3ZPVE

Crystal structure of drosophila pygo phd finger in complex with legless hd1 domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
AAMAIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evolutionary Adaptation of the Fly Pygo Phd Finger Towards Recognizing Histone H3 Tail Methylated at Arginine 2
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords PROTEIN BCL9 HOMOLOG
total genus 11
structure length 62
sequence length 62
chains with identical sequence O, Y
ec nomenclature
pdb deposition date 2013-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zpvE00
3O7AA 4LLBA 2QIZA 5AIUA 2VP7A 2ECNA 1VD4A 5C13A 3EB6A 5DKAA 1BORA 2F6JA 3N9MA 5D1MB 2EA6A 4UP5A 2Y43A 4I7CA 3SOWA 3GL6A 4MSXA 4L7XA 4LK9A 4A0CD 3KV5A 2UZGA 2VNFA 4N4FA 3C5KA 5B77A 1HYJA 2F6NA 1FBVA 2KWKA 1WEMA 2JMIA 2KFTA 4YATA 5TBNA 3HTKC 3U5MA 4GNGA 3ZVYA 5G0FA 3LQHA 5LKZA 2H0DA 2M1RA 2MNYA 4R2YA 4R8PK 2LGGA 2LQ6A 2MT5A 3IHPA 2KWJA 4YBTA 1FP0A 2G45A 5C11A 2VJEB 4O64A 4LKAA 2ECTA 3I2DA 2C2LA 4CCGX 2LV9A 5DINA 4ZQLA 4ZDTA 2F42A 1Z2QA 2L0BA 2KIZA 2FUUA 3N9QA 4GB0A 2LGLA 4YC9A 1WENA 3SOXA 4GNFA 2D8SA 5LKXA 5J3XA 4I7DA 3N9OA 3T6RA 4IC3A 5KH7A 3M62A 1DVPA 2YREA 2DX8A 2JMDA 5G05B 1MM2A 2H0DB 5EYAF 3LQIA 4BBQA 3N9PA 2MD7B 5B79A 2MIQA 1ZBDB 3PHDA 1IYMA 2XEUA 5D1KB 3L11A 4FO9A 1X4JA 1WIMA 2RI7A 2VJEA 2G43A 5B75A 4A4BA 4AP4A 2MNZA 2YSMA 5H1VA 3RPGC 2E6RA 3KV6A 2YU4A 4S3OC 2K16A 1XWHA 1HYIA 1WEEA 2LGVA 1WEQA 4IC2A 2YQMA 3SHBA 1RMDA 2ECIA 4N3WA 5KH3A 5JG6A 3HCTA 3ZYQA 2K4DA 2KU3A 2QJ0A 1WEUA 5LKUA 5KH9A 1WEPA 5B8DA 3RTRB 2FUIA 2KYUA 4YBMA 1X4UA 2PUYA 2YYRA 1WEWA 3N9NA 1VYXA 4NN2A 2VJFA 3VK6A 2KE1A 3U5NA 4ZUXU 4A4CA 1LDKC 5LKTA 1VFYA 5FB0A 3T7LA 4S3OB 4LJNA 4V3LC 3DPLR 1JM7B 3O34A 3NG2A 1F62A 1Z6UA 2JMJA 2YHOA 1JM7A 2NAAA 2LGKA 3M99A 2HDPA 2CKLB 5B76A 1WEVA 2LXHC 5H1UA 3ASLA 2BAYA 3MHHA 3L1XA 2VPEA 1V87A 2YT5A 4B86C 2KWOA 4GNDA 3L1ZB 4YABA 4AYCB 1T1HA 2Y1NA 1WESA 2YW8A 2KGGA 4P5OB 3HCSA 2LDRA 2VJFB 2KWNA 3KNVA 4QF2A 4QF3A 3ZPV1 4PTBA 4C9ZA 2EGPA 2VPBA 4UI9B 3O70A 1K2FA 3ZNIA 3DQVR 4L58A 3ZTGA 3M63A 2YSJA 3KQIA 5LCWB 3ZVZB 4LADB 1WILA 2IDAA 3C6WA 2ECWA 2CSYA 2KREA 2RSDA 3RPGB 3O37A 4FJCA 4BHWA 4TKPB 2HYED 2YURA 4FK5A 2I50A 2YUCA 2YHNA 3FL2A 4I7BA 2Y1MA 5H1TA 4YBSA 2CSZA 4V3KC 1Z60A 3V43A 1JOCA 2L5UA 2XB1A 3LRQA 4WZ3B 4B7YC 5TRBA 3QZVA 2ECGA 4WZ0A 2QICA 2LXPC 1WE9A 2L75A 3ZPVE 4UP0A 4GNEA 4WA6A 1LDJB 4XI1A 3SOUA 3HCUA 4AUQB 2FSAA 