3ZPVE

Crystal structure of drosophila pygo phd finger in complex with legless hd1 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
AAMAIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PROTEIN BCL9 HOMOLOG
publication title Evolutionary Adaptation of the Fly Pygo Phd Finger Towards Recognizing Histone H3 Tail Methylated at Arginine 2
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 11
structure length 62
sequence length 62
chains with identical sequence O, Y
ec nomenclature
pdb deposition date 2013-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zpvE00
4YBTA 2CKLA 3NG2A 4R7EA 2ECVA 5B79A 3SOUA 1WEOA 4LLBA 3O36A 1X4JA 2XEUA 4W4UA 2K4DA 5AIUA 2YREA 3VK6A 4AYCA 1HYIA 2DX8A 3SHBA 2L0BA 2H0DA 4UI9B 2D8SA 3QZVA 4YBMA 2MIQA 2ECJA 4FK5A 3I2DA 2MA5A 5FEYA 1WEUA 2KWOA 1WEQA 2LN0A 1RMDA 2KE1A 2LXHC 2M3HA 2ECNA 2G6QA 4B7YC 4R2YA 2VJEB 3RPGB 2EODA 3M63A 2LDRA 2MD7B 2I50A 3O34A 2OXQC 1FP0A 2FUUA 2YURA 4MVTA 3T6RA 4FJCA 5JG6A 3LQHA 2L5UA 2VNFA 2VPEA 2MA6A 5EYAF 1MM3A 4O64A 4AVXA 3RTRB 2KU3A 2EA6A 5TDWA 1IYMA 4LK9A 4IC2A 2YQLA 5G04B 3ASLA 3O33A 2KWJA 2JMDA 3O70A 5KH7A 2ECIA 2QIZA 2F6NA 2LGKA 2ZETC 1F62A 3ZYQA 3ZVYA 3LRQA 2ECWA 4N3WA 1WEMA 2K1JA 4FIPA 5C11A 4A4BA 5H1TA 2EGPA 4N4FA 4TKPB 4AP4A 4IC3A 5FERA 2MNZA 4L58A 1WESA 2YHNA 1VD4A 4X3GA 3V43A 2IDAA 4S3OC 3LQIA 3HCUA 2MD8C 4ZQLA 3ZVZB 5J3XA 3N9QA 2KWNA 3PUQA 1JM7A 5D1MB 2KYUA 4I7DA 2KWKA 2E6RA 3L1XA 2YSMA 3N9MA 3HTKC 5LCWB 3L11A 3LQJA 3IHPA 5TRBA 2LV9A 4I7BA 2CT2A 1WIMA 3N9PA 1FBVA 2LGLA 2VPGA 2CSYA 4WZ0A 5H1VA 2FUIA 2JMJA 1LDJB 1XWHA 4GNFA 2MNYA 4YATA 4A0CD 3N9OA 4PPEA 2JRJA 1Z2QA 3KV6A 4XI1A 3L1ZB 3U5NA 4QF3A 5TDRA 1X4UA 3GV4A 2G43A 3KQIA 2CKLB 2FSAA 4F52B 4YABA 5KH3A 1WEVA 4I7CA 4UP5A 4C9ZA 2YQMA 5B77A 2F6JA 2RSDA 2JMIA 2M6MA 4AYCB 2G45A 2YW8A 2Y43A 4LKAA 1E4UA 3N9NA 1N87A 5B75A 3C6WA 2H0DB 1WILA 2MUMA 3DQVR 3FL2A 5LKUA 5FB0A 4FO9A 2Y1MA 5H9MA 5DKAA 1T1HA 3O35A 1ZBDB 4V3LC 4Q6FA 1HYJA 3O7AA 2PNXA 4WA6A 3MHSA 4B86C 3MHHA 4QF2A 2AN6A 1K2FA 1VYXA 5B76A 1G25A 2E6SA 2K17A 1WE9A 2HYED 3ZPV1 5AITA 4P5OB 2F42A 2VJFA 4YADA 2C2VS 3ZTGA 5LKTA 2KREA 5LKXA 3RPGC 3PURA 5C13A 1WEEA 1V87A 2M1RA 4YAXA 4GNDA 3DPLR 3M62A 2L43A 1WGMA 2VPDA 5I3LA 4BBQA 4PTBA 3GL6A 2LGVA 2KIZA 3ZNIA 3HCSA 2VP7A 1Z60A 2M85A 2QICA 2L80A 4A49A 1MM2A 4L7XA 2XB1A 1DVPA 4ZUXU 4NN2A 3KV5A 3U5MA 4BHWA 4YC9A 5B8DA 3HCTA 1LDKC 4AUQB 2LXPC 3M99A 5D1LB 2HDPA 5G0FA 2QJ0A 1Z6UA 