3ZPVE

Crystal structure of drosophila pygo phd finger in complex with legless hd1 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
AAMAIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN BCL9 HOMOLOG
publication title Evolutionary Adaptation of the Fly Pygo Phd Finger Towards Recognizing Histone H3 Tail Methylated at Arginine 2
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 11
structure length 62
sequence length 62
chains with identical sequence O, Y
ec nomenclature
pdb deposition date 2013-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zpvE00
2KFTA 2LQ6A 1CHCA 5G0FA 4R8PK 1WE9A 1WEQA 5C13A 2L43A 3N9LA 3ZPVE 4AYCA 5LCWB 4YBSA 1WIMA 2LGKA 5KH7A 2KYUA 2VPBA 3ZTGA 5D1KB 1WEWA 2VJFB 2AN6A 2YHNA 2YU4A 2KGGA 4GNFA 3KV6A 4V3LC 5EYAF 4V3KC 1WEVA 2H0DA 2FUUA 3U5NA 5C11A 5DINA 1WEOA 5B76A 1Z2QA 2RSDA 5FEYA 1WILA 4YATA 5TDWA 4GNDA 3M62A 3PHDA 4B7YC 4NN2A 2KU3A 2LN0A 2M85A 2QICA 2NAAA 2ECJA 2D8SA 2YHOA 4A0CD 1WESA 2E6SA 3DQVR 4GNGA 2VJEA 4UP0A 3KQIA 4YADA 1X4IA 3SOUA 4W4UA 2F6NA 4LLBA 2K16A 2F42A 1WEEA 2JMJA 2YW8A 4GB0A 2MA6A 2YQLA 3VK6A 1HYIA 2MT5A 2ECVA 1G25A 2KIZA 1V87A 4IC3A 3GV4A 4MVTA 2IDAA 1VD4A 3U5MA 2Y43A 4PPEA 4N3WA 5H1UA 4CCGX 2YSMA 1DVPA 4PTBA 2YUCA 4GNEA 3SOXA 2EODA 4R7EA 3NG2A 1ZBDB 2E6RA 3MHHA 3FL2A 3O70A 3GL6A 5KH3A 2JMDA 3MHSA 2MNYA 2Y1MA 1JM7A 4C9ZA 2FSAA 2Y1NA 4FIPA 2L0BA 4QF3A 4IC2A 4X3GA 4I7CA 2VNFA 2FUIA 3RPGC 5D1LB 3IHPA 3C6WA 3O35A 4L7XA 4YBMA 2DX8A 2MNZA 5G05B 2OXQC 1FBVA 4A4CA 5LKXA 2YURA 1XWHA 5AIUA 3U5OA 2UZGA 3U5PA 1T1HA 2KWJA 2EA6A 1K2FA 2XEUA 4ZQLA 5G04B 2HYED 1FP0A 1U6GB 5D1MB 4WZ2A 2KWKA 2LGLA 3PUQA 3SOWA 4MSXA 2M6MA 2QIZA 3HCUA 4B86C 5B75A 2CT2A 2VJFA 2YREA 3ZYQA 4S3OC 2CKLB 2YT5A 2L5UA 4A4BA 2ECWA 2YSJA 3SHBA 2VPDA 2K4DA 4CA1A 2CSYA 2L80A 4LK9A 5B79A 5FERA 1WGMA 2K1JA 4AYCB 5H1VA 2YYRA 3ASLA 1HYJA 4UP5A 5LKTA 4ZDTA 3RPGB 5B8DA 2XB1A 4R2YA 2QJ0A 3N9MA 2JRJA 4UI9B 4TKPB 3O34A 5LKZA 5TRBA 4Q6FA 5KH9A 4YABA 5H9MA 1VYXA 2BAYA 3ZVZB 1N87A 1F62A 2CSZA 5AITA 3M63A 5J3XA 3ZVYA 5TBNA 2C2LA 2MD7B 4FK5A 2I50A 2KREA 2M1RA 1WEMA 3PURA 2ECTA 2CKLA 4WZ3B 1LDKC 4WA6A 3KV5A 4AP4A 4O64A 5DKAA 5TDRA 2LXHC 1RMDA 3O37A 5B77A 5B78A 2ECIA 2KGIA 2ECNA 2VJEB 2EGPA 1MM3A 1X4JA 3KNVA 4LKAA 2JMIA 3T6RA 1Z6UA 4LADB 4S3OB 5JG6A 2MD8C 2MA5A 5TABA 1WFKA 4YAXA 4A49A 3N9QA 3O7AA 1E4UA 2M3HA 1Z60A 2VPEA 2VPGA 2G43A 4N4FA 2MUMA 2YQMA 3C5KA 2KR4A 4I7DA 5FB0A 2C2VS 2G6QA 3QZVA 