3ZPVE

Crystal structure of drosophila pygo phd finger in complex with legless hd1 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
b'AAMAIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN BCL9 HOMOLOG
publication title Evolutionary Adaptation of the Fly Pygo Phd Finger Towards Recognizing Histone H3 Tail Methylated at Arginine 2
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 11
structure length 62
sequence length 62
chains with identical sequence O, Y
ec nomenclature
pdb deposition date 2013-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zpvE00
2ECJA 4B86C 4AYCA 4FO9A 4YC9A 3C6WA 4C9ZA 3M99A 3ZYQA 4A49A 4YADA 3KV6A 1WIMA 2UZGA 3N9QA 3IHPA 4YAXA 2F6JA 2NAAA 3QZVA 2RI7A 2YT5A 5G05B 5KH3A 5TRBA 4FK5A 2HDPA 2MA6A 2F42A 2VJFA 4YBSA 2ZETC 2C2VS 2QIZA 2PNXA 3SOWA 2CKLA 2K4DA 2YU4A 3DPLR 4A4CA 1JOCA 2FSAA 1FP0A 2KR4A 3C5KA 2YREA 4W4UA 1U6GB 3O35A 3N9OA 4N3WA 4LADB 2BAYA 4QF2A 3GL6A 3KQIA 3SOXA 1ZBDB 2M3HA 1X4UA 5FEYA 2LGVA 2FUIA 2D8SA 1N87A 1LDKC 3ASLA 1FBVA 3EB6A 3HCUA 5D1MB 2YURA 1T1HA 1WEPA 2YSMA 1MM3A 4GNFA 4YATA 1RMDA 2VJEB 4O64A 3U5MA 2LGKA 4CA1A 4I7DA 5G04B 3M63A 2YHNA 4GB0A 5FERA 2KYUA 2QICA 2LXPC 5KH7A 4N4FA 2H0DB 3O33A 4LLBA 3LQHA 1CHCA 2YHOA 4QF3A 2VPEA 4PPEA 3SOUA 2MD8C 5B75A 2JMJA 4BHWA 3DQVR 3RPGC 2I50A 1K2FA 2KWKA 3MHSA 5TDRA 1WEVA 5JG6A 4GNDA 5DINA 1WEUA 3O7AA 2ECIA 4I7CA 5B76A 5TDWA 2LRIC 4X3GA 3KV5A 4AVXA 2G45A 4WZ3B 4CCGX 4R2YA 2L43A 5FB0A 4ZDTA 4LKAA 5AIUA 1Z2QA 2DX8A 5G0FA 4BBQA 1G25A 4FIPA 1VFYA 3KNVA 4LJNA 2EODA 1V87A 2YQMA 1DVPA 3NG2A 4AYCB 4L58A 3RPGB 2YYRA 2IDAA 2XEUA 2LDRA 2LGLA 5H1TA 4MVTA 3PHDA 1BORA 2MNYA 2ECVA 2KIZA 4YBTA 2VP7A 4XI1A 1Z6UA 2L80A 4P5OB 2Y1MA 3VK6A 1WFKA 2LGGA 2ECWA 1F62A 5C13A 2QJ0A 1IYMA 1WGMA 2KWJA 5LKZA 2HYED 5B78A 1WE9A 2KWNA 1JM7A 3V43A 5H9MA 2VJFB 5B77A 1WEMA 2LV9A 4YBMA 3L1ZB 5TABA 4S3OC 2CKLB 2K1JA 3ZNIA 5B8DA 5H1VA 3PUQA 2VPDA 2MUMA 5LKXA 1MM2A 2YQLA 3LRQA 2KREA 3O36A 4NN2A 5D1KB 1Z60A 3HCTA 1WENA 2M1RA 1XWHA 4IC2A 5FB1A 2L0BA 1HYIA 3T6RA 2Y1NA 3ZPVE 4F52B 2K17A 3O70A 2YW8A 4ZUXU 4MSXA 2EGPA 4I7BA 5J3XA 1WILA 2G6QA 3U5NA 2CSZA 2KFTA 2KE1A 2KGGA 2MT5A 2G43A 4FJCA 5TBNA 3L1XA 3PURA 2KGIA 4WZ2A 3RTRB 3LQIA 2PUYA 2E6SA 4GNGA 2M85A 5KH9A 2AN6A 2L5UA 4R8PK 5EYAF 2LXHC 4YABA 3MHHA 2LN0A 2CSYA 2XB1A 2ECNA 4R7EA 4V3LC 1WEWA 4L7XA 3EB5A 1WEEA 2K16A 1WEQA 2JMDA 2M6MA 4ZQLA 4PTBA 1VD4A 2ECTA 2LQ6A 2OXQC 5LKTA 3O37A 3N9LA 4UI9B 