2LN0A

Structure of moz
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
110
structure length
110
Chain Sequence
b'EPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT6A
publication title Combinatorial readout of unmodified H3R2 and acetylated H3K14 by the tandem PHD finger of MOZ reveals a regulatory mechanism for HOXA9 transcription.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 13
structure length 110
sequence length 110
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ln0A00
2KR4A 2HDPA 3ZPVE 5LKUA 3PUQA 5JG6A 2YHOA 4F52B 2YSJA 2L0BA 4CCGX 4XI1A 5H9MA 2LV9A 2Y1NA 2KFTA 2PNXA 2MIQA 4FIPA 3ZVZB 1LDJB 1HYIA 2LQ6A 1WESA 2RI7A 4QF3A 4R7EA 4O64A 3MHHA 5B76A 5J3XA 2YURA 2VP7A 4ZQLA 3O37A 5B8DA 2ZETC 4GB0A 2KGIA 4MVTA 3SOUA 5LKZA 2K1JA 2YQMA 4L7XA 5TDWA 3EB5A 3LQHA 4GNDA 2OXQC 5KH3A 2LGVA 2L5UA 5H1TA 2LXPC 3O33A 2VPEA 4WZ2A 3LQIA 2QICA 2YW8A 2VPGA 5G04B 3U5NA 2YYRA 3U5OA 4PTBA 3N9NA 4LKAA 2UZGA 2KWJA 1IYMA 2FSAA 1WFKA 4GNGA 5C13A 5B78A 5LKTA 2KE1A 1DVPA 3NG2A 4S3OC 1JM7B 4V3KC 3HTKC 4P5OB 3L1ZB 2KU3A 3O36A 1LDKC 4ZDTA 3GL6A 3C5KA 2F42A 2VJFB 1F62A 4IC2A 4GNFA 1BORA 4X3GA 4A0CD 1U6GB 2JMDA 2HYED 2CT2A 3HCTA 4WA6A 4B7YC 5FB0A 2VJEA 2G43A 2ECNA 5FERA 3RTRB 1WEPA 4YAXA 3VK6A 1RMDA 5FB1A 2MA5A 3RPGB 2D8SA 1E4UA 4MSXA 2BAYA 2XEUA 1WE9A 1WEOA 2I50A 2XB1A 2KREA 5B75A 5G0FA 2E6SA 2CSYA 4AYCB 3LQJA 1WEMA 2LGLA 4A4BA 5H1VA 4YATA 2VJFA 3PHDA 3ZPV1 3O35A 2FUIA 4UP0A 3T7LA 2KGGA 2VPBA 3MHSA 3RPGC 5KH9A 3M99A 2CSZA 3DPLR 4I7CA 4S3OB 2YUCA 3PURA 2CKLB 5AITA 2M6MA 3ZVYA 5TABA 4R8PK 2ECWA 2VPDA 3QZVA 1T1HA 2K16A 3N9LA 1WENA 4C9ZA 2MNZA 4UP5A 1XWHA 4N4FA 3ZYQA 4AYCA 5B79A 2QJ0A 3SOXA 2LDRA 4TKPB 4AUQB 3O7AA 4BBQA 2Y1MA 3EB6A 4YBTA 4YADA 1VD4A 4BHWA 4YC9A 