2LGVA 2HDPA 3LQIA 1VFYA 3LQHA 2VP7A 3V43A 2ZETC 4YBTA 3LQJA 2KE1A 4AVXA 3EB5A 1X4UA 4L58A 4P5OB 1JOCA 4WZ0A 4ZUXU 4AUQB 2F6JA 4I7BA 3N9NA 1BORA 3DPLR 3L1ZB 3ZPV1 4LJNA 2K17A 3N9PA 4BBQA 1JM7B 3N9OA 3O33A 3I2DA 3EB6A 1WEPA 3L1XA 2G45A 2PUYA 4FJCA 5FB1A 5H1TA 2LGGA 4BHWA 4F52B 4QF2A 3HCTA 2LDRA 3O36A 2LXPC 2H0DB 1WEUA 2MIQA 3HTKC 3ZNIA 2LRIC 3T7LA 1IYMA 3RTRB 2RI7A 2LV9A 2PNXA 1LDJB 2L75A 3LRQA 1MM2A 4YC9A 2KWOA 5I3LA 4FO9A 3HCSA 3M99A 2ECGA 3L11A 4XI1A 5LKUA 1WENA 2KWNA
chains in the Genus database with same CATH superfamily
2KFTA 2LQ6A 1CHCA 5G0FA 4OGCA 4R8PK 2E61A 3LJUX 1WE9A 1WEQA 5C13A 2L43A 3N9LA 3ZPVE 4AYCA 5LCWB 4YBSA 1WIMA 2LGKA 2XP0A 5KH7A 2KYUA 2VPBA 3ZTGA 5D1KB 1WEWA 2VJFB 2AN6A 2YHNA 2YU4A 2KGGA 4GNFA 3KV6A 4V3LC 5EYAF 4V3KC 2XOZA 1WEVA 2H0DA 3JUEA 2FUUA 3U5NA 5C11A 5DINA 1WEOA 5B76A 2L7PA 1Z2QA 2RSDA 5FEYA 1WILA 2LAUA 4YATA 5TDWA 1MBMA 4GNDA 5SVYA 3M62A 3PHDA 4B7YC 3FJUB 4Z0OA 3FANA 4NN2A 2KU3A 2LN0A 2M85A 2QICA 2XOYA 2NAAA 2ECJA 2D8SA 2YHOA 4A0CD 1WESA 2E6SA 3DQVR 4GNGA 2VJEA 4UP0A 3KQIA 4YADA 3DWDA 1X4IA 3SOUA 4W4UA 2F6NA 4LLBA 3LVRE 2K16A 2F42A 1WEEA 2JMJA 2YW8A 4GB0A 2MA6A 2YQLA 3VK6A 3Q1DA 2MT5A 2ECVA 1HYIA 1G25A 2KIZA 1V87A 4IC3A 3GV4A 2DSMA 4MVTA 2IDAA 1VD4A 3U5MA 3H7HA 2Y43A 4PPEA 4N3WA 5H1UA 4CCGX 2YSMA 1DVPA 4PTBA 2YUCA 4GNEA 3SOXA 2EODA 4R7EA 3NG2A 1ZBDB 2E6RA 2B0OE 3MHHA 3FL2A 3O70A 3GL6A 2KKXA 5KH3A 2JMDA 3MHSA 2MNYA 2Y1MA 1JM7A 5K3QA 4C9ZA 2FSAA 2Y1NA 4FIPA 2L0BA 4QF3A 2RR4A 4IC2A 4X3GA 4I7CA 2VNFA 2YVRA 2FUIA 3RPGC 5D1LB 3IHPA 5SVXA 2JUNA 3C6WA 3O35A 4L7XA 4YBMA 2DX8A 2EGMA 2FD4A 2MNZA 5G05B 2OXQC 1FBVA 4A4CA 5LKXA 2YURA 1XWHA 5AIUA 3U5OA 2UZGA 3U5PA 1T1HA 3FAOA 2KWJA 2EA6A 1K2FA 5SVIA 2XEUA 4ZQLA 5G04B 2HYED 1FP0A 3T9KA 4O62A 1U6GB 5D1MB 3DDTA 4WZ2A 2KWKA 2LGLA 3PUQA 3SOWA 4MSXA 2M6MA 3FEHA 2QIZA 4F1PA 3HCUA 4B86C 2P57A 5B75A 2CT2A 2D8UA 2DJAA 2VJFA 2YREA 3ZYQA 4S3OC 2CKLB 2YT5A 2L5UA 4A4BA 4H9DA 2ECWA 2YSJA 3SHBA 2VPDA 2K4DA 4CA1A 2CSYA 2L80A 4LK9A 5B79A 3KDEC 5FERA 1WGMA 2K1JA 4AYCB 5H1VA 2YYRA 3ASLA 1HYJA 4UP5A 2CONA 5LKTA 4ZDTA 3RPGB 5B8DA 3LVQE 2XB1A 4R2YA 2QJ0A 2IQJA 3N9MA 2MKEA 2JRJA 4UI9B 4TKPB 3O34A 5LKZA 5TRBA 4Q6FA 5KH9A 3O47A 4YABA 5H9MA 1VYXA 2BAYA 3ZVZB 1N87A 1F62A 2CSZA 5AITA 3M63A 5J3XA 3ZVYA 5TBNA 2C2LA 2MD7B 4FK5A 2I50A 2KREA 2M1RA 1WEMA 3PURA 2ECTA 2CKLA 4WZ3B 1LDKC 4WA6A 3KV5A 2CRRA 4AP4A 4O64A 5DKAA 5TDRA 2LXHC 1RMDA 3O37A 5B77A 5B78A 