5C11A 4LK9A 2RSDA 3U5PA 5LCWB 3N9PA 2VJEA 1HYJA 2F6NA 5I3LA 2YUCA 2MIQA 3ZVZB 3ZVYA 3HTKC 3L11A 4WA6A 2JMIA 3GV4A 1E4UA 2MD7B 2JRJA 4TKPB 1WEOA 3LQJA 2C2LA 2H0DA 5D1LB 3HCSA 2ECGA 2VPGA 4WZ0A 4A0CD 2Y43A 4AP4A 4A4BA 4IC3A 3ZTGA 2MA5A 2VNFA 3I2DA 1WESA 2EA6A 3U5OA 2CT2A 4GNEA 2FUUA 1VYXA 5B79A 2KWOA 4Q6FA 1X4JA 2KU3A 5DKAA 5LKUA 1X4IA 3N9MA 2VPBA 4UP0A 3FL2A 4V3KC 2MNZA 1JM7B 2YSJA 4S3OB 4UP5A 2E6RA 4B7YC 2L75A 5AITA 4AUQB 3O34A 3N9NA 3T7LA 3M62A 3ZPV1 3SHBA 1LDJB 5H1UA
chains in the Genus database with same CATH superfamily
2ECJA 4B86C 4AYCA 4FO9A 4YC9A 2DSMA 3C6WA 3MDBC 2B0OE 2OWAA 4C9ZA 3M99A 1DCQA 3ZYQA 4A49A 4YADA 3KV6A 1WIMA 2UZGA 3N9QA 3IHPA 3FANA 3T9KA 4YAXA 2F6JA 2NAAA 3QZVA 2RI7A 2YT5A 5G05B 5KH3A 5TRBA 4FK5A 2HDPA 2MA6A 2EXUA 2F42A 2VJFA 2P57A 4YBSA 2ZETC 2C2VS 2KKXA 2QIZA 2PNXA 3SOWA 2CKLA 2K4DA 2YU4A 3DPLR 4A4CA 2IQJA 2L7PA 2LAUA 5SVIA 1JOCA 2FSAA 3DDTA 1FP0A 3H7HA 2KR4A 3C5KA 2YREA 4W4UA 1U6GB 3O35A 3N9OA 4N3WA 4LADB 3LDYA 2BAYA 4QF2A 3GL6A 3KQIA 3FJUB 3SOXA 1ZBDB 2M3HA 1X4UA 5FEYA 2LGVA 2FUIA 2D8SA 1N87A 1LDKC 3ASLA 1FBVA 3EB6A 2CONA 3HCUA 5D1MB 2YURA 1T1HA 5K3QA 1WEPA 2YSMA 1MM3A 3FEHA 4GNFA 4YATA 1RMDA 2MKEA 2VJEB 4O64A 3U5MA 2LGKA 4CA1A 4I7DA 3PLWA 4O62A 5G04B 3M63A 2YHNA 4GB0A 5FERA 2KYUA 2QICA 2LXPC 5SVXA 5KH7A 4N4FA 2CRRA 2H0DB 3DWDA 3O33A 2XOYA 4LLBA 3LQHA 1CHCA 2JM3A 3LVRE 3SUBA 2FD4A 2YHOA 4QF3A 2VPEA 4PPEA 3SOUA 2MD8C 5B75A 2JMJA 3Q1DA 4BHWA 3DQVR 3RPGC 2I50A 1K2FA 2KWKA 3MHSA 5TDRA 1WEVA 5JG6A 4GNDA 5DINA 1WEUA 2D8UA 3O7AA 2ECIA 4I7CA 5B76A 5TDWA 2LRIC 4X3GA 3KV5A 4AVXA 2M13A 2G45A 4WZ3B 4CCGX 4R2YA 2L43A 5FB0A 4ZDTA 4LKAA 5AIUA 1Z2QA 3M7KA 2DX8A 5G0FA 4BBQA 1G25A 4FIPA 1VFYA 3KNVA 4LJNA 2EODA 1V87A 2YQMA 1DVPA 2E61A 3NG2A 4AYCB 4L58A 4OGCA 3RPGB 2YYRA 2IDAA 2XEUA 3KDEC 2LDRA 2LGLA 5H1TA 4MVTA 3PHDA 1BORA 2MNYA 2ECVA 2KIZA 4YBTA 2VP7A 4XI1A 1Z6UA 2L80A 4P5OB 2Y1MA 4OGEA 3VK6A 1WFKA 3O47A 2LGGA 2ECWA 1F62A 5C13A 2QJ0A 2YVRA 1IYMA 1WGMA 2KWJA 5LKZA 2HYED 5B78A 1WE9A 2KWNA 4Z0OA 1JM7A 3V43A 5H9MA 2VJFB 5B77A 1WEMA 2LV9A 4YBMA 3L1ZB 5TABA 4S3OC 2CKLB 2K1JA 3ZNIA 5B8DA 5H1VA 3PUQA 2VPDA 2MUMA 2XOZA 3FM8C 5LKXA 1MM2A 2YQLA 3LRQA 2KREA 3O36A 4NN2A 4H9DA 5D1KB 5SVIB 1Z60A 3HCTA 1WENA 2M1RA 1XWHA 4IC2A 5FB1A 2L0BA 2DJAA 1HYIA 3T6RA 2Y1NA 2EGMA 3ZPVE 4F52B 2K17A 3O70A 3JUEA 2YW8A 4ZUXU 4MSXA 2EGPA 4I7BA 5J3XA 1WILA 2G6QA 2JUNA 3U5NA 2CSZA 2KFTA 2KE1A 4Z0RA 2KGGA 3LVQE 