2KR4A 3GV4A 4F52B 4A49A 3PUQA 2C2VS 1WEOA 2VPGA 5D1LB 1G25A 2AN6A 5B78A 4FIPA 4X3GA 2OXQC 2LN0A 3LQJA 4YAXA 2K17A 2CKLA 2LRIC 2VPDA 4WZ2A 2JRJA 3U5PA 2MD8C 2E6SA 5TDWA 2L80A 1U6GB 4MVTA 1CHCA 4W4UA 4Q6FA 2CT2A 4CA1A 2MUMA 1X4IA 2M3HA 1E4UA 5TDRA 5AITA 2PNXA 2ECJA 2G6QA 3O33A 3PURA 3O35A 4R7EA 3EB5A 1MM3A 3U5OA 5H9MA 2M6MA 5I3LA 4YADA 1WGMA 4AYCA 3MHSA 5TABA 2EODA 3O36A 1N87A 5FERA 2ZETC 2KGIA 5FEYA 5FB1A 4AVXA 2ECVA 5G04B 2MA5A 2L43A 3N9LA 2MA6A 4PPEA 2K1JA 2YQLA 1WFKA 2M85A
chains in the Genus database with same CATH superfamily
3O47A 3O7AA 4LLBA 2QIZA 5SVIA 2FD4A 5AIUA 2VP7A 2JM3A 2ECNA 2P57A 1VD4A 5C13A 3EB6A 5DKAA 1BORA 2F6JA 3N9MA 3FM8C 5D1MB 2EA6A 4UP5A 2Y43A 4I7CA 3SOWA 3GL6A 4MSXA 4L7XA 4LK9A 4A0CD 3KV5A 2UZGA 2VNFA 4N4FA 3C5KA 5B77A 1HYJA 2F6NA 1FBVA 2KWKA 1WEMA 2JMIA 2KFTA 4YATA 2D8UA 5TBNA 2JUNA 3HTKC 3U5MA 4GNGA 3ZVYA 5G0FA 3DDTA 3LQHA 5LKZA 2H0DA 2M1RA 2MNYA 4R2YA 4R8PK 2LGGA 2LQ6A 4QQ4A 2DJAA 2MT5A 3IHPA 2KWJA 4YBTA 1FP0A 2G45A 5C11A 2MKEA 2VJEB 4O64A 4LKAA 2IQJA 2ECTA 3I2DA 3FJUB 2C2LA 4CCGX 2LV9A 5DINA 4ZQLA 4ZDTA 2F42A 1Z2QA 2L0BA 2KIZA 3PLWA 2FUUA 3N9QA 4GB0A 2LGLA 4YC9A 1WENA 2L7PA 3SOXA 4GNFA 2D8SA 5LKXA 3T9KA 2B0OE 5J3XA 4I7DA 3N9OA 3T6RA 2EGMA 4IC3A 5KH7A 3M62A 1DVPA 3JUEA 2YREA 2DX8A 2JMDA 5G05B 1MM2A 2H0DB 5EYAF 3LQIA 4BBQA 3N9PA 2MD7B 5B79A 2MIQA 1ZBDB 3PHDA 1IYMA 2XEUA 5D1KB 3L11A 4FO9A 3SUBA 1X4JA 1WIMA 2RI7A 2VJEA 2G43A 5B75A 4A4BA 4AP4A 2MNZA 2YSMA 5H1VA 3RPGC 2E6RA 3KV6A 2YU4A 4S3OC 2K16A 1XWHA 2XOCA 4OGEA 1HYIA 1WEEA 2LGVA 1WEQA 4IC2A 2YQMA 3SHBA 1RMDA 2ECIA 4N3WA 5KH3A 5JG6A 4O62A 3HCTA 3LVRE 2K4DA 3ZYQA 2KU3A 2QJ0A 1MBMA 1WEUA 5LKUA 5KH9A 1WEPA 3RTRB 5B8DA 2KKYA 2FUIA 2KYUA 4YBMA 1X4UA 2PUYA 3M7KA 2YYRA 4Z0OA 1WEWA 3N9NA 1VYXA 4NN2A 2VJFA 3VK6A 2KE1A 3U5NA 4ZUXU 3DWDA 4A4CA 2M13A 1LDKC 5LKTA 1VFYA 5FB0A 3T7LA 4S3OB 4LJNA 4V3LC 3DPLR 2OWAA 1JM7B 3O34A 3NG2A 1F62A 1Z6UA 2JMJA 5SVYA 2YHOA 1JM7A 2NAAA 2CONA 2LGKA 2FFWA 3M99A 2HDPA 2CKLB 5SVIB 5B76A 1WEVA 2LXHC 5H1UA 1DCQA 3ASLA 2RR4A 2BAYA 3MHHA 3L1XA 2VPEA 1V87A 2XOZA 2YT5A 2KKXA 4B86C 2KWOA 4GNDA 3L1ZB 4YABA 4AYCB 4Z0RA 1T1HA 3LJUX 5SVXA 2Y1NA 1WESA 2YW8A 2KGGA 4P5OB 3HCSA 2LDRA 2VJFB 2KWNA 3KNVA 4QF2A 2LAUA 4QF3A 3ZPV1 4H9DA 4PTBA 4C9ZA 2EGPA 2VPBA 4UI9B 3O70A 1K2FA 3ZNIA 3DQVR 4L58A 3ZTGA 3M63A 2YSJA 3FANA 3KQIA 5LCWB 3ZVZB 2CRWA 4LADB 1WILA 2IDAA 3C6WA 2ECWA 2CSYA 2KREA 2RSDA 3RPGB 3O37A 4FJCA 4BHWA 