2ECIA 2KGIA 3M7KA 2ECNA 2JM3A 2VJEB 2EGPA 1MM3A 2FFWA 1X4JA 3KNVA 4LKAA 2JMIA 3T6RA 1Z6UA 4LADB 4S3OB 1DCQA 5JG6A 2MD8C 2MA5A 5TABA 1WFKA 4YAXA 4A49A 3N9QA 3O7AA 1E4UA 2M3HA 1Z60A 2VPEA 2VPGA 2CSVA 2G43A 4N4FA 2MUMA 2YQMA 4QQ4A 3C5KA 2KR4A 4I7DA 5FB0A 3SUBA 2C2VS 2G6QA 3QZVA 2LGVA 2OWAA 2HDPA 3LQIA 1VFYA 3LQHA 3MDBC 2VP7A 3V43A 2ZETC 4YBTA 3LQJA 2KE1A 4AVXA 3EB5A 1X4UA 4L58A 4P5OB 1JOCA 4WZ0A 4ZUXU 4AUQB 3LDYA 2F6JA 2CRWA 4I7BA 3N9NA 4OGEA 1BORA 3DPLR 3L1ZB 3ZPV1 4LJNA 2K17A 3N9PA 4BBQA 1JM7B 3N9OA 2EXUA 3O33A 3I2DA 3EB6A 1WEPA 3L1XA 2KKYA 2G45A 2M13A 2PUYA 4FJCA 5FB1A 5H1TA 2LGGA 4BHWA 4F52B 4QF2A 2XOCA 3HCTA 2LDRA 3O36A 2LXPC 2H0DB 3PLWA 1WEUA 2MIQA 3HTKC 3ZNIA 2LRIC 3T7LA 1IYMA 3FM8C 2RI7A 3RTRB 5SVIB 2LV9A 2PNXA 4Z0RA 1LDJB 2L75A 3LRQA 1MM2A 4YC9A 2KWOA 5I3LA 4FO9A 3HCSA 3M99A 2ECGA 3L11A 4XI1A 5LKUA 1WENA 2KWNA 3E2DA
chains in the Genus database with same CATH topology
2KFTA 2LQ6A 1CHCA 5G0FA 4R8PK 1WE9A 1WEQA 5C13A 2L43A 3N9LA 3ZPVE 4AYCA 5LCWB 4YBSA 1WIMA 2LGKA 5KH7A 2KYUA 2VPBA 3ZTGA 5D1KB 1WEWA 2VJFB 2AN6A 2YHNA 2YU4A 2KGGA 4GNFA 3KV6A 4V3LC 5EYAF 4V3KC 1WEVA 2H0DA 2FUUA 3U5NA 5C11A 5DINA 1WEOA 5B76A 1Z2QA 2RSDA 5FEYA 1WILA 4YATA 5TDWA 4GNDA 3M62A 3PHDA 4B7YC 4NN2A 2KU3A 2LN0A 2M85A 2QICA 2NAAA 2ECJA 2D8SA 2YHOA 4A0CD 1WESA 2E6SA 3DQVR 4GNGA 2VJEA 4UP0A 3KQIA 4YADA 1X4IA 3SOUA 4W4UA 2F6NA 4LLBA 2K16A 2F42A 1WEEA 2JMJA 2YW8A 4GB0A 2MA6A 2YQLA 3VK6A 1HYIA 2MT5A 2ECVA 1G25A 2KIZA 1V87A 4IC3A 3GV4A 4MVTA 2IDAA 1VD4A 3U5MA 2Y43A 4PPEA 4N3WA 5H1UA 4CCGX 2YSMA 1DVPA 4PTBA 2YUCA 4GNEA 3SOXA 2EODA 4R7EA 3NG2A 1ZBDB 2E6RA 3MHHA 3FL2A 3O70A 3GL6A 5KH3A 2JMDA 3MHSA 2MNYA 2Y1MA 1JM7A 4C9ZA 2FSAA 2Y1NA 4FIPA 2L0BA 4QF3A 4IC2A 4X3GA 4I7CA 2VNFA 2FUIA 3RPGC 5D1LB 3IHPA 3C6WA 3O35A 4L7XA 4YBMA 2DX8A 2MNZA 5G05B 2OXQC 1FBVA 4A4CA 5LKXA 2YURA 1XWHA 5AIUA 3U5OA 2UZGA 3U5PA 1T1HA 2KWJA 2EA6A 1K2FA 2XEUA 4ZQLA 5G04B 2HYED 1FP0A 1U6GB 5D1MB 4WZ2A 2KWKA 2LGLA 3PUQA 3SOWA 4MSXA 2M6MA 2QIZA 3HCUA 4B86C 5B75A 2CT2A 2VJFA 2YREA 3ZYQA 4S3OC 2CKLB 2YT5A 2L5UA 4A4BA 2ECWA 2YSJA 3SHBA 2VPDA 2K4DA 4CA1A 2CSYA 2L80A 4LK9A 5B79A 5FERA 1WGMA 2K1JA 4AYCB 5H1VA 2YYRA 3ASLA 1HYJA 4UP5A 5LKTA 4ZDTA 3RPGB 5B8DA 2XB1A 4R2YA 2QJ0A 3N9MA 2JRJA 4UI9B 4TKPB 3O34A 5LKZA 5TRBA 4Q6FA 5KH9A 4YABA 5H9MA 1VYXA 2BAYA 3ZVZB 1N87A 1F62A 2CSZA 5AITA 3M63A 5J3XA 3ZVYA 5TBNA 2C2LA 2MD7B 4FK5A 2I50A 2KREA 2M1RA 1WEMA 3PURA 2ECTA 