2MT5A 2G43A 1MBMA 2KKYA 4FJCA 5TBNA 3L1XA 3PURA 2CSVA 2KGIA 4WZ2A 3RTRB 3LQIA 2PUYA 2E6SA 4GNGA 2M85A 5KH9A 2AN6A 2L5UA 4R8PK 5EYAF 2LXHC 4YABA 3MHHA 2LN0A 2CSYA 2XB1A 2ECNA 4R7EA 4V3LC 1WEWA 4L7XA 3EB5A 1WEEA 2K16A 4F1PA 1WEQA 2JMDA 2CRWA 2M6MA 4ZQLA 4PTBA 1VD4A 2ECTA 2LQ6A 2OXQC 5LKTA 3O37A 3N9LA 4UI9B 5C11A 4LK9A 2RSDA 3U5PA 5LCWB 3N9PA 2VJEA 4QQ4A 1HYJA 2F6NA 5I3LA 3E2DA 2YUCA 2MIQA 3ZVZB 3ZVYA 3HTKC 3L11A 4WA6A 2JMIA 3GV4A 2XOCA 2FFWA 1E4UA 2MD7B 2JRJA 4TKPB 1WEOA 3LQJA 3LJUX 2C2LA 2H0DA 5D1LB 3HCSA 2ECGA 2VPGA 4WZ0A 4A0CD 2RR4A 2Y43A 4AP4A 4A4BA 4IC3A 3ZTGA 2MA5A 2VNFA 3I2DA 1WESA 2EA6A 3U5OA 2CT2A 4GNEA 2FUUA 1VYXA 5B79A 2KWOA 5SVYA 4Q6FA 1X4JA 2KU3A 5DKAA 5LKUA 3FAOA 1X4IA 3N9MA 2VPBA 4UP0A 3FL2A 4V3KC 2MNZA 1JM7B 2YSJA 4S3OB 4UP5A 2E6RA 2XP0A 4B7YC 2L75A 5AITA 4AUQB 3O34A 3N9NA 3T7LA 3M62A 3ZPV1 3SHBA 1LDJB 5H1UA
chains in the Genus database with same CATH topology
2ECJA 4B86C 4AYCA 4FO9A 4YC9A 3C6WA 4C9ZA 3M99A 3ZYQA 4A49A 4YADA 3KV6A 1WIMA 2UZGA 3N9QA 3IHPA 4YAXA 2F6JA 2NAAA 3QZVA 2RI7A 2YT5A 5G05B 5KH3A 5TRBA 4FK5A 2HDPA 2MA6A 2F42A 2VJFA 4YBSA 2ZETC 2C2VS 2QIZA 2PNXA 3SOWA 2CKLA 2K4DA 2YU4A 3DPLR 4A4CA 1JOCA 2FSAA 1FP0A 2KR4A 3C5KA 2YREA 4W4UA 1U6GB 3O35A 3N9OA 4N3WA 4LADB 2BAYA 4QF2A 3GL6A 3KQIA 3SOXA 1ZBDB 2M3HA 1X4UA 5FEYA 2LGVA 2FUIA 2D8SA 1N87A 1LDKC 3ASLA 1FBVA 3EB6A 3HCUA 5D1MB 2YURA 1T1HA 1WEPA 2YSMA 1MM3A 4GNFA 4YATA 1RMDA 2VJEB 4O64A 3U5MA 2LGKA 4CA1A 4I7DA 5G04B 3M63A 2YHNA 4GB0A 5FERA 2KYUA 2QICA 2LXPC 5KH7A 4N4FA 2H0DB 3O33A 4LLBA 3LQHA 1CHCA 2YHOA 4QF3A 2VPEA 4PPEA 3SOUA 2MD8C 5B75A 2JMJA 4BHWA 3DQVR 3RPGC 2I50A 1K2FA 2KWKA 3MHSA 5TDRA 1WEVA 5JG6A 4GNDA 5DINA 1WEUA 3O7AA 2ECIA 4I7CA 5B76A 5TDWA 2LRIC 4X3GA 3KV5A 4AVXA 2G45A 4WZ3B 4CCGX 4R2YA 2L43A 5FB0A 4ZDTA 4LKAA 5AIUA 1Z2QA 2DX8A 5G0FA 4BBQA 1G25A 4FIPA 1VFYA 3KNVA 4LJNA 2EODA 1V87A 2YQMA 1DVPA 3NG2A 4AYCB 4L58A 3RPGB 2YYRA 2IDAA 2XEUA 2LDRA 2LGLA 5H1TA 4MVTA 3PHDA 1BORA 2MNYA 2ECVA 2KIZA 4YBTA 2VP7A 4XI1A 1Z6UA 2L80A 4P5OB 2Y1MA 3VK6A 1WFKA 2LGGA 2ECWA 1F62A 5C13A 2QJ0A 1IYMA 1WGMA 2KWJA 5LKZA 2HYED 5B78A 1WE9A 2KWNA 1JM7A 3V43A 5H9MA 2VJFB 5B77A 1WEMA 2LV9A 4YBMA 3L1ZB 5TABA 4S3OC 2CKLB 2K1JA 3ZNIA 5B8DA 5H1VA 3PUQA 2VPDA 2MUMA 5LKXA 1MM2A 2YQLA 3LRQA 2KREA 3O36A 4NN2A 5D1KB 1Z60A 3HCTA 1WENA 2M1RA 1XWHA 4IC2A 5FB1A 2L0BA 1HYIA 3T6RA 2Y1NA 3ZPVE 4F52B 2K17A 3O70A 2YW8A 4ZUXU 4MSXA 2EGPA 4I7BA 5J3XA 