5TDRA 5LCWB 2YREA 4FK5A 2JRJA 4UI9B 4LK9A 2LN0A 4I7BA 5DKAA 3KNVA 2ECGA 3HCSA 2MA6A 5D1MB 2MD7B 4GNEA 3ASLA 3HCUA 1WEEA 4R2YA 1Z2QA 1K2FA 5I3LA 2H0DB 4Q6FA 3N9OA 2IDAA 1V87A 2F6NA 4I7DA 2L75A 2LGKA 2KWNA 2DX8A 2LRIC 4AVXA 1JM7A 3C6WA 3FL2A 1WILA 3SHBA 2MNYA 4FJCA 3DQVR 4QF2A 2G45A 1WGMA 5TBNA 5FEYA 3KQIA 1MM2A 2PUYA 3ZNIA 2C2LA 2YU4A 3SOWA 4CA1A 2K17A 2JMJA 1X4JA 5EYAF 4ZUXU 5C11A 4PPEA 2H0DA 4AP4A 3N9QA 1FP0A 3KV6A 5B77A 1N87A 2C2VS 2YQLA 3IHPA 4WZ3B 5G05B 4LLBA 2EODA 1X4IA 2ECIA 1Z6UA 2MT5A 2L80A 2F6JA 3U5MA 4W4UA 1ZBDB 4FO9A 4LJNA 3L1XA 2YT5A 1VFYA 1Z60A 2M1RA 2K4DA 1WEVA 3O34A 4LADB 4B86C 2LXHC 2MUMA 2EA6A 1FBVA 3M62A 5KH7A 3N9PA 2AN6A 2KWOA 1HYJA 1JOCA 1WEUA 2YSMA 2ECTA 4V3LC 3O70A 3ZTGA 2E6RA 3GV4A 4N3WA 1MM3A 5D1LB 2KIZA 2YHNA 4NN2A 2RSDA 2M3HA 2G6QA 5D1KB 2VJEB 5DINA 2CKLA 1G25A 4A4CA 1X4UA 2ECVA 2LGGA 3I2DA 3L11A 2QIZA 5LKXA 5TRBA 2KYUA 3LRQA 4YBMA 4WZ0A 1WEQA 2M85A 4L58A 3M63A 5H1UA 3N9MA 4A49A 4YABA 2VNFA 2FUUA 2EGPA 3V43A 1WIMA 1CHCA 2L43A 2NAAA 2Y43A 2MD8C 2ECJA 1VYXA 4IC3A 3KV5A 2KWKA 5AIUA 2JMIA 3T6RA 3U5PA 1WEWA 4YBSA
chains in the Genus database with same CATH superfamily
2KR4A 2KKXA 2CRWA 2HDPA 3ZPVE 2P57A 5LKUA 3PUQA 2JUNA 5JG6A 2YHOA 4F52B 2YSJA 2L0BA 4CCGX 4XI1A 5H9MA 2LV9A 2Y1NA 2KFTA 2PNXA 2MIQA 4FIPA 3ZVZB 1LDJB 1HYIA 2XOZA 2LQ6A 1WESA 2KKYA 2RI7A 4QF3A 5SVYA 4R7EA 4O64A 3MHHA 2XOCA 5B76A 5J3XA 2DSMA 2YURA 2VP7A 4ZQLA 3O37A 5B8DA 2YVRA 2ZETC 4GB0A 2KGIA 3FM8C 4MVTA 3SOUA 5LKZA 3DWDA 2K1JA 2YQMA 4L7XA 3M7KA 5TDWA 2L7PA 3EB5A 3LQHA 2EGMA 4GNDA 2OXQC 5KH3A 2LGVA 2L5UA 5H1TA 2LXPC 3O33A 2VPEA 4WZ2A 3LQIA 2QICA 2YW8A 2VPGA 5G04B 3U5NA 2YYRA 3U5OA 4PTBA 2IQJA 3N9NA 3LDYA 4LKAA 2UZGA 2KWJA 1IYMA 2FSAA 1WFKA 4GNGA 2LAUA 5C13A 5B78A 5LKTA 