2CKLA 4WZ3B 1LDKC 4WA6A 3KV5A 4AP4A 4O64A 5DKAA 5TDRA 2LXHC 1RMDA 3O37A 5B77A 5B78A 2ECIA 2KGIA 2ECNA 2VJEB 2EGPA 1MM3A 1X4JA 3KNVA 4LKAA 2JMIA 3T6RA 1Z6UA 4LADB 4S3OB 5JG6A 2MD8C 2MA5A 5TABA 1WFKA 4YAXA 4A49A 3N9QA 3O7AA 1E4UA 2M3HA 1Z60A 2VPEA 2VPGA 2G43A 4N4FA 2MUMA 2YQMA 3C5KA 2KR4A 4I7DA 5FB0A 2C2VS 2G6QA 3QZVA 2LGVA 2HDPA 3LQIA 1VFYA 3LQHA 2VP7A 3V43A 2ZETC 4YBTA 3LQJA 2KE1A 4AVXA 3EB5A 1X4UA 4L58A 4P5OB 1JOCA 4WZ0A 4ZUXU 4AUQB 2F6JA 4I7BA 3N9NA 1BORA 3DPLR 3L1ZB 3ZPV1 4LJNA 2K17A 3N9PA 4BBQA 1JM7B 3N9OA 3O33A 3I2DA 3EB6A 1WEPA 3L1XA 2G45A 2PUYA 4FJCA 5FB1A 5H1TA 2LGGA 4BHWA 4F52B 4QF2A 3HCTA 2LDRA 3O36A 2LXPC 2H0DB 1WEUA 2MIQA 3HTKC 3ZNIA 2LRIC 3T7LA 1IYMA 3RTRB 2RI7A 2LV9A 2PNXA 1LDJB 2L75A 3LRQA 1MM2A 4YC9A 2KWOA 5I3LA 4FO9A 3HCSA 3M99A 2ECGA 3L11A 4XI1A 5LKUA 1WENA 2KWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFT A;  2LQ6 A;  1CHC A;  5G0F A;  4R8P K;  1WE9 A;  1WEQ A;  5C13 A;  2L43 A;  3N9L A;  3ZPV E;  4AYC A;  5LCW B;  4YBS A;  1WIM A;  2LGK A;  5KH7 A;  2KYU A;  2VPB A;  3ZTG A;  5D1K B;  1WEW A;  2VJF B;  2AN6 A;  2YHN A;  2YU4 A;  2KGG A;  4GNF A;  3KV6 A;  4V3L C;  5EYA F;  4V3K C;  1WEV A;  2H0D A;  2FUU A;  3U5N A;  5C11 A;  5DIN A;  1WEO A;  5B76 A;  1Z2Q A;  2RSD A;  5FEY A;  1WIL A;  4YAT A;  5TDW A;  4GND A;  3M62 A;  3PHD A;  4B7Y C;  4NN2 A;  2KU3 A;  2LN0 A;  2M85 A;  2QIC A;  2NAA A;  2ECJ A;  2D8S A;  2YHO A;  4A0C D;  1WES A;  2E6S A;  3DQV R;  4GNG A;  2VJE A;  4UP0 A;  3KQI A;  4YAD A;  1X4I A;  3SOU A;  4W4U A;  2F6N A;  4LLB A;  2K16 A;  2F42 A;  1WEE A;  2JMJ A;  2YW8 A;  4GB0 A;  2MA6 A;  2YQL A;  3VK6 A;  1HYI A;  2MT5 A;  2ECV A;  1G25 A;  2KIZ A;  1V87 A;  4IC3 A;  3GV4 A;  4MVT A;  2IDA A;  1VD4 A;  3U5M A;  2Y43 A;  4PPE A;  4N3W A;  5H1U A;  4CCG X;  2YSM A;  1DVP A;  4PTB A;  2YUC A;  4GNE A;  3SOX A;  2EOD A;  4R7E A;  3NG2 A;  1ZBD B;  2E6R A;  3MHH A;  3FL2 A;  3O70 A;  3GL6 A;  5KH3 A;  2JMD A;  3MHS A;  2MNY A;  2Y1M A;  1JM7 A;  4C9Z A;  2FSA A;  2Y1N A;  4FIP A;  2L0B A;  4QF3 A;  4IC2 A;  4X3G A;  4I7C A;  2VNF A;  2FUI A;  3RPG C;  5D1L B;  3IHP A;  3C6W A;  3O35 A;  4L7X A;  4YBM A;  2DX8 A;  2MNZ A;  5G05 B;  2OXQ C;  1FBV A;  4A4C A;  5LKX A;  2YUR A;  1XWH A;  5AIU A;  3U5O A;  2UZG A;  3U5P A;  1T1H A;  2KWJ A;  2EA6 A;  1K2F A;  2XEU A;  4ZQL A;  5G04 B;  2HYE D;  1FP0 A;  1U6G B;  5D1M B;  4WZ2 A;  2KWK A;  2LGL A;  