1WILA 2G6QA 3U5NA 2CSZA 2KFTA 2KE1A 2KGGA 2MT5A 2G43A 4FJCA 5TBNA 3L1XA 3PURA 2KGIA 4WZ2A 3RTRB 3LQIA 2PUYA 2E6SA 4GNGA 2M85A 5KH9A 2AN6A 2L5UA 4R8PK 5EYAF 2LXHC 4YABA 3MHHA 2LN0A 2CSYA 2XB1A 2ECNA 4R7EA 4V3LC 1WEWA 4L7XA 3EB5A 1WEEA 2K16A 1WEQA 2JMDA 2M6MA 4ZQLA 4PTBA 1VD4A 2ECTA 2LQ6A 2OXQC 5LKTA 3O37A 3N9LA 4UI9B 5C11A 4LK9A 2RSDA 3U5PA 5LCWB 3N9PA 2VJEA 1HYJA 2F6NA 5I3LA 2YUCA 2MIQA 3ZVZB 3ZVYA 3HTKC 3L11A 4WA6A 2JMIA 3GV4A 1E4UA 2MD7B 2JRJA 4TKPB 1WEOA 3LQJA 2C2LA 2H0DA 5D1LB 3HCSA 2ECGA 2VPGA 4WZ0A 4A0CD 2Y43A 4AP4A 4A4BA 4IC3A 3ZTGA 2MA5A 2VNFA 3I2DA 1WESA 2EA6A 3U5OA 2CT2A 4GNEA 2FUUA 1VYXA 5B79A 2KWOA 4Q6FA 1X4JA 2KU3A 5DKAA 5LKUA 1X4IA 3N9MA 2VPBA 4UP0A 3FL2A 4V3KC 2MNZA 1JM7B 2YSJA 4S3OB 4UP5A 2E6RA 4B7YC 2L75A 5AITA 4AUQB 3O34A 3N9NA 3T7LA 3M62A 3ZPV1 3SHBA 1LDJB 5H1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECJ A;  4B86 C;  4AYC A;  4FO9 A;  4YC9 A;  3C6W A;  4C9Z A;  3M99 A;  3ZYQ A;  4A49 A;  4YAD A;  3KV6 A;  1WIM A;  2UZG A;  3N9Q A;  3IHP A;  4YAX A;  2F6J A;  2NAA A;  3QZV A;  2RI7 A;  2YT5 A;  5G05 B;  5KH3 A;  5TRB A;  4FK5 A;  2HDP A;  2MA6 A;  2F42 A;  2VJF A;  4YBS A;  2ZET C;  2C2V S;  2QIZ A;  2PNX A;  3SOW A;  2CKL A;  2K4D A;  2YU4 A;  3DPL R;  4A4C A;  1JOC A;  2FSA A;  1FP0 A;  2KR4 A;  3C5K A;  2YRE A;  4W4U A;  1U6G B;  3O35 A;  3N9O A;  4N3W A;  4LAD B;  2BAY A;  4QF2 A;  3GL6 A;  3KQI A;  3SOX A;  1ZBD B;  2M3H A;  1X4U A;  5FEY A;  2LGV A;  2FUI A;  2D8S A;  1N87 A;  1LDK C;  3ASL A;  1FBV A;  3EB6 A;  3HCU A;  5D1M B;  2YUR A;  1T1H A;  1WEP A;  2YSM A;  1MM3 A;  4GNF A;  4YAT A;  1RMD A;  2VJE B;  4O64 A;  3U5M A;  2LGK A;  4CA1 A;  4I7D A;  5G04 B;  3M63 A;  2YHN A;  4GB0 A;  5FER A;  2KYU A;  2QIC A;  2LXP C;  5KH7 A;  4N4F A;  2H0D B;  3O33 A;  4LLB A;  3LQH A;  1CHC A;  2YHO A;  4QF3 A;  2VPE A;  4PPE A;  3SOU A;  2MD8 C;  5B75 A;  2JMJ A;  4BHW A;  3DQV R;  3RPG C;  2I50 A;  1K2F A;  2KWK A;  3MHS A;  5TDR A;  1WEV A;  5JG6 A;  4GND A;  5DIN A;  1WEU A;  3O7A A;  2ECI A;  4I7C A;  5B76 A;  5TDW A;  2LRI C;  4X3G A;  3KV5 A;  4AVX A;  2G45 A;  4WZ3 B;  4CCG X;  4R2Y A;  2L43 A;  5FB0 A;  4ZDT A;  4LKA A;  5AIU A;  1Z2Q A;  2DX8 A;  5G0F A;  4BBQ A;  1G25 A;  4FIP A;  1VFY A;  3KNV A;  4LJN A;  2EOD A;  1V87 A;  2YQM A;  1DVP A;  3NG2 A;  4AYC B;  4L58 A;  3RPG B;  2YYR A;  2IDA A;  2XEU A;  2LDR A;  2LGL A;  5H1T A;  4MVT A;  3PHD A;  