4TKPB 2HYED 2YURA 4FK5A 2I50A 2YUCA 2YHNA 3FL2A 4I7BA 2Y1MA 2CRRA 5H1TA 4YBSA 2CSZA 4V3KC 1Z60A 3V43A 1JOCA 2L5UA 2XB1A 2DSMA 3LRQA 4WZ3B 5K3QA 4B7YC 5TRBA 3LVQE 3QZVA 2ECGA 4WZ0A 2QICA 2LXPC 1WE9A 2L75A 3ZPVE 4UP0A 3LDYA 4GNEA 4WA6A 1LDJB 4XI1A 3SOUA 3HCUA 4AUQB 2FSAA 2KR4A 3GV4A 4F52B 4A49A 3PUQA 2C2VS 1WEOA 2VPGA 5D1LB 1G25A 2AN6A 5B78A 4FIPA 3KDEC 4X3GA 2OXQC 2LN0A 3LQJA 4YAXA 2K17A 3MDBC 2CKLA 2LRIC 2VPDA 3H7HA 4WZ2A 2JRJA 3U5PA 2MD8C 2E6SA 5TDWA 2L80A 1U6GB 4MVTA 1CHCA 2XP0A 4W4UA 4Q6FA 4OGCA 2CT2A 4CA1A 2MUMA 1X4IA 2M3HA 1E4UA 5TDRA 5AITA 2PNXA 2ECJA 2G6QA 3E2DA 3O33A 3PURA 3O35A 4R7EA 4F1PA 3EB5A 2EXUA 1MM3A 3U5OA 5H9MA 2E61A 2M6MA 5I3LA 4YADA 1WGMA 4AYCA 3MHSA 5TABA 2EODA 3O36A 1N87A 2YVRA 2CSVA 5FERA 2XOYA 2ZETC 2KGIA 5FEYA 5FB1A 3Q1DA 5G04B 2ECVA 4AVXA 2MA5A 3N9LA 2L43A 3FAOA 2MA6A 3FEHA 4PPEA 2K1JA 2YQLA 1WFKA 2M85A
chains in the Genus database with same CATH topology
3O7AA 4LLBA 2QIZA 5AIUA 2VP7A 2ECNA 1VD4A 5C13A 3EB6A 5DKAA 1BORA 2F6JA 3N9MA 5D1MB 2EA6A 4UP5A 2Y43A 4I7CA 3SOWA 3GL6A 4MSXA 4L7XA 4LK9A 4A0CD 3KV5A 2UZGA 2VNFA 4N4FA 3C5KA 5B77A 1HYJA 2F6NA 1FBVA 2KWKA 1WEMA 2JMIA 2KFTA 4YATA 5TBNA 3HTKC 3U5MA 4GNGA 3ZVYA 5G0FA 3LQHA 5LKZA 2H0DA 2M1RA 2MNYA 4R2YA 4R8PK 2LGGA 2LQ6A 2MT5A 3IHPA 2KWJA 4YBTA 1FP0A 2G45A 5C11A 2VJEB 4O64A 4LKAA 2ECTA 3I2DA 2C2LA 4CCGX 2LV9A 5DINA 4ZQLA 4ZDTA 2F42A 1Z2QA 2L0BA 2KIZA 2FUUA 3N9QA 4GB0A 2LGLA 4YC9A 1WENA 3SOXA 4GNFA 2D8SA 5LKXA 5J3XA 4I7DA 3N9OA 3T6RA 4IC3A 5KH7A 3M62A 1DVPA 2YREA 2DX8A 2JMDA 5G05B 1MM2A 2H0DB 5EYAF 3LQIA 4BBQA 3N9PA 2MD7B 5B79A 2MIQA 1ZBDB 3PHDA 1IYMA 2XEUA 5D1KB 3L11A 4FO9A 1X4JA 1WIMA 2RI7A 2VJEA 2G43A 5B75A 4A4BA 4AP4A 2MNZA 2YSMA 5H1VA 3RPGC 2E6RA 3KV6A 2YU4A 4S3OC 2K16A 1XWHA 1HYIA 1WEEA 2LGVA 1WEQA 4IC2A 2YQMA 3SHBA 1RMDA 2ECIA 4N3WA 5KH3A 5JG6A 3HCTA 3ZYQA 2K4DA 2KU3A 2QJ0A 1WEUA 5LKUA 5KH9A 1WEPA 5B8DA 3RTRB 2FUIA 2KYUA 4YBMA 1X4UA 2PUYA 2YYRA 1WEWA 3N9NA 1VYXA 4NN2A 2VJFA 3VK6A 2KE1A 3U5NA 4ZUXU 4A4CA 1LDKC 5LKTA 1VFYA 5FB0A 3T7LA 4S3OB 4LJNA 4V3LC 3DPLR 1JM7B 3O34A 3NG2A 1F62A 1Z6UA 2JMJA 2YHOA 1JM7A 2NAAA 2LGKA 3M99A 2HDPA 2CKLB 5B76A 1WEVA 2LXHC 5H1UA 3ASLA 2BAYA 3MHHA 3L1XA 2VPEA 1V87A 2YT5A 4B86C 2KWOA 4GNDA 3L1ZB 4YABA 4AYCB 1T1HA 2Y1NA 1WESA 2YW8A 2KGGA 4P5OB 3HCSA 2LDRA 2VJFB 2KWNA 3KNVA 4QF2A 4QF3A 3ZPV1 4PTBA 4C9ZA 2EGPA 2VPBA 4UI9B 3O70A 1K2FA 3ZNIA 3DQVR 4L58A 3ZTGA 3M63A 2YSJA 3KQIA 5LCWB 