3FJUB 2KE1A 1DVPA 3NG2A 4S3OC 1JM7B 4V3KC 3HTKC 4P5OB 2M13A 4Z0RA 3L1ZB 2RR4A 2KU3A 3O36A 3O47A 4O62A 1LDKC 4ZDTA 3GL6A 3FAOA 3C5KA 2F42A 5SVIB 2VJFB 1F62A 4IC2A 4GNFA 1BORA 4X3GA 4A0CD 1U6GB 2JMDA 2D8UA 2HYED 2CT2A 2OWAA 3DDTA 3HCTA 4WA6A 4B7YC 5FB0A 2VJEA 2G43A 1MBMA 2ECNA 5FERA 3RTRB 1WEPA 4YAXA 3VK6A 1RMDA 5FB1A 2MA5A 3RPGB 2D8SA 1E4UA 4MSXA 2BAYA 2XEUA 1WE9A 1WEOA 2I50A 2XB1A 2KREA 5B75A 5G0FA 2E6SA 4Z0OA 3LVRE 2CSYA 4AYCB 3LQJA 1WEMA 2LGLA 4A4BA 5H1VA 4YATA 5SVIA 2VJFA 3PHDA 3ZPV1 3O35A 2FUIA 3SUBA 4UP0A 3T7LA 2KGGA 2VPBA 3MHSA 3RPGC 5KH9A 3M99A 2CSZA 3DPLR 4I7CA 4QQ4A 4S3OB 2YUCA 3PURA 2CKLB 5AITA 2M6MA 3ZVYA 5TABA 4R8PK 2ECWA 2VPDA 2CRRA 3QZVA 1T1HA 2K16A 3N9LA 1WENA 4C9ZA 2MNZA 4UP5A 1XWHA 4N4FA 3ZYQA 4AYCA 5B79A 2QJ0A 3SOXA 2LDRA 4TKPB 2MKEA 4AUQB 3FANA 3O7AA 4BBQA 2XOYA 2Y1MA 3EB6A 4YBTA 4YADA 1VD4A 4BHWA 4YC9A 5TDRA 4OGCA 5LCWB 2YREA 4FK5A 2JRJA 4UI9B 4LK9A 2LN0A 4I7BA 5DKAA 2EXUA 3KNVA 2ECGA 3HCSA 3JUEA 2DJAA 3LJUX 2MA6A 2CONA 5D1MB 2MD7B 4GNEA 3ASLA 3HCUA 1WEEA 4R2YA 1Z2QA 4H9DA 1K2FA 5I3LA 2H0DB 4Q6FA 3N9OA 2IDAA 1V87A 2F6NA 4I7DA 2L75A 2LGKA 2KWNA 2DX8A 2LRIC 4AVXA 1JM7A 3C6WA 3FL2A 1WILA 3SHBA 2MNYA 5SVXA 4FJCA 3DQVR 4QF2A 2G45A 1WGMA 5TBNA 2FFWA 5FEYA 3H7HA 3KQIA 1MM2A 2PUYA 3T9KA 3ZNIA 2C2LA 2YU4A 3SOWA 4CA1A 2K17A 2JMJA 1X4JA 5EYAF 4ZUXU 5C11A 4PPEA 2H0DA 4AP4A 3N9QA 1FP0A 3Q1DA 3FEHA 3KV6A 5B77A 1N87A 2C2VS 2YQLA 3IHPA 4WZ3B 5G05B 4LLBA 2FD4A 2EODA 1X4IA 2JM3A 2ECIA 1Z6UA 2MT5A 2L80A 2B0OE 2F6JA 3U5MA 4W4UA 1ZBDB 4FO9A 4LJNA 1DCQA 3L1XA 2YT5A 1VFYA 1Z60A 5K3QA 2M1RA 3LVQE 2K4DA 1WEVA 3O34A 4LADB 4B86C 2LXHC 2MUMA 2EA6A 1FBVA 3M62A 5KH7A 3N9PA 2AN6A 2KWOA 1HYJA 1JOCA 4F1PA 1WEUA 2YSMA 2ECTA 4V3LC 3MDBC 3O70A 3ZTGA 2E6RA 3GV4A 4N3WA 1MM3A 