1BOR A;  2MNY A;  2ECV A;  2KIZ A;  4YBT A;  2VP7 A;  4XI1 A;  1Z6U A;  2L80 A;  4P5O B;  2Y1M A;  3VK6 A;  1WFK A;  2LGG A;  2ECW A;  1F62 A;  5C13 A;  2QJ0 A;  1IYM A;  1WGM A;  2KWJ A;  5LKZ A;  2HYE D;  5B78 A;  1WE9 A;  2KWN A;  1JM7 A;  3V43 A;  5H9M A;  2VJF B;  5B77 A;  1WEM A;  2LV9 A;  4YBM A;  3L1Z B;  5TAB A;  4S3O C;  2CKL B;  2K1J A;  3ZNI A;  5B8D A;  5H1V A;  3PUQ A;  2VPD A;  2MUM A;  5LKX A;  1MM2 A;  2YQL A;  3LRQ A;  2KRE A;  3O36 A;  4NN2 A;  5D1K B;  1Z60 A;  3HCT A;  1WEN A;  2M1R A;  1XWH A;  4IC2 A;  5FB1 A;  2L0B A;  1HYI A;  3T6R A;  2Y1N A;  3ZPV E;  4F52 B;  2K17 A;  3O70 A;  2YW8 A;  4ZUX U;  4MSX A;  2EGP A;  4I7B A;  5J3X A;  1WIL A;  2G6Q A;  3U5N A;  2CSZ A;  2KFT A;  2KE1 A;  2KGG A;  2MT5 A;  2G43 A;  4FJC A;  5TBN A;  3L1X A;  3PUR A;  2KGI A;  4WZ2 A;  3RTR B;  3LQI A;  2PUY A;  2E6S A;  4GNG A;  2M85 A;  5KH9 A;  2AN6 A;  2L5U A;  4R8P K;  5EYA F;  2LXH C;  4YAB A;  3MHH A;  2LN0 A;  2CSY A;  2XB1 A;  2ECN A;  4R7E A;  4V3L C;  1WEW A;  4L7X A;  3EB5 A;  1WEE A;  2K16 A;  1WEQ A;  2JMD A;  2M6M A;  4ZQL A;  4PTB A;  1VD4 A;  2ECT A;  2LQ6 A;  2OXQ C;  5LKT A;  3O37 A;  3N9L A;  4UI9 B;  5C11 A;  4LK9 A;  2RSD A;  3U5P A;  5LCW B;  3N9P A;  2VJE A;  1HYJ A;  2F6N A;  5I3L A;  2YUC A;  2MIQ A;  3ZVZ B;  3ZVY A;  3HTK C;  3L11 A;  4WA6 A;  2JMI A;  3GV4 A;  1E4U A;  2MD7 B;  2JRJ A;  4TKP B;  1WEO A;  3LQJ A;  2C2L A;  2H0D A;  5D1L B;  3HCS A;  2ECG A;  2VPG A;  4WZ0 A;  4A0C D;  2Y43 A;  4AP4 A;  4A4B A;  4IC3 A;  3ZTG A;  2MA5 A;  2VNF A;  3I2D A;  1WES A;  2EA6 A;  3U5O A;  2CT2 A;  4GNE A;  2FUU A;  1VYX A;  5B79 A;  2KWO A;  4Q6F A;  1X4J A;  2KU3 A;  5DKA A;  5LKU A;  1X4I A;  3N9M A;  2VPB A;  4UP0 A;  3FL2 A;  4V3K C;  2MNZ A;  1JM7 B;  2YSJ A;  4S3O B;  4UP5 A;  2E6R A;  4B7Y C;  2L75 A;  5AIT A;  4AUQ B;  3O34 A;  3N9N A;  3T7L A;  3M62 A;  3ZPV 1;  3SHB A;  1LDJ B;  5H1U A; 
#chains in the Genus database with same CATH topology
 2ECJ A;  4B86 C;  4AYC A;  4FO9 A;  4YC9 A;  2DSM A;  3C6W A;  3MDB C;  2B0O E;  2OWA A;  4C9Z A;  3M99 A;  1DCQ A;  3ZYQ A;  4A49 A;  4YAD A;  3KV6 A;  1WIM A;  2UZG A;  3N9Q A;  3IHP A;  3FAN A;  3T9K A;  4YAX A;  2F6J A;  2NAA A;  3QZV A;  2RI7 A;  2YT5 A;  5G05 B;  5KH3 A;  5TRB A;  4FK5 A;  2HDP A;  2MA6 A;  2EXU A;  2F42 A;  2VJF A;  2P57 A;  4YBS A;  2ZET C;  2C2V S;  2KKX A;  2QIZ A;  2PNX A;  3SOW A;  