2PUYA 2LQ6A 4CA1A 4GB0A 3C5KA 4MSXA 3T7LA 2ECTA 2VJFB 3SOWA 2LRIC 4ZDTA 3EB5A 4S3OB 4WZ2A 5G05B 3KNVA 5TBNA 1X4IA 1WENA 4V3KC 3U5OA 2L75A 2Y1NA 2UZGA 3SOXA 2ECGA 5FB1A 2KGGA 1JM7B 5B78A 2YYRA 3PHDA 5LKZA 4CCGX 2YHOA 2YU4A 3O37A 1CHCA 3EB6A 1JOCA 5DINA 3N9LA 2MT5A 4UP0A 2VPBA 2KGIA 5H1UA 4YBSA 2KFTA 5KH9A 5TABA 4LJNA 2RI7A 3U5PA 2YT5A 5D1KB 4GNGA 4WZ3B 1BORA 1U6GB 3ZPVE 4A4CA 2LGGA 4GNEA 2CSZA 2YUCA 2VJEA 1VFYA 1WFKA 2K16A 4LADB 2KR4A 1WEPA 2C2LA 1WEWA 4R8PK 2YSJA 2BAYA 2NAAA
chains in the Genus database with same CATH superfamily
2RR4A 4YBTA 2CKLA 3NG2A 4R7EA 2ECVA 5B79A 2XOYA 3SOUA 1WEOA 4LLBA 3O36A 1X4JA 2XEUA 4W4UA 2K4DA 5AIUA 2DJAA 3LJUX 2YREA 3VK6A 4AYCA 1HYIA 2IQJA 2DX8A 3SHBA 2L0BA 2H0DA 3O47A 4UI9B 2D8SA 3QZVA 4YBMA 3E2DA 2MIQA 3FM8C 2ECJA 2JUNA 4FK5A 3I2DA 2MA5A 5FEYA 1WEUA 2KWOA 1WEQA 2LN0A 1RMDA 2KE1A 2LXHC 2M3HA 2ECNA 2G6QA 4B7YC 4R2YA 2VJEB 3RPGB 2EODA 3M63A 2LDRA 2MD7B 2I50A 3LVQE 3O34A 2OXQC 1MBMA 1FP0A 2FUUA 2YURA 4MVTA 3T6RA 4FJCA 5JG6A 3FEHA 3LQHA 2L5UA 2VNFA 2VPEA 2MA6A 5EYAF 2CRWA 1MM3A 4O64A 4F1PA 4AVXA 3RTRB 2KU3A 2EA6A 5TDWA 1IYMA 4LK9A 4IC2A 2YQLA 5G04B 3ASLA 3O33A 2KWJA 2JMDA 3O70A 5KH7A 2ECIA 2QIZA 5SVYA 2F6NA 2LGKA 2ZETC 3FANA 5SVXA 1F62A 3ZYQA 3ZVYA 3LRQA 2ECWA 4N3WA 2E61A 1WEMA 4Z0OA 4H9DA 2K1JA 4FIPA 5C11A 4A4BA 5H1TA 2EGPA 4N4FA 4TKPB 4AP4A 4IC3A 5FERA 2P57A 2MNZA 4L58A 1WESA 2YHNA 1VD4A 4X3GA 3V43A 2IDAA 4S3OC 3LQIA 3HCUA 2MD8C 4ZQLA 3ZVZB 5J3XA 3N9QA 2KWNA 3PUQA 1JM7A 5D1MB 2KYUA 4I7DA 1DCQA 5SVIA 2KWKA 2E6RA 3L1XA 2YSMA 3N9MA 3HTKC 5LCWB 3L11A 3LQJA 3IHPA 3LDYA 5TRBA 2LV9A 4I7BA 2CT2A 3KDEC 1WIMA 3N9PA 2JM3A 1FBVA 3DDTA 2LGLA 2VPGA 2CSYA 4WZ0A 5H1VA 2FUIA 2JMJA 1LDJB 1XWHA 4GNFA 2MNYA 4YATA 2EXUA 4A0CD 2D8UA 3N9OA 4PPEA 2JRJA 1Z2QA 3KV6A 4XI1A 3L1ZB 3U5NA 2CSVA 4QF3A 5TDRA 1X4UA 3GV4A 2G43A 3KQIA 2CKLB 2FSAA 4F52B 2KKYA 3DWDA 4YABA 5KH3A 1WEVA 5K3QA 2KKXA 4I7CA 4UP5A 4C9ZA 2YQMA 2MKEA 5B77A 2F6JA 2RSDA 2JMIA 2M6MA 4AYCB 2G45A 2YW8A 2Y43A 4LKAA 1E4UA 3N9NA 1N87A 5B75A 3C6WA 2H0DB 1WILA 2MUMA 2M13A 3DQVR 3FL2A 5LKUA 5FB0A 4FO9A 2Y1MA 3T9KA 4OGEA 5H9MA 5DKAA 1T1HA 3O35A 1ZBDB 4V3LC 3H7HA 4Q6FA 1HYJA 3O7AA 2PNXA 4WA6A 3MHSA 4B86C 3MHHA 4QF2A 2AN6A 2EGMA 1K2FA 1VYXA 5B76A 1G25A 2CONA 2E6SA 2K17A 2FD4A 3PLWA 1WE9A 2HYED 4QQ4A 3ZPV1 5AITA 4P5OB 2F42A 2VJFA 4YADA 2C2VS 3ZTGA 5LKTA 2KREA 5LKXA 3RPGC 3PURA 5C13A 1WEEA 1V87A 2M1RA 4YAXA 4GNDA 3Q1DA 3DPLR 3M62A 