5D1LB 2KIZA 2CSVA 2YHNA 4NN2A 2RSDA 2M3HA 2G6QA 5D1KB 2VJEB 3KDEC 5DINA 2CKLA 3PLWA 1G25A 4A4CA 1X4UA 2ECVA 2LGGA 3I2DA 3L11A 2QIZA 5LKXA 5TRBA 2KYUA 2XP0A 3LRQA 4YBMA 4WZ0A 1WEQA 2M85A 4L58A 3M63A 5H1UA 3N9MA 2E61A 4A49A 4OGEA 4YABA 2VNFA 2FUUA 2EGPA 3V43A 1WIMA 1CHCA 2L43A 2NAAA 2Y43A 2MD8C 2ECJA 1VYXA 4IC3A 3KV5A 2KWKA 5AIUA 2JMIA 3T6RA 3U5PA 1WEWA 3E2DA 4YBSA
chains in the Genus database with same CATH topology
2KR4A 2HDPA 3ZPVE 5LKUA 3PUQA 5JG6A 2YHOA 4F52B 2YSJA 2L0BA 4CCGX 4XI1A 5H9MA 2LV9A 2Y1NA 2KFTA 2PNXA 2MIQA 4FIPA 3ZVZB 1LDJB 1HYIA 2LQ6A 1WESA 2RI7A 4QF3A 4R7EA 4O64A 3MHHA 5B76A 5J3XA 2YURA 2VP7A 4ZQLA 3O37A 5B8DA 2ZETC 4GB0A 2KGIA 4MVTA 3SOUA 5LKZA 2K1JA 2YQMA 4L7XA 5TDWA 3EB5A 3LQHA 4GNDA 2OXQC 5KH3A 2LGVA 2L5UA 5H1TA 2LXPC 3O33A 2VPEA 4WZ2A 3LQIA 2QICA 2YW8A 2VPGA 5G04B 3U5NA 2YYRA 3U5OA 4PTBA 3N9NA 4LKAA 2UZGA 2KWJA 1IYMA 2FSAA 1WFKA 4GNGA 5C13A 5B78A 5LKTA 2KE1A 1DVPA 3NG2A 4S3OC 1JM7B 4V3KC 3HTKC 4P5OB 3L1ZB 2KU3A 3O36A 1LDKC 4ZDTA 3GL6A 3C5KA 2F42A 2VJFB 1F62A 4IC2A 4GNFA 1BORA 4X3GA 4A0CD 1U6GB 2JMDA 2HYED 2CT2A 3HCTA 4WA6A 4B7YC 5FB0A 2VJEA 2G43A 2ECNA 5FERA 3RTRB 1WEPA 4YAXA 3VK6A 1RMDA 5FB1A 2MA5A 3RPGB 2D8SA 1E4UA 4MSXA 2BAYA 2XEUA 1WE9A 1WEOA 2I50A 2XB1A 2KREA 5B75A 5G0FA 2E6SA 2CSYA 4AYCB 3LQJA 1WEMA 2LGLA 4A4BA 5H1VA 4YATA 2VJFA 3PHDA 3ZPV1 3O35A 2FUIA 4UP0A 3T7LA 2KGGA 2VPBA 3MHSA 3RPGC 5KH9A 3M99A 2CSZA 3DPLR 4I7CA 4S3OB 2YUCA 3PURA 2CKLB 5AITA 2M6MA 3ZVYA 5TABA 4R8PK 2ECWA 2VPDA 3QZVA 1T1HA 2K16A 3N9LA 1WENA 4C9ZA 2MNZA 4UP5A 1XWHA 4N4FA 3ZYQA 4AYCA 5B79A 2QJ0A 3SOXA 2LDRA 4TKPB 4AUQB 3O7AA 4BBQA 2Y1MA 3EB6A 4YBTA 4YADA 1VD4A 4BHWA 4YC9A 5TDRA 5LCWB 2YREA 4FK5A 2JRJA 4UI9B 4LK9A 2LN0A 4I7BA 5DKAA 3KNVA 2ECGA 3HCSA 2MA6A 