2CKL A;  2K4D A;  2YU4 A;  3DPL R;  4A4C A;  2IQJ A;  2L7P A;  2LAU A;  5SVI A;  1JOC A;  2FSA A;  3DDT A;  1FP0 A;  3H7H A;  2KR4 A;  3C5K A;  2YRE A;  4W4U A;  1U6G B;  3O35 A;  3N9O A;  4N3W A;  4LAD B;  3LDY A;  2BAY A;  4QF2 A;  3GL6 A;  3KQI A;  3FJU B;  3SOX A;  1ZBD B;  2M3H A;  1X4U A;  5FEY A;  2LGV A;  2FUI A;  2D8S A;  1N87 A;  1LDK C;  3ASL A;  1FBV A;  3EB6 A;  2CON A;  3HCU A;  5D1M B;  2YUR A;  1T1H A;  5K3Q A;  1WEP A;  2YSM A;  1MM3 A;  3FEH A;  4GNF A;  4YAT A;  1RMD A;  2MKE A;  2VJE B;  4O64 A;  3U5M A;  2LGK A;  4CA1 A;  4I7D A;  3PLW A;  4O62 A;  5G04 B;  3M63 A;  2YHN A;  4GB0 A;  5FER A;  2KYU A;  2QIC A;  2LXP C;  5SVX A;  5KH7 A;  4N4F A;  2CRR A;  2H0D B;  3DWD A;  3O33 A;  2XOY A;  4LLB A;  3LQH A;  1CHC A;  2JM3 A;  3LVR E;  3SUB A;  2FD4 A;  2YHO A;  4QF3 A;  2VPE A;  4PPE A;  3SOU A;  2MD8 C;  5B75 A;  2JMJ A;  3Q1D A;  4BHW A;  3DQV R;  3RPG C;  2I50 A;  1K2F A;  2KWK A;  3MHS A;  5TDR A;  1WEV A;  5JG6 A;  4GND A;  5DIN A;  1WEU A;  2D8U A;  3O7A A;  2ECI A;  4I7C A;  5B76 A;  5TDW A;  2LRI C;  4X3G A;  3KV5 A;  4AVX A;  2M13 A;  2G45 A;  4WZ3 B;  4CCG X;  4R2Y A;  2L43 A;  5FB0 A;  4ZDT A;  4LKA A;  5AIU A;  1Z2Q A;  3M7K A;  2DX8 A;  5G0F A;  4BBQ A;  1G25 A;  4FIP A;  1VFY A;  3KNV A;  4LJN A;  2EOD A;  1V87 A;  2YQM A;  1DVP A;  2E61 A;  3NG2 A;  4AYC B;  4L58 A;  4OGC A;  3RPG B;  2YYR A;  2IDA A;  2XEU A;  3KDE C;  2LDR A;  2LGL A;  5H1T A;  4MVT A;  3PHD A;  1BOR A;  2MNY A;  2ECV A;  2KIZ A;  4YBT A;  2VP7 A;  4XI1 A;  1Z6U A;  2L80 A;  4P5O B;  2Y1M A;  4OGE A;  3VK6 A;  1WFK A;  3O47 A;  2LGG A;  2ECW A;  1F62 A;  5C13 A;  2QJ0 A;  2YVR A;  1IYM A;  1WGM A;  2KWJ A;  5LKZ A;  2HYE D;  5B78 A;  1WE9 A;  2KWN A;  4Z0O A;  1JM7 A;  3V43 A;  5H9M A;  2VJF B;  5B77 A;  1WEM A;  2LV9 A;  4YBM A;  3L1Z B;  5TAB A;  4S3O C;  2CKL B;  2K1J A;  3ZNI A;  5B8D A;  5H1V A;  3PUQ A;  2VPD A;  2MUM A;  2XOZ A;  3FM8 C;  5LKX A;  1MM2 A;  2YQL A;  3LRQ A;  2KRE A;  3O36 A;  4NN2 A;  4H9D A;  5D1K B;  5SVI B;  1Z60 A;  3HCT A;  1WEN A;  2M1R A;  1XWH A;  4IC2 A;  5FB1 A;  2L0B A;  2DJA A;  1HYI A;  3T6R A;  2Y1N A;  2EGM A;  3ZPV E;  4F52 B;  2K17 A;  3O70 A;  3JUE A;  2YW8 A;  4ZUX U;  4MSX A;  2EGP A;  4I7B A;  5J3X A;  1WIL A;  2G6Q A;  2JUN A;  3U5N A;  2CSZ A;  2KFT A;  2KE1 A;  4Z0R A;  2KGG A;  3LVQ E;  2MT5 A;  2G43 A;  1MBM A;  2KKY A;  4FJC A;  