3ZVZB 4LADB 1WILA 2IDAA 3C6WA 2ECWA 2CSYA 2KREA 2RSDA 3RPGB 3O37A 4FJCA 4BHWA 4TKPB 2HYED 2YURA 4FK5A 2I50A 2YUCA 2YHNA 3FL2A 4I7BA 2Y1MA 5H1TA 4YBSA 2CSZA 4V3KC 1Z60A 3V43A 1JOCA 2L5UA 2XB1A 3LRQA 4WZ3B 4B7YC 5TRBA 3QZVA 2ECGA 4WZ0A 2QICA 2LXPC 1WE9A 2L75A 3ZPVE 4UP0A 4GNEA 4WA6A 1LDJB 4XI1A 3SOUA 3HCUA 4AUQB 2FSAA 2KR4A 3GV4A 4F52B 4A49A 3PUQA 2C2VS 1WEOA 2VPGA 5D1LB 1G25A 2AN6A 5B78A 4FIPA 4X3GA 2OXQC 2LN0A 3LQJA 4YAXA 2K17A 2CKLA 2LRIC 2VPDA 4WZ2A 2JRJA 3U5PA 2MD8C 2E6SA 5TDWA 2L80A 1U6GB 4MVTA 1CHCA 4W4UA 4Q6FA 2CT2A 4CA1A 2MUMA 1X4IA 2M3HA 1E4UA 5TDRA 5AITA 2PNXA 2ECJA 2G6QA 3O33A 3PURA 3O35A 4R7EA 3EB5A 1MM3A 3U5OA 5H9MA 2M6MA 5I3LA 4YADA 1WGMA 4AYCA 3MHSA 5TABA 2EODA 3O36A 1N87A 5FERA 2ZETC 2KGIA 5FEYA 5FB1A 4AVXA 2ECVA 5G04B 2MA5A 2L43A 3N9LA 2MA6A 4PPEA 2K1JA 2YQLA 1WFKA 2M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O7A A;  4LLB A;  2QIZ A;  5AIU A;  2VP7 A;  2ECN A;  1VD4 A;  5C13 A;  3EB6 A;  5DKA A;  1BOR A;  2F6J A;  3N9M A;  5D1M B;  2EA6 A;  4UP5 A;  2Y43 A;  4I7C A;  3SOW A;  3GL6 A;  4MSX A;  4L7X A;  4LK9 A;  4A0C D;  3KV5 A;  2UZG A;  2VNF A;  4N4F A;  3C5K A;  5B77 A;  1HYJ A;  2F6N A;  1FBV A;  2KWK A;  1WEM A;  2JMI A;  2KFT A;  4YAT A;  5TBN A;  3HTK C;  3U5M A;  4GNG A;  3ZVY A;  5G0F A;  3LQH A;  5LKZ A;  2H0D A;  2M1R A;  2MNY A;  4R2Y A;  4R8P K;  2LGG A;  2LQ6 A;  2MT5 A;  3IHP A;  2KWJ A;  4YBT A;  1FP0 A;  2G45 A;  5C11 A;  2VJE B;  4O64 A;  4LKA A;  2ECT A;  3I2D A;  2C2L A;  4CCG X;  2LV9 A;  5DIN A;  4ZQL A;  4ZDT A;  2F42 A;  1Z2Q A;  2L0B A;  2KIZ A;  2FUU A;  3N9Q A;  4GB0 A;  2LGL A;  4YC9 A;  1WEN A;  3SOX A;  4GNF A;  2D8S A;  5LKX A;  5J3X A;  4I7D A;  3N9O A;  3T6R A;  4IC3 A;  5KH7 A;  3M62 A;  1DVP A;  2YRE A;  2DX8 A;  2JMD A;  5G05 B;  1MM2 A;  2H0D B;  5EYA F;  3LQI A;  4BBQ A;  3N9P A;  2MD7 B;  5B79 A;  2MIQ A;  1ZBD B;  3PHD A;  1IYM A;  2XEU A;  5D1K B;  3L11 A;  4FO9 A;  1X4J A;  1WIM A;  2RI7 A;  2VJE A;  2G43 A;  5B75 A;  4A4B A;  4AP4 A;  2MNZ A;  2YSM A;  5H1V A;  3RPG C;  2E6R A;  3KV6 A;  2YU4 A;  4S3O C;  2K16 A;  1XWH A;  1HYI A;  1WEE A;  2LGV A;  1WEQ A;  4IC2 A;  2YQM A;  3SHB A;  1RMD A;  2ECI A;  4N3W A;  5KH3 A;  5JG6 A;  3HCT A;  3ZYQ A;  2K4D A;  2KU3 A;  2QJ0 A;  1WEU A;  5LKU A;  5KH9 A;  1WEP A;  5B8D A;  3RTR B;  2FUI A;  2KYU A;  4YBM A;  1X4U A;  2PUY A;  2YYR A;  1WEW A;  3N9N A;  1VYX A;  4NN2 A;  2VJF