3PUQ A;  3SOW A;  4MSX A;  2M6M A;  2QIZ A;  3HCU A;  4B86 C;  5B75 A;  2CT2 A;  2VJF A;  2YRE A;  3ZYQ A;  4S3O C;  2CKL B;  2YT5 A;  2L5U A;  4A4B A;  2ECW A;  2YSJ A;  3SHB A;  2VPD A;  2K4D A;  4CA1 A;  2CSY A;  2L80 A;  4LK9 A;  5B79 A;  5FER A;  1WGM A;  2K1J A;  4AYC B;  5H1V A;  2YYR A;  3ASL A;  1HYJ A;  4UP5 A;  5LKT A;  4ZDT A;  3RPG B;  5B8D A;  2XB1 A;  4R2Y A;  2QJ0 A;  3N9M A;  2JRJ A;  4UI9 B;  4TKP B;  3O34 A;  5LKZ A;  5TRB A;  4Q6F A;  5KH9 A;  4YAB A;  5H9M A;  1VYX A;  2BAY A;  3ZVZ B;  1N87 A;  1F62 A;  2CSZ A;  5AIT A;  3M63 A;  5J3X A;  3ZVY A;  5TBN A;  2C2L A;  2MD7 B;  4FK5 A;  2I50 A;  2KRE A;  2M1R A;  1WEM A;  3PUR A;  2ECT A;  2CKL A;  4WZ3 B;  1LDK C;  4WA6 A;  3KV5 A;  4AP4 A;  4O64 A;  5DKA A;  5TDR A;  2LXH C;  1RMD A;  3O37 A;  5B77 A;  5B78 A;  2ECI A;  2KGI A;  2ECN A;  2VJE B;  2EGP A;  1MM3 A;  1X4J A;  3KNV A;  4LKA A;  2JMI A;  3T6R A;  1Z6U A;  4LAD B;  4S3O B;  5JG6 A;  2MD8 C;  2MA5 A;  5TAB A;  1WFK A;  4YAX A;  4A49 A;  3N9Q A;  3O7A A;  1E4U A;  2M3H A;  1Z60 A;  2VPE A;  2VPG A;  2G43 A;  4N4F A;  2MUM A;  2YQM A;  3C5K A;  2KR4 A;  4I7D A;  5FB0 A;  2C2V S;  2G6Q A;  3QZV A;  2LGV A;  2HDP A;  3LQI A;  1VFY A;  3LQH A;  2VP7 A;  3V43 A;  2ZET C;  4YBT A;  3LQJ A;  2KE1 A;  4AVX A;  3EB5 A;  1X4U A;  4L58 A;  4P5O B;  1JOC A;  4WZ0 A;  4ZUX U;  4AUQ B;  2F6J A;  4I7B A;  3N9N A;  1BOR A;  3DPL R;  3L1Z B;  3ZPV 1;  4LJN A;  2K17 A;  3N9P A;  4BBQ A;  1JM7 B;  3N9O A;  3O33 A;  3I2D A;  3EB6 A;  1WEP A;  3L1X A;  2G45 A;  2PUY A;  4FJC A;  5FB1 A;  5H1T A;  2LGG A;  4BHW A;  4F52 B;  4QF2 A;  3HCT A;  2LDR A;  3O36 A;  2LXP C;  2H0D B;  1WEU A;  2MIQ A;  3HTK C;  3ZNI A;  2LRI C;  3T7L A;  1IYM A;  3RTR B;  2RI7 A;  2LV9 A;  2PNX A;  1LDJ B;  2L75 A;  3LRQ A;  1MM2 A;  4YC9 A;  2KWO A;  5I3L A;  4FO9 A;  3HCS A;  3M99 A;  2ECG A;  3L11 A;  4XI1 A;  5LKU A;  1WEN A;  2KWN A; 
#chains in the Genus database with same CATH topology
 2KFT A;  2LQ6 A;  1CHC A;  5G0F A;  4OGC A;  4R8P K;  2E61 A;  3LJU X;  1WE9 A;  1WEQ A;  5C13 A;  2L43 A;  3N9L A;  3ZPV E;  4AYC A;  5LCW B;  4YBS A;  1WIM A;  2LGK A;  2XP0 A;  5KH7 A;  2KYU A;  2VPB A;  3ZTG A;  5D1K B;  1WEW A;  2VJF B;  2AN6 A;  2YHN A;  2YU4 A;  2KGG A;  4GNF A;  3KV6 A;  4V3L C;  5EYA F;  4V3K C;  2XOZ A;  1WEV A;  2H0D A;  3JUE A;  2FUU A;  3U5N A;  5C11 A;  5DIN A;  1WEO A;  5B76 A;  