2L43A 3M7KA 1WGMA 2VPDA 5I3LA 4BBQA 4PTBA 3GL6A 2LGVA 2KIZA 3ZNIA 3HCSA 2VP7A 1Z60A 2M85A 4O62A 2QICA 2B0OE 2L80A 4A49A 1MM2A 4L7XA 2XB1A 3JUEA 1DVPA 4ZUXU 4NN2A 3KV5A 3U5MA 2DSMA 2XOZA 4BHWA 4YC9A 5B8DA 3HCTA 3MDBC 1LDKC 4AUQB 2LXPC 3M99A 5D1LB 2FFWA 2HDPA 5G0FA 2QJ0A 1Z6UA 2PUYA 2LQ6A 4CA1A 4GB0A 3C5KA 4MSXA 2YVRA 3T7LA 2ECTA 2VJFB 4OGCA 3SOWA 2LRIC 4ZDTA 3EB5A 4S3OB 4WZ2A 3FJUB 5G05B 3KNVA 2XP0A 5TBNA 1X4IA 1WENA 4V3KC 3U5OA 2L75A 2Y1NA 2CRRA 2UZGA 3SOXA 2ECGA 5FB1A 2KGGA 1JM7B 5B78A 2YYRA 3PHDA 5LKZA 4CCGX 5SVIB 2L7PA 2YHOA 2YU4A 3O37A 1CHCA 3EB6A 1JOCA 5DINA 3N9LA 2MT5A 4UP0A 2VPBA 2KGIA 3FAOA 4Z0RA 5H1UA 4YBSA 2KFTA 5KH9A 3SUBA 5TABA 4LJNA 2RI7A 3U5PA 2YT5A 5D1KB 4GNGA 4WZ3B 1BORA 1U6GB 3ZPVE 2OWAA 4A4CA 2LGGA 4GNEA 2XOCA 2CSZA 2YUCA 2LAUA 2VJEA 1VFYA 1WFKA 2K16A 4LADB 2KR4A 1WEPA 2C2LA 1WEWA 4R8PK 2YSJA 3LVRE 2BAYA 2NAAA
chains in the Genus database with same CATH topology
4YBTA 2CKLA 3NG2A 4R7EA 2ECVA 5B79A 3SOUA 1WEOA 4LLBA 3O36A 1X4JA 2XEUA 4W4UA 2K4DA 5AIUA 2YREA 3VK6A 4AYCA 1HYIA 2DX8A 3SHBA 2L0BA 2H0DA 4UI9B 2D8SA 3QZVA 4YBMA 2MIQA 2ECJA 4FK5A 3I2DA 2MA5A 5FEYA 1WEUA 2KWOA 1WEQA 2LN0A 1RMDA 2KE1A 2LXHC 2M3HA 2ECNA 2G6QA 4B7YC 4R2YA 2VJEB 3RPGB 2EODA 3M63A 2LDRA 2MD7B 2I50A 3O34A 2OXQC 1FP0A 2FUUA 2YURA 4MVTA 3T6RA 4FJCA 5JG6A 3LQHA 2L5UA 2VNFA 2VPEA 2MA6A 5EYAF 1MM3A 4O64A 4AVXA 3RTRB 2KU3A 2EA6A 5TDWA 1IYMA 4LK9A 4IC2A 2YQLA 5G04B 3ASLA 3O33A 2KWJA 2JMDA 3O70A 5KH7A 2ECIA 2QIZA 2F6NA 2LGKA 2ZETC 1F62A 3ZYQA 3ZVYA 3LRQA 2ECWA 4N3WA 1WEMA 2K1JA 4FIPA 5C11A 4A4BA 5H1TA 2EGPA 4N4FA 4TKPB 4AP4A 4IC3A 5FERA 2MNZA 4L58A 1WESA 2YHNA 1VD4A 4X3GA 3V43A 2IDAA 4S3OC 3LQIA 3HCUA 2MD8C 4ZQLA 3ZVZB 5J3XA 3N9QA 2KWNA 3PUQA 1JM7A 5D1MB 2KYUA 4I7DA 2KWKA 2E6RA 3L1XA 2YSMA 3N9MA 3HTKC 5LCWB 3L11A 3LQJA 3IHPA 5TRBA 2LV9A 4I7BA 2CT2A 1WIMA 3N9PA 1FBVA 2LGLA 2VPGA 2CSYA 4WZ0A 5H1VA 2FUIA 2JMJA 1LDJB 1XWHA 4GNFA 2MNYA 4YATA 4A0CD 3N9OA 4PPEA 2JRJA 1Z2QA 3KV6A 4XI1A 3L1ZB 3U5NA 4QF3A 5TDRA 1X4UA 3GV4A 2G43A 3KQIA 2CKLB 2FSAA 4F52B 4YABA 5KH3A 1WEVA 4I7CA 4UP5A 4C9ZA 2YQMA 5B77A 2F6JA 2RSDA 2JMIA 2M6MA 4AYCB 2G45A 2YW8A 2Y43A 4LKAA 1E4UA 3N9NA 1N87A 5B75A 3C6WA 2H0DB 1WILA 2MUMA 3DQVR 3FL2A 5LKUA 5FB0A 4FO9A 2Y1MA 5H9MA 5DKAA 1T1HA 3O35A 1ZBDB 4V3LC 4Q6FA 1HYJA 3O7AA 2PNXA 4WA6A 3MHSA 4B86C 3MHHA 4QF2A 2AN6A 1K2FA 1VYXA 5B76A 1G25A 2E6SA 2K17A 1WE9A 2HYED 3ZPV1 5AITA 4P5OB 2F42A 2VJFA 4YADA 2C2VS 