A;  3VK6 A;  2KE1 A;  3U5N A;  4ZUX U;  4A4C A;  1LDK C;  5LKT A;  1VFY A;  5FB0 A;  3T7L A;  4S3O B;  4LJN A;  4V3L C;  3DPL R;  1JM7 B;  3O34 A;  3NG2 A;  1F62 A;  1Z6U A;  2JMJ A;  2YHO A;  1JM7 A;  2NAA A;  2LGK A;  3M99 A;  2HDP A;  2CKL B;  5B76 A;  1WEV A;  2LXH C;  5H1U A;  3ASL A;  2BAY A;  3MHH A;  3L1X A;  2VPE A;  1V87 A;  2YT5 A;  4B86 C;  2KWO A;  4GND A;  3L1Z B;  4YAB A;  4AYC B;  1T1H A;  2Y1N A;  1WES A;  2YW8 A;  2KGG A;  4P5O B;  3HCS A;  2LDR A;  2VJF B;  2KWN A;  3KNV A;  4QF2 A;  4QF3 A;  3ZPV 1;  4PTB A;  4C9Z A;  2EGP A;  2VPB A;  4UI9 B;  3O70 A;  1K2F A;  3ZNI A;  3DQV R;  4L58 A;  3ZTG A;  3M63 A;  2YSJ A;  3KQI A;  5LCW B;  3ZVZ B;  4LAD B;  1WIL A;  2IDA A;  3C6W A;  2ECW A;  2CSY A;  2KRE A;  2RSD A;  3RPG B;  3O37 A;  4FJC A;  4BHW A;  4TKP B;  2HYE D;  2YUR A;  4FK5 A;  2I50 A;  2YUC A;  2YHN A;  3FL2 A;  4I7B A;  2Y1M A;  5H1T A;  4YBS A;  2CSZ A;  4V3K C;  1Z60 A;  3V43 A;  1JOC A;  2L5U A;  2XB1 A;  3LRQ A;  4WZ3 B;  4B7Y C;  5TRB A;  3QZV A;  2ECG A;  4WZ0 A;  2QIC A;  2LXP C;  1WE9 A;  2L75 A;  3ZPV E;  4UP0 A;  4GNE A;  4WA6 A;  1LDJ B;  4XI1 A;  3SOU A;  3HCU A;  4AUQ B;  2FSA A;  2KR4 A;  3GV4 A;  4F52 B;  4A49 A;  3PUQ A;  2C2V S;  1WEO A;  2VPG A;  5D1L B;  1G25 A;  2AN6 A;  5B78 A;  4FIP A;  4X3G A;  2OXQ C;  2LN0 A;  3LQJ A;  4YAX A;  2K17 A;  2CKL A;  2LRI C;  2VPD A;  4WZ2 A;  2JRJ A;  3U5P A;  2MD8 C;  2E6S A;  5TDW A;  2L80 A;  1U6G B;  4MVT A;  1CHC A;  4W4U A;  4Q6F A;  2CT2 A;  4CA1 A;  2MUM A;  1X4I A;  2M3H A;  1E4U A;  5TDR A;  5AIT A;  2PNX A;  2ECJ A;  2G6Q A;  3O33 A;  3PUR A;  3O35 A;  4R7E A;  3EB5 A;  1MM3 A;  3U5O A;  5H9M A;  2M6M A;  5I3L A;  4YAD A;  1WGM A;  4AYC A;  3MHS A;  5TAB A;  2EOD A;  3O36 A;  1N87 A;  5FER A;  2ZET C;  2KGI A;  5FEY A;  5FB1 A;  4AVX A;  2ECV A;  5G04 B;  2MA5 A;  2L43 A;  3N9L A;  2MA6 A;  4PPE A;  2K1J A;  2YQL A;  1WFK A;  2M85 A; 
#chains in the Genus database with same CATH topology
 3O47 A;  3O7A A;  4LLB A;  2QIZ A;  5SVI A;  2FD4 A;  5AIU A;  2VP7 A;  2JM3 A;  2ECN A;  2P57 A;  1VD4 A;  5C13 A;  3EB6 A;  5DKA A;  1BOR A;  2F6J A;  3N9M A;  3FM8 C;  5D1M B;  2EA6 A;  4UP5 A;  2Y43 A;  4I7C A;  3SOW A;  3GL6 A;  4MSX A;  4L7X A;  4LK9 A;  4A0C D;  3KV5 A;  2UZG A;  2VNF A;  4N4F A;  3C5K A;  5B77 A;  1HYJ A;  2F6N A;  1FBV A;  2KWK A;  1WEM A;  2JMI A;  2KFT A;  4YAT A;  2D8U A;  5TBN