5TBN A;  3L1X A;  3PUR A;  2CSV A;  2KGI A;  4WZ2 A;  3RTR B;  3LQI A;  2PUY A;  2E6S A;  4GNG A;  2M85 A;  5KH9 A;  2AN6 A;  2L5U A;  4R8P K;  5EYA F;  2LXH C;  4YAB A;  3MHH A;  2LN0 A;  2CSY A;  2XB1 A;  2ECN A;  4R7E A;  4V3L C;  1WEW A;  4L7X A;  3EB5 A;  1WEE A;  2K16 A;  4F1P A;  1WEQ A;  2JMD A;  2CRW A;  2M6M A;  4ZQL A;  4PTB A;  1VD4 A;  2ECT A;  2LQ6 A;  2OXQ C;  5LKT A;  3O37 A;  3N9L A;  4UI9 B;  5C11 A;  4LK9 A;  2RSD A;  3U5P A;  5LCW B;  3N9P A;  2VJE A;  4QQ4 A;  1HYJ A;  2F6N A;  5I3L A;  3E2D A;  2YUC A;  2MIQ A;  3ZVZ B;  3ZVY A;  3HTK C;  3L11 A;  4WA6 A;  2JMI A;  3GV4 A;  2XOC A;  2FFW A;  1E4U A;  2MD7 B;  2JRJ A;  4TKP B;  1WEO A;  3LQJ A;  3LJU X;  2C2L A;  2H0D A;  5D1L B;  3HCS A;  2ECG A;  2VPG A;  4WZ0 A;  4A0C D;  2RR4 A;  2Y43 A;  4AP4 A;  4A4B A;  4IC3 A;  3ZTG A;  2MA5 A;  2VNF A;  3I2D A;  1WES A;  2EA6 A;  3U5O A;  2CT2 A;  4GNE A;  2FUU A;  1VYX A;  5B79 A;  2KWO A;  5SVY A;  4Q6F A;  1X4J A;  2KU3 A;  5DKA A;  5LKU A;  3FAO A;  1X4I A;  3N9M A;  2VPB A;  4UP0 A;  3FL2 A;  4V3K C;  2MNZ A;  1JM7 B;  2YSJ A;  4S3O B;  4UP5 A;  2E6R A;  2XP0 A;  4B7Y C;  2L75 A;  5AIT A;  4AUQ B;  3O34 A;  3N9N A;  3T7L A;  3M62 A;  3ZPV 1;  3SHB A;  1LDJ B;  5H1U A; 
#chains in the Genus database with same CATH homology
 2ECJ A;  4B86 C;  4AYC A;  4FO9 A;  4YC9 A;  3C6W A;  4C9Z A;  3M99 A;  3ZYQ A;  4A49 A;  4YAD A;  3KV6 A;  1WIM A;  2UZG A;  3N9Q A;  3IHP A;  4YAX A;  2F6J A;  2NAA A;  3QZV A;  2RI7 A;  2YT5 A;  5G05 B;  5KH3 A;  5TRB A;  4FK5 A;  2HDP A;  2MA6 A;  2F42 A;  2VJF A;  4YBS A;  2ZET C;  2C2V S;  2QIZ A;  2PNX A;  3SOW A;  2CKL A;  2K4D A;  2YU4 A;  3DPL R;  4A4C A;  1JOC A;  2FSA A;  1FP0 A;  2KR4 A;  3C5K A;  2YRE A;  4W4U A;  1U6G B;  3O35 A;  3N9O A;  4N3W A;  4LAD B;  2BAY A;  4QF2 A;  3GL6 A;  3KQI A;  3SOX A;  1ZBD B;  2M3H A;  1X4U A;  5FEY A;  2LGV A;  2FUI A;  2D8S A;  1N87 A;  1LDK C;  3ASL A;  1FBV A;  3EB6 A;  3HCU A;  5D1M B;  2YUR A;  1T1H A;  1WEP A;  2YSM A;  1MM3 A;  4GNF A;  4YAT A;  1RMD A;  2VJE B;  4O64 A;  3U5M A;  2LGK A;  4CA1 A;  4I7D A;  5G04 B;  3M63 A;  2YHN A;  4GB0 A;  5FER A;  2KYU A;  2QIC A;  2LXP C;  5KH7 A;  4N4F A;  2H0D B;  3O33 A;  4LLB A;  3LQH A;  1CHC A;  2YHO A;  4QF3 A;  2VPE A;  4PPE A;  3SOU A;  2MD8 C;  5B75 A;  2JMJ A;  4BHW A;  3DQV R;  3RPG C;  2I50 A;  1K2F A;  2KWK A;  3MHS A;  5TDR A;  1WEV A;  5JG6 