3ZTGA 5LKTA 2KREA 5LKXA 3RPGC 3PURA 5C13A 1WEEA 1V87A 2M1RA 4YAXA 4GNDA 3DPLR 3M62A 2L43A 1WGMA 2VPDA 5I3LA 4BBQA 4PTBA 3GL6A 2LGVA 2KIZA 3ZNIA 3HCSA 2VP7A 1Z60A 2M85A 2QICA 2L80A 4A49A 1MM2A 4L7XA 2XB1A 1DVPA 4ZUXU 4NN2A 3KV5A 3U5MA 4BHWA 4YC9A 5B8DA 3HCTA 1LDKC 4AUQB 2LXPC 3M99A 5D1LB 2HDPA 5G0FA 2QJ0A 1Z6UA 2PUYA 2LQ6A 4CA1A 4GB0A 3C5KA 4MSXA 3T7LA 2ECTA 2VJFB 3SOWA 2LRIC 4ZDTA 3EB5A 4S3OB 4WZ2A 5G05B 3KNVA 5TBNA 1X4IA 1WENA 4V3KC 3U5OA 2L75A 2Y1NA 2UZGA 3SOXA 2ECGA 5FB1A 2KGGA 1JM7B 5B78A 2YYRA 3PHDA 5LKZA 4CCGX 2YHOA 2YU4A 3O37A 1CHCA 3EB6A 1JOCA 5DINA 3N9LA 2MT5A 4UP0A 2VPBA 2KGIA 5H1UA 4YBSA 2KFTA 5KH9A 5TABA 4LJNA 2RI7A 3U5PA 2YT5A 5D1KB 4GNGA 4WZ3B 1BORA 1U6GB 3ZPVE 4A4CA 2LGGA 4GNEA 2CSZA 2YUCA 2VJEA 1VFYA 1WFKA 2K16A 4LADB 2KR4A 1WEPA 2C2LA 1WEWA 4R8PK 2YSJA 2BAYA 2NAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBT A;  2CKL A;  3NG2 A;  4R7E A;  2ECV A;  5B79 A;  3SOU A;  1WEO A;  4LLB A;  3O36 A;  1X4J A;  2XEU A;  4W4U A;  2K4D A;  5AIU A;  2YRE A;  3VK6 A;  4AYC A;  1HYI A;  2DX8 A;  3SHB A;  2L0B A;  2H0D A;  4UI9 B;  2D8S A;  3QZV A;  4YBM A;  2MIQ A;  2ECJ A;  4FK5 A;  3I2D A;  2MA5 A;  5FEY A;  1WEU A;  2KWO A;  1WEQ A;  2LN0 A;  1RMD A;  2KE1 A;  2LXH C;  2M3H A;  2ECN A;  2G6Q A;  4B7Y C;  4R2Y A;  2VJE B;  3RPG B;  2EOD A;  3M63 A;  2LDR A;  2MD7 B;  2I50 A;  3O34 A;  2OXQ C;  1FP0 A;  2FUU A;  2YUR A;  4MVT A;  3T6R A;  4FJC A;  5JG6 A;  3LQH A;  2L5U A;  2VNF A;  2VPE A;  2MA6 A;  5EYA F;  1MM3 A;  4O64 A;  4AVX A;  3RTR B;  2KU3 A;  2EA6 A;  5TDW A;  1IYM A;  4LK9 A;  4IC2 A;  2YQL A;  5G04 B;  3ASL A;  3O33 A;  2KWJ A;  2JMD A;  3O70 A;  5KH7 A;  2ECI A;  2QIZ A;  2F6N A;  2LGK A;  2ZET C;  1F62 A;  3ZYQ A;  3ZVY A;  3LRQ A;  2ECW A;  4N3W A;  1WEM A;  2K1J A;  4FIP A;  5C11 A;  4A4B A;  5H1T A;  2EGP A;  4N4F A;  4TKP B;  4AP4 A;  4IC3 A;  5FER A;  2MNZ A;  4L58 A;  1WES A;  2YHN A;  1VD4 A;  4X3G A;  3V43 A;  2IDA A;  4S3O C;  3LQI A;  3HCU A;  2MD8 C;  4ZQL A;  3ZVZ B;  5J3X A;  3N9Q A;  2KWN A;  3PUQ A;  1JM7 A;  5D1M B;  2KYU A;  4I7D A;  2KWK A;  2E6R A;  3L1X A;  2YSM A;  3N9M A;  3HTK C;  5LCW B;  3L11 A;  3LQJ A;  3IHP A;  5TRB A;  2LV9 A;  4I7B A;  2CT2 A;  1WIM A;  3N9P A;  1FBV A;  2LGL A;  2VPG A;  2CSY A;  4WZ0 A;  5H1V A;  2FUI A;  2JMJ A;  1LDJ B;  1XWH A;  4GNF A;  2MNY A;  4YAT A;  4A0C D;  3N9O A;  4PPE A;  2JRJ A;  1Z2Q A;  3KV6 