2L7P A;  1Z2Q A;  2RSD A;  5FEY A;  1WIL A;  2LAU A;  4YAT A;  5TDW A;  1MBM A;  4GND A;  5SVY A;  3M62 A;  3PHD A;  4B7Y C;  3FJU B;  4Z0O A;  3FAN A;  4NN2 A;  2KU3 A;  2LN0 A;  2M85 A;  2QIC A;  2XOY A;  2NAA A;  2ECJ A;  2D8S A;  2YHO A;  4A0C D;  1WES A;  2E6S A;  3DQV R;  4GNG A;  2VJE A;  4UP0 A;  3KQI A;  4YAD A;  3DWD A;  1X4I A;  3SOU A;  4W4U A;  2F6N A;  4LLB A;  3LVR E;  2K16 A;  2F42 A;  1WEE A;  2JMJ A;  2YW8 A;  4GB0 A;  2MA6 A;  2YQL A;  3VK6 A;  3Q1D A;  2MT5 A;  2ECV A;  1HYI A;  1G25 A;  2KIZ A;  1V87 A;  4IC3 A;  3GV4 A;  2DSM A;  4MVT A;  2IDA A;  1VD4 A;  3U5M A;  3H7H A;  2Y43 A;  4PPE A;  4N3W A;  5H1U A;  4CCG X;  2YSM A;  1DVP A;  4PTB A;  2YUC A;  4GNE A;  3SOX A;  2EOD A;  4R7E A;  3NG2 A;  1ZBD B;  2E6R A;  2B0O E;  3MHH A;  3FL2 A;  3O70 A;  3GL6 A;  2KKX A;  5KH3 A;  2JMD A;  3MHS A;  2MNY A;  2Y1M A;  1JM7 A;  5K3Q A;  4C9Z A;  2FSA A;  2Y1N A;  4FIP A;  2L0B A;  4QF3 A;  2RR4 A;  4IC2 A;  4X3G A;  4I7C A;  2VNF A;  2YVR A;  2FUI A;  3RPG C;  5D1L B;  3IHP A;  5SVX A;  2JUN A;  3C6W A;  3O35 A;  4L7X A;  4YBM A;  2DX8 A;  2EGM A;  2FD4 A;  2MNZ A;  5G05 B;  2OXQ C;  1FBV A;  4A4C A;  5LKX A;  2YUR A;  1XWH A;  5AIU A;  3U5O A;  2UZG A;  3U5P A;  1T1H A;  3FAO A;  2KWJ A;  2EA6 A;  1K2F A;  5SVI A;  2XEU A;  4ZQL A;  5G04 B;  2HYE D;  1FP0 A;  3T9K A;  4O62 A;  1U6G B;  5D1M B;  3DDT A;  4WZ2 A;  2KWK A;  2LGL A;  3PUQ A;  3SOW A;  4MSX A;  2M6M A;  3FEH A;  2QIZ A;  4F1P A;  3HCU A;  4B86 C;  2P57 A;  5B75 A;  2CT2 A;  2D8U A;  2DJA A;  2VJF A;  2YRE A;  3ZYQ A;  4S3O C;  2CKL B;  2YT5 A;  2L5U A;  4A4B A;  4H9D A;  2ECW A;  2YSJ A;  3SHB A;  2VPD A;  2K4D A;  4CA1 A;  2CSY A;  2L80 A;  4LK9 A;  5B79 A;  3KDE C;  5FER A;  1WGM A;  2K1J A;  4AYC B;  5H1V A;  2YYR A;  3ASL A;  1HYJ A;  4UP5 A;  2CON A;  5LKT A;  4ZDT A;  3RPG B;  5B8D A;  3LVQ E;  2XB1 A;  4R2Y A;  2QJ0 A;  2IQJ A;  3N9M A;  2MKE A;  2JRJ A;  4UI9 B;  4TKP B;  3O34 A;  5LKZ A;  5TRB A;  4Q6F A;  5KH9 A;  3O47 A;  4YAB A;  5H9M A;  1VYX A;  2BAY A;  3ZVZ B;  1N87 A;  1F62 A;  2CSZ A;  5AIT A;  3M63 A;  5J3X A;  3ZVY A;  5TBN A;  2C2L A;  2MD7 B;  4FK5 A;  2I50 A;  2KRE A;  2M1R A;  1WEM A;  3PUR A;  2ECT A;  2CKL A;  4WZ3 B;  1LDK C;  4WA6 A;  3KV5 A;  2CRR A;  4AP4 A;  4O64 A;  5DKA A;  5TDR A;  2LXH C;  1RMD A;  3O37 A;  5B77 A;  5B78 A;  2ECI A;  2KGI A;  3M7K A;  2ECN A;  2JM3 A;  