A;  4GND A;  5DIN A;  1WEU A;  3O7A A;  2ECI A;  4I7C A;  5B76 A;  5TDW A;  2LRI C;  4X3G A;  3KV5 A;  4AVX A;  2G45 A;  4WZ3 B;  4CCG X;  4R2Y A;  2L43 A;  5FB0 A;  4ZDT A;  4LKA A;  5AIU A;  1Z2Q A;  2DX8 A;  5G0F A;  4BBQ A;  1G25 A;  4FIP A;  1VFY A;  3KNV A;  4LJN A;  2EOD A;  1V87 A;  2YQM A;  1DVP A;  3NG2 A;  4AYC B;  4L58 A;  3RPG B;  2YYR A;  2IDA A;  2XEU A;  2LDR A;  2LGL A;  5H1T A;  4MVT A;  3PHD A;  1BOR A;  2MNY A;  2ECV A;  2KIZ A;  4YBT A;  2VP7 A;  4XI1 A;  1Z6U A;  2L80 A;  4P5O B;  2Y1M A;  3VK6 A;  1WFK A;  2LGG A;  2ECW A;  1F62 A;  5C13 A;  2QJ0 A;  1IYM A;  1WGM A;  2KWJ A;  5LKZ A;  2HYE D;  5B78 A;  1WE9 A;  2KWN A;  1JM7 A;  3V43 A;  5H9M A;  2VJF B;  5B77 A;  1WEM A;  2LV9 A;  4YBM A;  3L1Z B;  5TAB A;  4S3O C;  2CKL B;  2K1J A;  3ZNI A;  5B8D A;  5H1V A;  3PUQ A;  2VPD A;  2MUM A;  5LKX A;  1MM2 A;  2YQL A;  3LRQ A;  2KRE A;  3O36 A;  4NN2 A;  5D1K B;  1Z60 A;  3HCT A;  1WEN A;  2M1R A;  1XWH A;  4IC2 A;  5FB1 A;  2L0B A;  1HYI A;  3T6R A;  2Y1N A;  3ZPV E;  4F52 B;  2K17 A;  3O70 A;  2YW8 A;  4ZUX U;  4MSX A;  2EGP A;  4I7B A;  5J3X A;  1WIL A;  2G6Q A;  3U5N A;  2CSZ A;  2KFT A;  2KE1 A;  2KGG A;  2MT5 A;  2G43 A;  4FJC A;  5TBN A;  3L1X A;  3PUR A;  2KGI A;  4WZ2 A;  3RTR B;  3LQI A;  2PUY A;  2E6S A;  4GNG A;  2M85 A;  5KH9 A;  2AN6 A;  2L5U A;  4R8P K;  5EYA F;  2LXH C;  4YAB A;  3MHH A;  2LN0 A;  2CSY A;  2XB1 A;  2ECN A;  4R7E A;  4V3L C;  1WEW A;  4L7X A;  3EB5 A;  1WEE A;  2K16 A;  1WEQ A;  2JMD A;  2M6M A;  4ZQL A;  4PTB A;  1VD4 A;  2ECT A;  2LQ6 A;  2OXQ C;  5LKT A;  3O37 A;  3N9L A;  4UI9 B;  5C11 A;  4LK9 A;  2RSD A;  3U5P A;  5LCW B;  3N9P A;  2VJE A;  1HYJ A;  2F6N A;  5I3L A;  2YUC A;  2MIQ A;  3ZVZ B;  3ZVY A;  3HTK C;  3L11 A;  4WA6 A;  2JMI A;  3GV4 A;  1E4U A;  2MD7 B;  2JRJ A;  4TKP B;  1WEO A;  3LQJ A;  2C2L A;  2H0D A;  5D1L B;  3HCS A;  2ECG A;  2VPG A;  4WZ0 A;  4A0C D;  2Y43 A;  4AP4 A;  4A4B A;  4IC3 A;  3ZTG A;  2MA5 A;  2VNF A;  3I2D A;  1WES A;  2EA6 A;  3U5O A;  2CT2 A;  4GNE A;  2FUU A;  1VYX A;  5B79 A;  2KWO A;  4Q6F A;  1X4J A;  2KU3 A;  5DKA A;  5LKU A;  1X4I A;  3N9M A;  2VPB A;  4UP0 A;  3FL2 A;  4V3K C;  2MNZ A;  1JM7 B;  2YSJ A;  4S3O B;  4UP5 A;  2E6R A;  4B7Y C;  2L75 A;  5AIT A;  4AUQ B;  3O34 A;  3N9N A;  3T7L A;  3M62 A;  3ZPV 1;  3SHB A;  1LDJ B;  5H1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...