A;  4XI1 A;  3L1Z B;  3U5N A;  4QF3 A;  5TDR A;  1X4U A;  3GV4 A;  2G43 A;  3KQI A;  2CKL B;  2FSA A;  4F52 B;  4YAB A;  5KH3 A;  1WEV A;  4I7C A;  4UP5 A;  4C9Z A;  2YQM A;  5B77 A;  2F6J A;  2RSD A;  2JMI A;  2M6M A;  4AYC B;  2G45 A;  2YW8 A;  2Y43 A;  4LKA A;  1E4U A;  3N9N A;  1N87 A;  5B75 A;  3C6W A;  2H0D B;  1WIL A;  2MUM A;  3DQV R;  3FL2 A;  5LKU A;  5FB0 A;  4FO9 A;  2Y1M A;  5H9M A;  5DKA A;  1T1H A;  3O35 A;  1ZBD B;  4V3L C;  4Q6F A;  1HYJ A;  3O7A A;  2PNX A;  4WA6 A;  3MHS A;  4B86 C;  3MHH A;  4QF2 A;  2AN6 A;  1K2F A;  1VYX A;  5B76 A;  1G25 A;  2E6S A;  2K17 A;  1WE9 A;  2HYE D;  3ZPV 1;  5AIT A;  4P5O B;  2F42 A;  2VJF A;  4YAD A;  2C2V S;  3ZTG A;  5LKT A;  2KRE A;  5LKX A;  3RPG C;  3PUR A;  5C13 A;  1WEE A;  1V87 A;  2M1R A;  4YAX A;  4GND A;  3DPL R;  3M62 A;  2L43 A;  1WGM A;  2VPD A;  5I3L A;  4BBQ A;  4PTB A;  3GL6 A;  2LGV A;  2KIZ A;  3ZNI A;  3HCS A;  2VP7 A;  1Z60 A;  2M85 A;  2QIC A;  2L80 A;  4A49 A;  1MM2 A;  4L7X A;  2XB1 A;  1DVP A;  4ZUX U;  4NN2 A;  3KV5 A;  3U5M A;  4BHW A;  4YC9 A;  5B8D A;  3HCT A;  1LDK C;  4AUQ B;  2LXP C;  3M99 A;  5D1L B;  2HDP A;  5G0F A;  2QJ0 A;  1Z6U A;  2PUY A;  2LQ6 A;  4CA1 A;  4GB0 A;  3C5K A;  4MSX A;  3T7L A;  2ECT A;  2VJF B;  3SOW A;  2LRI C;  4ZDT A;  3EB5 A;  4S3O B;  4WZ2 A;  5G05 B;  3KNV A;  5TBN A;  1X4I A;  1WEN A;  4V3K C;  3U5O A;  2L75 A;  2Y1N A;  2UZG A;  3SOX A;  2ECG A;  5FB1 A;  2KGG A;  1JM7 B;  5B78 A;  2YYR A;  3PHD A;  5LKZ A;  4CCG X;  2YHO A;  2YU4 A;  3O37 A;  1CHC A;  3EB6 A;  1JOC A;  5DIN A;  3N9L A;  2MT5 A;  4UP0 A;  2VPB A;  2KGI A;  5H1U A;  4YBS A;  2KFT A;  5KH9 A;  5TAB A;  4LJN A;  2RI7 A;  3U5P A;  2YT5 A;  5D1K B;  4GNG A;  4WZ3 B;  1BOR A;  1U6G B;  3ZPV E;  4A4C A;  2LGG A;  4GNE A;  2CSZ A;  2YUC A;  2VJE A;  1VFY A;  1WFK A;  2K16 A;  4LAD B;  2KR4 A;  1WEP A;  2C2L A;  1WEW A;  4R8P K;  2YSJ A;  2BAY A;  2NAA A; 
#chains in the Genus database with same CATH topology
 2RR4 A;  4YBT A;  2CKL A;  3NG2 A;  4R7E A;  2ECV A;  5B79 A;  2XOY A;  3SOU A;  1WEO A;  4LLB A;  3O36 A;  1X4J A;  2XEU A;  4W4U A;  2K4D A;  5AIU A;  2DJA A;  3LJU X;  2YRE A;  3VK6 A;  4AYC A;  1HYI A;  2IQJ A;  2DX8 A;  3SHB A;  2L0B A;  2H0D A;  3O47 A;  4UI9 B;  2D8S A;  3QZV A;  4YBM A;  3E2D A;  2MIQ A;  3FM8 C;  2ECJ A;  2JUN A;  4FK5 A;  3I2D A;  2MA5 A;  5FEY A;  1WEU A;  2KWO A;  1WEQ A;  2LN0 A;  