A;  2JUN A;  3HTK C;  3U5M A;  4GNG A;  3ZVY A;  5G0F A;  3DDT A;  3LQH A;  5LKZ A;  2H0D A;  2M1R A;  2MNY A;  4R2Y A;  4R8P K;  2LGG A;  2LQ6 A;  4QQ4 A;  2DJA A;  2MT5 A;  3IHP A;  2KWJ A;  4YBT A;  1FP0 A;  2G45 A;  5C11 A;  2MKE A;  2VJE B;  4O64 A;  4LKA A;  2IQJ A;  2ECT A;  3I2D A;  3FJU B;  2C2L A;  4CCG X;  2LV9 A;  5DIN A;  4ZQL A;  4ZDT A;  2F42 A;  1Z2Q A;  2L0B A;  2KIZ A;  3PLW A;  2FUU A;  3N9Q A;  4GB0 A;  2LGL A;  4YC9 A;  1WEN A;  2L7P A;  3SOX A;  4GNF A;  2D8S A;  5LKX A;  3T9K A;  2B0O E;  5J3X A;  4I7D A;  3N9O A;  3T6R A;  2EGM A;  4IC3 A;  5KH7 A;  3M62 A;  1DVP A;  3JUE A;  2YRE A;  2DX8 A;  2JMD A;  5G05 B;  1MM2 A;  2H0D B;  5EYA F;  3LQI A;  4BBQ A;  3N9P A;  2MD7 B;  5B79 A;  2MIQ A;  1ZBD B;  3PHD A;  1IYM A;  2XEU A;  5D1K B;  3L11 A;  4FO9 A;  3SUB A;  1X4J A;  1WIM A;  2RI7 A;  2VJE A;  2G43 A;  5B75 A;  4A4B A;  4AP4 A;  2MNZ A;  2YSM A;  5H1V A;  3RPG C;  2E6R A;  3KV6 A;  2YU4 A;  4S3O C;  2K16 A;  1XWH A;  2XOC A;  4OGE A;  1HYI A;  1WEE A;  2LGV A;  1WEQ A;  4IC2 A;  2YQM A;  3SHB A;  1RMD A;  2ECI A;  4N3W A;  5KH3 A;  5JG6 A;  4O62 A;  3HCT A;  3LVR E;  2K4D A;  3ZYQ A;  2KU3 A;  2QJ0 A;  1MBM A;  1WEU A;  5LKU A;  5KH9 A;  1WEP A;  3RTR B;  5B8D A;  2KKY A;  2FUI A;  2KYU A;  4YBM A;  1X4U A;  2PUY A;  3M7K A;  2YYR A;  4Z0O A;  1WEW A;  3N9N A;  1VYX A;  4NN2 A;  2VJF A;  3VK6 A;  2KE1 A;  3U5N A;  4ZUX U;  3DWD A;  4A4C A;  2M13 A;  1LDK C;  5LKT A;  1VFY A;  5FB0 A;  3T7L A;  4S3O B;  4LJN A;  4V3L C;  3DPL R;  2OWA A;  1JM7 B;  3O34 A;  3NG2 A;  1F62 A;  1Z6U A;  2JMJ A;  5SVY A;  2YHO A;  1JM7 A;  2NAA A;  2CON A;  2LGK A;  2FFW A;  3M99 A;  2HDP A;  2CKL B;  5SVI B;  5B76 A;  1WEV A;  2LXH C;  5H1U A;  1DCQ A;  3ASL A;  2RR4 A;  2BAY A;  3MHH A;  3L1X A;  2VPE A;  1V87 A;  2XOZ A;  2YT5 A;  2KKX A;  4B86 C;  2KWO A;  4GND A;  3L1Z B;  4YAB A;  4AYC B;  4Z0R A;  1T1H A;  3LJU X;  5SVX A;  2Y1N A;  1WES A;  2YW8 A;  2KGG A;  4P5O B;  3HCS A;  2LDR A;  2VJF B;  2KWN A;  3KNV A;  4QF2 A;  2LAU A;  4QF3 A;  3ZPV 1;  4H9D A;  4PTB A;  4C9Z A;  2EGP A;  2VPB A;  4UI9 B;  3O70 A;  1K2F A;  3ZNI A;  3DQV R;  4L58 A;  3ZTG A;  3M63 A;  2YSJ A;  3FAN A;  3KQI A;  5LCW B;  3ZVZ B;  2CRW A;  4LAD B;  1WIL A;  2IDA A;  3C6W A;  2ECW A;  2CSY A;  2KRE A;  2RSD A;  3RPG B;  3O37 A;  4FJC A;  4BHW A;  4TKP B;  2HYE D;  2YUR A;  4FK5 A;  2I50 A;  2YUC A;  