A;  2KGG A;  5FB0 A;  4B86 C;  4L7X A;  5SVY A;  4WZ0 A;  1DCQ A;  2YHO A;  5G0F A;  4X3G A;  3FL2 A;  4IC3 A;  2LAU A;  2CRW A;  4OGE A;  4V3L C;  4P5O B;  1N87 A;  2FUU A;  2L75 A;  4O64 A;  4CCG X;  5DIN A;  3JUE A;  5B75 A;  3KV5 A;  1JM7 A;  4FK5 A;  3RPG B;  3FAO A;  3LVR E;  5H1V A;  2ZET C;  5LKZ A;  2LGG A;  1Z6U A;  4ZDT A;  4AVX A;  5TDR A;  3L1Z B;  4NN2 A;  4LLB A;  4WA6 A;  3N9Q A;  3M62 A;  2LGL A;  2XEU A;  5SVI B;  2G45 A;  3MHS A;  2F6N A;  4A49 A;  2M85 A;  4R7E A;  2F42 A;  2L5U A;  3MDB C;  3PLW A;  2G43 A;  5SVX A;  2VJE B;  1K2F A;  3SOU A;  5TRB A;  5LKT A; 
#chains in the Genus database with same CATH homology
 2ECV A;  4F52 B;  5TAB A;  4YC9 A;  4LK9 A;  5LKU A;  4N3W A;  4A0C D;  3ZVZ B;  2VJF B;  1WEW A;  5H9M A;  2OXQ C;  1WGM A;  3N9M A;  1WEE A;  4I7B A;  3O35 A;  4C9Z A;  2LGV A;  3LRQ A;  3L1X A;  3ZPV 1;  3KNV A;  4GND A;  3GV4 A;  4AYC A;  3U5P A;  4FJC A;  3PUQ A;  2VPB A;  1F62 A;  2ECJ A;  2YHN A;  4YBM A;  3GL6 A;  5G05 B;  5KH9 A;  4WZ3 B;  1FBV A;  2L0B A;  5FB1 A;  2LDR A;  5EYA F;  4S3O B;  2KRE A;  2HYE D;  3C5K A;  3ASL A;  1HYI A;  1Z2Q A;  5KH3 A;  3U5O A;  4B7Y C;  2MD7 B;  2M1R A;  2KWK A;  5JG6 A;  1T1H A;  2ECG A;  2MNZ A;  2M3H A;  2YU4 A;  1LDJ B;  1VD4 A;  2VJE A;  4BBQ A;  5I3L A;  4GNG A;  1WEM A;  4WZ2 A;  4AP4 A;  5C11 A;  4ZQL A;  1MM3 A;  3PHD A;  2IDA A;  3ZYQ A;  3IHP A;  4UP5 A;  2LN0 A;  5D1L B;  5H1U A;  1X4J A;  2UZG A;  3SOW A;  1X4U A;  2G6Q A;  3DQV R;  3T7L A;  1G25 A;  1WEQ A;  5B78 A;  4QF2 A;  4UI9 B;  5TDW A;  2K17 A;  3ZPV E;  2KWO A;  5B76 A;  1WFK A;  2YSM A;  2YW8 A;  1WIL A;  2QJ0 A;  1WEN A;  2MA5 A;  3SOX A;  3U5M A;  2Y1M A;  5H1T A;  3N9P A;  4YAB A;  3O34 A;  2JMJ A;  1Z60 A;  3RTR B;  1RMD A;  2HDP A;  3O36 A;  2FSA A;  2ECI A;  1X4I A;  2FUI A;  3T6R A;  2E6S A;  2MIQ A;  2KU3 A;  3PUR A;  3SHB A;  5C13 A;  2EA6 A;  1LDK C;  4LKA A;  3ZNI A;  4N4F A;  1XWH A;  2H0D B;  2EOD A;  4V3K C;  2XB1 A;  2D8S A;  1ZBD B;  5G04 B;  4MSX A;  4AUQ B;  3LQI A;  4QF3 A;  4S3O C;  2YRE A;  3HCS A;  4BHW A;  3O37 