1RMD A;  2KE1 A;  2LXH C;  2M3H A;  2ECN A;  2G6Q A;  4B7Y C;  4R2Y A;  2VJE B;  3RPG B;  2EOD A;  3M63 A;  2LDR A;  2MD7 B;  2I50 A;  3LVQ E;  3O34 A;  2OXQ C;  1MBM A;  1FP0 A;  2FUU A;  2YUR A;  4MVT A;  3T6R A;  4FJC A;  5JG6 A;  3FEH A;  3LQH A;  2L5U A;  2VNF A;  2VPE A;  2MA6 A;  5EYA F;  2CRW A;  1MM3 A;  4O64 A;  4F1P A;  4AVX A;  3RTR B;  2KU3 A;  2EA6 A;  5TDW A;  1IYM A;  4LK9 A;  4IC2 A;  2YQL A;  5G04 B;  3ASL A;  3O33 A;  2KWJ A;  2JMD A;  3O70 A;  5KH7 A;  2ECI A;  2QIZ A;  5SVY A;  2F6N A;  2LGK A;  2ZET C;  3FAN A;  5SVX A;  1F62 A;  3ZYQ A;  3ZVY A;  3LRQ A;  2ECW A;  4N3W A;  2E61 A;  1WEM A;  4Z0O A;  4H9D A;  2K1J A;  4FIP A;  5C11 A;  4A4B A;  5H1T A;  2EGP A;  4N4F A;  4TKP B;  4AP4 A;  4IC3 A;  5FER A;  2P57 A;  2MNZ A;  4L58 A;  1WES A;  2YHN A;  1VD4 A;  4X3G A;  3V43 A;  2IDA A;  4S3O C;  3LQI A;  3HCU A;  2MD8 C;  4ZQL A;  3ZVZ B;  5J3X A;  3N9Q A;  2KWN A;  3PUQ A;  1JM7 A;  5D1M B;  2KYU A;  4I7D A;  1DCQ A;  5SVI A;  2KWK A;  2E6R A;  3L1X A;  2YSM A;  3N9M A;  3HTK C;  5LCW B;  3L11 A;  3LQJ A;  3IHP A;  3LDY A;  5TRB A;  2LV9 A;  4I7B A;  2CT2 A;  3KDE C;  1WIM A;  3N9P A;  2JM3 A;  1FBV A;  3DDT A;  2LGL A;  2VPG A;  2CSY A;  4WZ0 A;  5H1V A;  2FUI A;  2JMJ A;  1LDJ B;  1XWH A;  4GNF A;  2MNY A;  4YAT A;  2EXU A;  4A0C D;  2D8U A;  3N9O A;  4PPE A;  2JRJ A;  1Z2Q A;  3KV6 A;  4XI1 A;  3L1Z B;  3U5N A;  2CSV A;  4QF3 A;  5TDR A;  1X4U A;  3GV4 A;  2G43 A;  3KQI A;  2CKL B;  2FSA A;  4F52 B;  2KKY A;  3DWD A;  4YAB A;  5KH3 A;  1WEV A;  5K3Q A;  2KKX A;  4I7C A;  4UP5 A;  4C9Z A;  2YQM A;  2MKE A;  5B77 A;  2F6J A;  2RSD A;  2JMI A;  2M6M A;  4AYC B;  2G45 A;  2YW8 A;  2Y43 A;  4LKA A;  1E4U A;  3N9N A;  1N87 A;  5B75 A;  3C6W A;  2H0D B;  1WIL A;  2MUM A;  2M13 A;  3DQV R;  3FL2 A;  5LKU A;  5FB0 A;  4FO9 A;  2Y1M A;  3T9K A;  4OGE A;  5H9M A;  5DKA A;  1T1H A;  3O35 A;  1ZBD B;  4V3L C;  3H7H A;  4Q6F A;  1HYJ A;  3O7A A;  2PNX A;  4WA6 A;  3MHS A;  4B86 C;  3MHH A;  4QF2 A;  2AN6 A;  2EGM A;  1K2F A;  1VYX A;  5B76 A;  1G25 A;  2CON A;  2E6S A;  2K17 A;  2FD4 A;  3PLW A;  1WE9 A;  2HYE D;  4QQ4 A;  3ZPV 1;  5AIT A;  4P5O B;  2F42 A;  2VJF A;  4YAD A;  2C2V S;  3ZTG A;  5LKT A;  2KRE A;  5LKX A;  3RPG C;  3PUR A;  5C13 A;  1WEE A;  1V87 A;  2M1R A;  4YAX A;  4GND A;  3Q1D A;  3DPL R;  3M62 A;  2L43 A;  3M7K A;  1WGM A;  2VPD A;  5I3L A;  4BBQ A;  