2YHN A;  3FL2 A;  4I7B A;  2Y1M A;  2CRR A;  5H1T A;  4YBS A;  2CSZ A;  4V3K C;  1Z60 A;  3V43 A;  1JOC A;  2L5U A;  2XB1 A;  2DSM A;  3LRQ A;  4WZ3 B;  5K3Q A;  4B7Y C;  5TRB A;  3LVQ E;  3QZV A;  2ECG A;  4WZ0 A;  2QIC A;  2LXP C;  1WE9 A;  2L75 A;  3ZPV E;  4UP0 A;  3LDY A;  4GNE A;  4WA6 A;  1LDJ B;  4XI1 A;  3SOU A;  3HCU A;  4AUQ B;  2FSA A;  2KR4 A;  3GV4 A;  4F52 B;  4A49 A;  3PUQ A;  2C2V S;  1WEO A;  2VPG A;  5D1L B;  1G25 A;  2AN6 A;  5B78 A;  4FIP A;  3KDE C;  4X3G A;  2OXQ C;  2LN0 A;  3LQJ A;  4YAX A;  2K17 A;  3MDB C;  2CKL A;  2LRI C;  2VPD A;  3H7H A;  4WZ2 A;  2JRJ A;  3U5P A;  2MD8 C;  2E6S A;  5TDW A;  2L80 A;  1U6G B;  4MVT A;  1CHC A;  2XP0 A;  4W4U A;  4Q6F A;  4OGC A;  2CT2 A;  4CA1 A;  2MUM A;  1X4I A;  2M3H A;  1E4U A;  5TDR A;  5AIT A;  2PNX A;  2ECJ A;  2G6Q A;  3E2D A;  3O33 A;  3PUR A;  3O35 A;  4R7E A;  4F1P A;  3EB5 A;  2EXU A;  1MM3 A;  3U5O A;  5H9M A;  2E61 A;  2M6M A;  5I3L A;  4YAD A;  1WGM A;  4AYC A;  3MHS A;  5TAB A;  2EOD A;  3O36 A;  1N87 A;  2YVR A;  2CSV A;  5FER A;  2XOY A;  2ZET C;  2KGI A;  5FEY A;  5FB1 A;  3Q1D A;  5G04 B;  2ECV A;  4AVX A;  2MA5 A;  3N9L A;  2L43 A;  3FAO A;  2MA6 A;  3FEH A;  4PPE A;  2K1J A;  2YQL A;  1WFK A;  2M85 A; 
#chains in the Genus database with same CATH homology
 3O7A A;  4LLB A;  2QIZ A;  5AIU A;  2VP7 A;  2ECN A;  1VD4 A;  5C13 A;  3EB6 A;  5DKA A;  1BOR A;  2F6J A;  3N9M A;  5D1M B;  2EA6 A;  4UP5 A;  2Y43 A;  4I7C A;  3SOW A;  3GL6 A;  4MSX A;  4L7X A;  4LK9 A;  4A0C D;  3KV5 A;  2UZG A;  2VNF A;  4N4F A;  3C5K A;  5B77 A;  1HYJ A;  2F6N A;  1FBV A;  2KWK A;  1WEM A;  2JMI A;  2KFT A;  4YAT A;  5TBN A;  3HTK C;  3U5M A;  4GNG A;  3ZVY A;  5G0F A;  3LQH A;  5LKZ A;  2H0D A;  2M1R A;  2MNY A;  4R2Y A;  4R8P K;  2LGG A;  2LQ6 A;  2MT5 A;  3IHP A;  2KWJ A;  4YBT A;  1FP0 A;  2G45 A;  5C11 A;  2VJE B;  4O64 A;  4LKA A;  2ECT A;  3I2D A;  2C2L A;  4CCG X;  2LV9 A;  5DIN A;  4ZQL A;  4ZDT A;  2F42 A;  1Z2Q A;  2L0B A;  2KIZ A;  2FUU A;  3N9Q A;  4GB0 A;  2LGL A;  4YC9 A;  1WEN A;  3SOX A;  4GNF A;  2D8S A;  5LKX A;  5J3X A;  4I7D A;  3N9O A;  3T6R A;  4IC3 A;  5KH7 A;  3M62 A;  1DVP A;  2YRE A;  2DX8 A;  2JMD A;  5G05 B;  1MM2 A;  2H0D B;  5EYA F;  3LQI A;  4BBQ A;  3N9P A;  2MD7 B;  5B79 A;  2MIQ A;  1ZBD B;  3PHD A;  1IYM A;  2XEU A;  5D1K B;  3L11 A;  4FO9 A;  1X4J A;  1WIM A;  2RI7 A;  2VJE A;  2G43 A;  