A;  5LCW B;  5KH7 A;  1U6G B;  3QZV A;  2MA6 A;  3N9N A;  3L11 A;  2KR4 A;  1WES A;  2YUR A;  3EB6 A;  3MHH A;  2QIZ A;  3V43 A;  5FEY A;  2VJF A;  2KGI A;  2LXH C;  2LQ6 A;  3LQJ A;  3I2D A;  1JM7 B;  2L80 A;  2KFT A;  5B79 A;  2VPE A;  4I7D A;  5DKA A;  4UP0 A;  4R8P K;  3M99 A;  2YYR A;  2CKL A;  2VP7 A;  1MM2 A;  2C2V S;  2VNF A;  3C6W A;  4I7C A;  4AYC B;  4GNE A;  2CSZ A;  3LQH A;  5D1M B;  2VPG A;  4L58 A;  2MD8 C;  2CSY A;  2ECN A;  4FIP A;  2LRI C;  2JRJ A;  4YAT A;  1CHC A;  4MVT A;  2RI7 A;  2CT2 A;  2PNX A;  2MUM A;  2K4D A;  4GB0 A;  4W4U A;  3KQI A;  3HCU A;  1WEO A;  2KE1 A;  2EGP A;  2F6J A;  2M6M A;  3HCT A;  4IC2 A;  4PPE A;  3VK6 A;  1JOC A;  1VFY A;  2YSJ A;  5B77 A;  5D1K B;  4R2Y A;  2K16 A;  1WEV A;  2ECW A;  1V87 A;  5FER A;  1VYX A;  2KYU A;  1BOR A;  2LXP C;  4LJN A;  2JMD A;  4YAX A;  2E6R A;  2K1J A;  2AN6 A;  2NAA A;  4YBT A;  4PTB A;  3EB5 A;  3N9L A;  2KWN A;  3KV6 A;  2CKL B;  2YT5 A;  3ZVY A;  3DPL R;  5J3X A;  2LV9 A;  4A4B A;  4A4C A;  5B8D A;  2PUY A;  1WEU A;  2DX8 A;  5AIT A;  4FO9 A;  4XI1 A;  1E4U A;  2BAY A;  2LGK A;  4GNF A;  1IYM A;  3NG2 A;  5TBN A;  2Y1N A;  2L43 A;  5AIU A;  3O33 A;  1WE9 A;  1FP0 A;  5LKX A;  2JMI A;  1WEP A;  2YQL A;  4TKP B;  3U5N A;  2Y43 A;  2KWJ A;  3O70 A;  4LAD B;  2KIZ A;  2VPD A;  4YAD A;  2C2L A;  2YUC A;  3RPG C;  2YQM A;  2RSD A;  2QIC A;  2MT5 A;  3O7A A;  2H0D A;  4CA1 A;  1HYJ A;  2MNY A;  1DVP A;  1WIM A;  3HTK C;  3M63 A;  2I50 A;  3ZTG A;  2ECT A;  4YBS A;  3N9O A;  4Q6F A;  4ZUX U;  2KGG A;  5FB0 A;  4B86 C;  4L7X A;  4WZ0 A;  2YHO A;  5G0F A;  4X3G A;  3FL2 A;  4IC3 A;  4V3L C;  4P5O B;  1N87 A;  2FUU A;  2L75 A;  4O64 A;  4CCG X;  5DIN A;  5B75 A;  3KV5 A;  1JM7 A;  4FK5 A;  3RPG B;  5H1V A;  2ZET C;  5LKZ A;  2LGG A;  1Z6U A;  4ZDT A;  4AVX A;  5TDR A;  3L1Z B;  4NN2 A;  4LLB A;  4WA6 A;  3N9Q A;  3M62 A;  2LGL A;  2XEU A;  2G45 A;  3MHS A;  2F6N A;  4A49 A;  2M85 A;  4R7E A;  2F42 A;  2L5U A;  2G43 A;  2VJE B;  1K2F A;  3SOU A;  5TRB A;  5LKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...