4PTB A;  3GL6 A;  2LGV A;  2KIZ A;  3ZNI A;  3HCS A;  2VP7 A;  1Z60 A;  2M85 A;  4O62 A;  2QIC A;  2B0O E;  2L80 A;  4A49 A;  1MM2 A;  4L7X A;  2XB1 A;  3JUE A;  1DVP A;  4ZUX U;  4NN2 A;  3KV5 A;  3U5M A;  2DSM A;  2XOZ A;  4BHW A;  4YC9 A;  5B8D A;  3HCT A;  3MDB C;  1LDK C;  4AUQ B;  2LXP C;  3M99 A;  5D1L B;  2FFW A;  2HDP A;  5G0F A;  2QJ0 A;  1Z6U A;  2PUY A;  2LQ6 A;  4CA1 A;  4GB0 A;  3C5K A;  4MSX A;  2YVR A;  3T7L A;  2ECT A;  2VJF B;  4OGC A;  3SOW A;  2LRI C;  4ZDT A;  3EB5 A;  4S3O B;  4WZ2 A;  3FJU B;  5G05 B;  3KNV A;  2XP0 A;  5TBN A;  1X4I A;  1WEN A;  4V3K C;  3U5O A;  2L75 A;  2Y1N A;  2CRR A;  2UZG A;  3SOX A;  2ECG A;  5FB1 A;  2KGG A;  1JM7 B;  5B78 A;  2YYR A;  3PHD A;  5LKZ A;  4CCG X;  5SVI B;  2L7P A;  2YHO A;  2YU4 A;  3O37 A;  1CHC A;  3EB6 A;  1JOC A;  5DIN A;  3N9L A;  2MT5 A;  4UP0 A;  2VPB A;  2KGI A;  3FAO A;  4Z0R A;  5H1U A;  4YBS A;  2KFT A;  5KH9 A;  3SUB A;  5TAB A;  4LJN A;  2RI7 A;  3U5P A;  2YT5 A;  5D1K B;  4GNG A;  4WZ3 B;  1BOR A;  1U6G B;  3ZPV E;  2OWA A;  4A4C A;  2LGG A;  4GNE A;  2XOC A;  2CSZ A;  2YUC A;  2LAU A;  2VJE A;  1VFY A;  1WFK A;  2K16 A;  4LAD B;  2KR4 A;  1WEP A;  2C2L A;  1WEW A;  4R8P K;  2YSJ A;  3LVR E;  2BAY A;  2NAA A; 
#chains in the Genus database with same CATH homology
 4YBT A;  2CKL A;  3NG2 A;  4R7E A;  2ECV A;  5B79 A;  3SOU A;  1WEO A;  4LLB A;  3O36 A;  1X4J A;  2XEU A;  4W4U A;  2K4D A;  5AIU A;  2YRE A;  3VK6 A;  4AYC A;  1HYI A;  2DX8 A;  3SHB A;  2L0B A;  2H0D A;  4UI9 B;  2D8S A;  3QZV A;  4YBM A;  2MIQ A;  2ECJ A;  4FK5 A;  3I2D A;  2MA5 A;  5FEY A;  1WEU A;  2KWO A;  1WEQ A;  2LN0 A;  1RMD A;  2KE1 A;  2LXH C;  2M3H A;  2ECN A;  2G6Q A;  4B7Y C;  4R2Y A;  2VJE B;  3RPG B;  2EOD A;  3M63 A;  2LDR A;  2MD7 B;  2I50 A;  3O34 A;  2OXQ C;  1FP0 A;  2FUU A;  2YUR A;  4MVT A;  3T6R A;  4FJC A;  5JG6 A;  3LQH A;  2L5U A;  2VNF A;  2VPE A;  2MA6 A;  5EYA F;  1MM3 A;  4O64 A;  4AVX A;  3RTR B;  2KU3 A;  2EA6 A;  5TDW A;  1IYM A;  4LK9 A;  4IC2 A;  2YQL A;  5G04 B;  3ASL A;  3O33 A;  2KWJ A;  2JMD A;  3O70 A;  5KH7 A;  2ECI A;  2QIZ A;  2F6N A;  2LGK A;  2ZET C;  1F62 A;  3ZYQ A;  3ZVY A;  3LRQ A;  2ECW A;  4N3W A;  1WEM A;  2K1J A;  4FIP A;  5C11 A;  4A4B A;  5H1T A;  2EGP A;  4N4F A;  4TKP B;  4AP4 A;  4IC3 A;  5FER A;  2MNZ A;  4L58 A;  1WES A;  2YHN A;  1VD4 A;  4X3G A;  3V43 A;  2IDA A;  4S3O C;  3LQI A;  