2VJE B;  2EGP A;  1MM3 A;  2FFW A;  1X4J A;  3KNV A;  4LKA A;  2JMI A;  3T6R A;  1Z6U A;  4LAD B;  4S3O B;  1DCQ A;  5JG6 A;  2MD8 C;  2MA5 A;  5TAB A;  1WFK A;  4YAX A;  4A49 A;  3N9Q A;  3O7A A;  1E4U A;  2M3H A;  1Z60 A;  2VPE A;  2VPG A;  2CSV A;  2G43 A;  4N4F A;  2MUM A;  2YQM A;  4QQ4 A;  3C5K A;  2KR4 A;  4I7D A;  5FB0 A;  3SUB A;  2C2V S;  2G6Q A;  3QZV A;  2LGV A;  2OWA A;  2HDP A;  3LQI A;  1VFY A;  3LQH A;  3MDB C;  2VP7 A;  3V43 A;  2ZET C;  4YBT A;  3LQJ A;  2KE1 A;  4AVX A;  3EB5 A;  1X4U A;  4L58 A;  4P5O B;  1JOC A;  4WZ0 A;  4ZUX U;  4AUQ B;  3LDY A;  2F6J A;  2CRW A;  4I7B A;  3N9N A;  4OGE A;  1BOR A;  3DPL R;  3L1Z B;  3ZPV 1;  4LJN A;  2K17 A;  3N9P A;  4BBQ A;  1JM7 B;  3N9O A;  2EXU A;  3O33 A;  3I2D A;  3EB6 A;  1WEP A;  3L1X A;  2KKY A;  2G45 A;  2M13 A;  2PUY A;  4FJC A;  5FB1 A;  5H1T A;  2LGG A;  4BHW A;  4F52 B;  4QF2 A;  2XOC A;  3HCT A;  2LDR A;  3O36 A;  2LXP C;  2H0D B;  3PLW A;  1WEU A;  2MIQ A;  3HTK C;  3ZNI A;  2LRI C;  3T7L A;  1IYM A;  3FM8 C;  2RI7 A;  3RTR B;  5SVI B;  2LV9 A;  2PNX A;  4Z0R A;  1LDJ B;  2L75 A;  3LRQ A;  1MM2 A;  4YC9 A;  2KWO A;  5I3L A;  4FO9 A;  3HCS A;  3M99 A;  2ECG A;  3L11 A;  4XI1 A;  5LKU A;  1WEN A;  2KWN A;  3E2D A; 
#chains in the Genus database with same CATH homology
 2KFT A;  2LQ6 A;  1CHC A;  5G0F A;  4R8P K;  1WE9 A;  1WEQ A;  5C13 A;  2L43 A;  3N9L A;  3ZPV E;  4AYC A;  5LCW B;  4YBS A;  1WIM A;  2LGK A;  5KH7 A;  2KYU A;  2VPB A;  3ZTG A;  5D1K B;  1WEW A;  2VJF B;  2AN6 A;  2YHN A;  2YU4 A;  2KGG A;  4GNF A;  3KV6 A;  4V3L C;  5EYA F;  4V3K C;  1WEV A;  2H0D A;  2FUU A;  3U5N A;  5C11 A;  5DIN A;  1WEO A;  5B76 A;  1Z2Q A;  2RSD A;  5FEY A;  1WIL A;  4YAT A;  5TDW A;  4GND A;  3M62 A;  3PHD A;  4B7Y C;  4NN2 A;  2KU3 A;  2LN0 A;  2M85 A;  2QIC A;  2NAA A;  2ECJ A;  2D8S A;  2YHO A;  4A0C D;  1WES A;  2E6S A;  3DQV R;  4GNG A;  2VJE A;  4UP0 A;  3KQI A;  4YAD A;  1X4I A;  3SOU A;  4W4U A;  2F6N A;  4LLB A;  2K16 A;  2F42 A;  1WEE A;  2JMJ A;  2YW8 A;  4GB0 A;  2MA6 A;  2YQL A;  3VK6 A;  1HYI A;  2MT5 A;  2ECV A;  1G25 A;  2KIZ A;  1V87 A;  4IC3 A;  3GV4 A;  4MVT A;  2IDA A;  1VD4 A;  3U5M A;  2Y43 A;  4PPE A;  4N3W A;  5H1U A;  4CCG X;  2YSM A;  1DVP A;  4PTB A;  2YUC A;  4GNE A;  3SOX A;  2EOD A;  4R7E A;  3NG2 A;  1ZBD B;  2E6R A;  3MHH A;  3FL2 A;  3O70 A;  3GL6 A;  5KH3 A;  2JMD A;  3MHS A;  2MNY A;  2Y1M