5B75 A;  4A4B A;  4AP4 A;  2MNZ A;  2YSM A;  5H1V A;  3RPG C;  2E6R A;  3KV6 A;  2YU4 A;  4S3O C;  2K16 A;  1XWH A;  1HYI A;  1WEE A;  2LGV A;  1WEQ A;  4IC2 A;  2YQM A;  3SHB A;  1RMD A;  2ECI A;  4N3W A;  5KH3 A;  5JG6 A;  3HCT A;  3ZYQ A;  2K4D A;  2KU3 A;  2QJ0 A;  1WEU A;  5LKU A;  5KH9 A;  1WEP A;  5B8D A;  3RTR B;  2FUI A;  2KYU A;  4YBM A;  1X4U A;  2PUY A;  2YYR A;  1WEW A;  3N9N A;  1VYX A;  4NN2 A;  2VJF A;  3VK6 A;  2KE1 A;  3U5N A;  4ZUX U;  4A4C A;  1LDK C;  5LKT A;  1VFY A;  5FB0 A;  3T7L A;  4S3O B;  4LJN A;  4V3L C;  3DPL R;  1JM7 B;  3O34 A;  3NG2 A;  1F62 A;  1Z6U A;  2JMJ A;  2YHO A;  1JM7 A;  2NAA A;  2LGK A;  3M99 A;  2HDP A;  2CKL B;  5B76 A;  1WEV A;  2LXH C;  5H1U A;  3ASL A;  2BAY A;  3MHH A;  3L1X A;  2VPE A;  1V87 A;  2YT5 A;  4B86 C;  2KWO A;  4GND A;  3L1Z B;  4YAB A;  4AYC B;  1T1H A;  2Y1N A;  1WES A;  2YW8 A;  2KGG A;  4P5O B;  3HCS A;  2LDR A;  2VJF B;  2KWN A;  3KNV A;  4QF2 A;  4QF3 A;  3ZPV 1;  4PTB A;  4C9Z A;  2EGP A;  2VPB A;  4UI9 B;  3O70 A;  1K2F A;  3ZNI A;  3DQV R;  4L58 A;  3ZTG A;  3M63 A;  2YSJ A;  3KQI A;  5LCW B;  3ZVZ B;  4LAD B;  1WIL A;  2IDA A;  3C6W A;  2ECW A;  2CSY A;  2KRE A;  2RSD A;  3RPG B;  3O37 A;  4FJC A;  4BHW A;  4TKP B;  2HYE D;  2YUR A;  4FK5 A;  2I50 A;  2YUC A;  2YHN A;  3FL2 A;  4I7B A;  2Y1M A;  5H1T A;  4YBS A;  2CSZ A;  4V3K C;  1Z60 A;  3V43 A;  1JOC A;  2L5U A;  2XB1 A;  3LRQ A;  4WZ3 B;  4B7Y C;  5TRB A;  3QZV A;  2ECG A;  4WZ0 A;  2QIC A;  2LXP C;  1WE9 A;  2L75 A;  3ZPV E;  4UP0 A;  4GNE A;  4WA6 A;  1LDJ B;  4XI1 A;  3SOU A;  3HCU A;  4AUQ B;  2FSA A;  2KR4 A;  3GV4 A;  4F52 B;  4A49 A;  3PUQ A;  2C2V S;  1WEO A;  2VPG A;  5D1L B;  1G25 A;  2AN6 A;  5B78 A;  4FIP A;  4X3G A;  2OXQ C;  2LN0 A;  3LQJ A;  4YAX A;  2K17 A;  2CKL A;  2LRI C;  2VPD A;  4WZ2 A;  2JRJ A;  3U5P A;  2MD8 C;  2E6S A;  5TDW A;  2L80 A;  1U6G B;  4MVT A;  1CHC A;  4W4U A;  4Q6F A;  2CT2 A;  4CA1 A;  2MUM A;  1X4I A;  2M3H A;  1E4U A;  5TDR A;  5AIT A;  2PNX A;  2ECJ A;  2G6Q A;  3O33 A;  3PUR A;  3O35 A;  4R7E A;  3EB5 A;  1MM3 A;  3U5O A;  5H9M A;  2M6M A;  5I3L A;  4YAD A;  1WGM A;  4AYC A;  3MHS A;  5TAB A;  2EOD A;  3O36 A;  1N87 A;  5FER A;  2ZET C;  2KGI A;  5FEY A;  5FB1 A;  4AVX A;  2ECV A;  5G04 B;  2MA5 A;  2L43 A;  3N9L A;  2MA6 A;  4PPE A;  2K1J A;  2YQL A;  1WFK A;  2M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...