3HCU A;  2MD8 C;  4ZQL A;  3ZVZ B;  5J3X A;  3N9Q A;  2KWN A;  3PUQ A;  1JM7 A;  5D1M B;  2KYU A;  4I7D A;  2KWK A;  2E6R A;  3L1X A;  2YSM A;  3N9M A;  3HTK C;  5LCW B;  3L11 A;  3LQJ A;  3IHP A;  5TRB A;  2LV9 A;  4I7B A;  2CT2 A;  1WIM A;  3N9P A;  1FBV A;  2LGL A;  2VPG A;  2CSY A;  4WZ0 A;  5H1V A;  2FUI A;  2JMJ A;  1LDJ B;  1XWH A;  4GNF A;  2MNY A;  4YAT A;  4A0C D;  3N9O A;  4PPE A;  2JRJ A;  1Z2Q A;  3KV6 A;  4XI1 A;  3L1Z B;  3U5N A;  4QF3 A;  5TDR A;  1X4U A;  3GV4 A;  2G43 A;  3KQI A;  2CKL B;  2FSA A;  4F52 B;  4YAB A;  5KH3 A;  1WEV A;  4I7C A;  4UP5 A;  4C9Z A;  2YQM A;  5B77 A;  2F6J A;  2RSD A;  2JMI A;  2M6M A;  4AYC B;  2G45 A;  2YW8 A;  2Y43 A;  4LKA A;  1E4U A;  3N9N A;  1N87 A;  5B75 A;  3C6W A;  2H0D B;  1WIL A;  2MUM A;  3DQV R;  3FL2 A;  5LKU A;  5FB0 A;  4FO9 A;  2Y1M A;  5H9M A;  5DKA A;  1T1H A;  3O35 A;  1ZBD B;  4V3L C;  4Q6F A;  1HYJ A;  3O7A A;  2PNX A;  4WA6 A;  3MHS A;  4B86 C;  3MHH A;  4QF2 A;  2AN6 A;  1K2F A;  1VYX A;  5B76 A;  1G25 A;  2E6S A;  2K17 A;  1WE9 A;  2HYE D;  3ZPV 1;  5AIT A;  4P5O B;  2F42 A;  2VJF A;  4YAD A;  2C2V S;  3ZTG A;  5LKT A;  2KRE A;  5LKX A;  3RPG C;  3PUR A;  5C13 A;  1WEE A;  1V87 A;  2M1R A;  4YAX A;  4GND A;  3DPL R;  3M62 A;  2L43 A;  1WGM A;  2VPD A;  5I3L A;  4BBQ A;  4PTB A;  3GL6 A;  2LGV A;  2KIZ A;  3ZNI A;  3HCS A;  2VP7 A;  1Z60 A;  2M85 A;  2QIC A;  2L80 A;  4A49 A;  1MM2 A;  4L7X A;  2XB1 A;  1DVP A;  4ZUX U;  4NN2 A;  3KV5 A;  3U5M A;  4BHW A;  4YC9 A;  5B8D A;  3HCT A;  1LDK C;  4AUQ B;  2LXP C;  3M99 A;  5D1L B;  2HDP A;  5G0F A;  2QJ0 A;  1Z6U A;  2PUY A;  2LQ6 A;  4CA1 A;  4GB0 A;  3C5K A;  4MSX A;  3T7L A;  2ECT A;  2VJF B;  3SOW A;  2LRI C;  4ZDT A;  3EB5 A;  4S3O B;  4WZ2 A;  5G05 B;  3KNV A;  5TBN A;  1X4I A;  1WEN A;  4V3K C;  3U5O A;  2L75 A;  2Y1N A;  2UZG A;  3SOX A;  2ECG A;  5FB1 A;  2KGG A;  1JM7 B;  5B78 A;  2YYR A;  3PHD A;  5LKZ A;  4CCG X;  2YHO A;  2YU4 A;  3O37 A;  1CHC A;  3EB6 A;  1JOC A;  5DIN A;  3N9L A;  2MT5 A;  4UP0 A;  2VPB A;  2KGI A;  5H1U A;  4YBS A;  2KFT A;  5KH9 A;  5TAB A;  4LJN A;  2RI7 A;  3U5P A;  2YT5 A;  5D1K B;  4GNG A;  4WZ3 B;  1BOR A;  1U6G B;  3ZPV E;  4A4C A;  2LGG A;  4GNE A;  2CSZ A;  2YUC A;  2VJE A;  1VFY A;  1WFK A;  2K16 A;  4LAD B;  2KR4 A;  1WEP A;  2C2L A;  1WEW A;  4R8P K;  2YSJ A;  2BAY A;  2NAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...