A;  1JM7 A;  4C9Z A;  2FSA A;  2Y1N A;  4FIP A;  2L0B A;  4QF3 A;  4IC2 A;  4X3G A;  4I7C A;  2VNF A;  2FUI A;  3RPG C;  5D1L B;  3IHP A;  3C6W A;  3O35 A;  4L7X A;  4YBM A;  2DX8 A;  2MNZ A;  5G05 B;  2OXQ C;  1FBV A;  4A4C A;  5LKX A;  2YUR A;  1XWH A;  5AIU A;  3U5O A;  2UZG A;  3U5P A;  1T1H A;  2KWJ A;  2EA6 A;  1K2F A;  2XEU A;  4ZQL A;  5G04 B;  2HYE D;  1FP0 A;  1U6G B;  5D1M B;  4WZ2 A;  2KWK A;  2LGL A;  3PUQ A;  3SOW A;  4MSX A;  2M6M A;  2QIZ A;  3HCU A;  4B86 C;  5B75 A;  2CT2 A;  2VJF A;  2YRE A;  3ZYQ A;  4S3O C;  2CKL B;  2YT5 A;  2L5U A;  4A4B A;  2ECW A;  2YSJ A;  3SHB A;  2VPD A;  2K4D A;  4CA1 A;  2CSY A;  2L80 A;  4LK9 A;  5B79 A;  5FER A;  1WGM A;  2K1J A;  4AYC B;  5H1V A;  2YYR A;  3ASL A;  1HYJ A;  4UP5 A;  5LKT A;  4ZDT A;  3RPG B;  5B8D A;  2XB1 A;  4R2Y A;  2QJ0 A;  3N9M A;  2JRJ A;  4UI9 B;  4TKP B;  3O34 A;  5LKZ A;  5TRB A;  4Q6F A;  5KH9 A;  4YAB A;  5H9M A;  1VYX A;  2BAY A;  3ZVZ B;  1N87 A;  1F62 A;  2CSZ A;  5AIT A;  3M63 A;  5J3X A;  3ZVY A;  5TBN A;  2C2L A;  2MD7 B;  4FK5 A;  2I50 A;  2KRE A;  2M1R A;  1WEM A;  3PUR A;  2ECT A;  2CKL A;  4WZ3 B;  1LDK C;  4WA6 A;  3KV5 A;  4AP4 A;  4O64 A;  5DKA A;  5TDR A;  2LXH C;  1RMD A;  3O37 A;  5B77 A;  5B78 A;  2ECI A;  2KGI A;  2ECN A;  2VJE B;  2EGP A;  1MM3 A;  1X4J A;  3KNV A;  4LKA A;  2JMI A;  3T6R A;  1Z6U A;  4LAD B;  4S3O B;  5JG6 A;  2MD8 C;  2MA5 A;  5TAB A;  1WFK A;  4YAX A;  4A49 A;  3N9Q A;  3O7A A;  1E4U A;  2M3H A;  1Z60 A;  2VPE A;  2VPG A;  2G43 A;  4N4F A;  2MUM A;  2YQM A;  3C5K A;  2KR4 A;  4I7D A;  5FB0 A;  2C2V S;  2G6Q A;  3QZV A;  2LGV A;  2HDP A;  3LQI A;  1VFY A;  3LQH A;  2VP7 A;  3V43 A;  2ZET C;  4YBT A;  3LQJ A;  2KE1 A;  4AVX A;  3EB5 A;  1X4U A;  4L58 A;  4P5O B;  1JOC A;  4WZ0 A;  4ZUX U;  4AUQ B;  2F6J A;  4I7B A;  3N9N A;  1BOR A;  3DPL R;  3L1Z B;  3ZPV 1;  4LJN A;  2K17 A;  3N9P A;  4BBQ A;  1JM7 B;  3N9O A;  3O33 A;  3I2D A;  3EB6 A;  1WEP A;  3L1X A;  2G45 A;  2PUY A;  4FJC A;  5FB1 A;  5H1T A;  2LGG A;  4BHW A;  4F52 B;  4QF2 A;  3HCT A;  2LDR A;  3O36 A;  2LXP C;  2H0D B;  1WEU A;  2MIQ A;  3HTK C;  3ZNI A;  2LRI C;  3T7L A;  1IYM A;  3RTR B;  2RI7 A;  2LV9 A;  2PNX A;  1LDJ B;  2L75 A;  3LRQ A;  1MM2 A;  4YC9 A;  2KWO A;  5I3L A;  4FO9 A;  3HCS A;  3M99 A;  2ECG A;  3L11 A;  4XI1 A;  5LKU A;  1WEN A;  2KWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...