5D1MB 2MD7B 4GNEA 3ASLA 3HCUA 1WEEA 4R2YA 1Z2QA 1K2FA 5I3LA 2H0DB 4Q6FA 3N9OA 2IDAA 1V87A 2F6NA 4I7DA 2L75A 2LGKA 2KWNA 2DX8A 2LRIC 4AVXA 1JM7A 3C6WA 3FL2A 1WILA 3SHBA 2MNYA 4FJCA 3DQVR 4QF2A 2G45A 1WGMA 5TBNA 5FEYA 3KQIA 1MM2A 2PUYA 3ZNIA 2C2LA 2YU4A 3SOWA 4CA1A 2K17A 2JMJA 1X4JA 5EYAF 4ZUXU 5C11A 4PPEA 2H0DA 4AP4A 3N9QA 1FP0A 3KV6A 5B77A 1N87A 2C2VS 2YQLA 3IHPA 4WZ3B 5G05B 4LLBA 2EODA 1X4IA 2ECIA 1Z6UA 2MT5A 2L80A 2F6JA 3U5MA 4W4UA 1ZBDB 4FO9A 4LJNA 3L1XA 2YT5A 1VFYA 1Z60A 2M1RA 2K4DA 1WEVA 3O34A 4LADB 4B86C 2LXHC 2MUMA 2EA6A 1FBVA 3M62A 5KH7A 3N9PA 2AN6A 2KWOA 1HYJA 1JOCA 1WEUA 2YSMA 2ECTA 4V3LC 3O70A 3ZTGA 2E6RA 3GV4A 4N3WA 1MM3A 5D1LB 2KIZA 2YHNA 4NN2A 2RSDA 2M3HA 2G6QA 5D1KB 2VJEB 5DINA 2CKLA 1G25A 4A4CA 1X4UA 2ECVA 2LGGA 3I2DA 3L11A 2QIZA 5LKXA 5TRBA 2KYUA 3LRQA 4YBMA 4WZ0A 1WEQA 2M85A 4L58A 3M63A 5H1UA 3N9MA 4A49A 4YABA 2VNFA 2FUUA 2EGPA 3V43A 1WIMA 1CHCA 2L43A 2NAAA 2Y43A 2MD8C 2ECJA 1VYXA 4IC3A 3KV5A 2KWKA 5AIUA 2JMIA 3T6RA 3U5PA 1WEWA 4YBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR4 A;  2HDP A;  3ZPV E;  5LKU A;  3PUQ A;  5JG6 A;  2YHO A;  4F52 B;  2YSJ A;  2L0B A;  4CCG X;  4XI1 A;  5H9M A;  2LV9 A;  2Y1N A;  2KFT A;  2PNX A;  2MIQ A;  4FIP A;  3ZVZ B;  1LDJ B;  1HYI A;  2LQ6 A;  1WES A;  2RI7 A;  4QF3 A;  4R7E A;  4O64 A;  3MHH A;  5B76 A;  5J3X A;  2YUR A;  2VP7 A;  4ZQL A;  3O37 A;  5B8D A;  2ZET C;  4GB0 A;  2KGI A;  4MVT A;  3SOU A;  5LKZ A;  2K1J A;  2YQM A;  4L7X A;  5TDW A;  3EB5 A;  3LQH A;  4GND A;  2OXQ C;  5KH3 A;  2LGV A;  2L5U A;  5H1T A;  2LXP C;  3O33 A;  2VPE A;  4WZ2 A;  3LQI A;  2QIC A;  2YW8 A;  2VPG A;  5G04 B;  3U5N A;  2YYR A;  3U5O A;  4PTB A;  3N9N A;  4LKA A;  2UZG A;  2KWJ A;  1IYM A;  2FSA A;  1WFK A;  4GNG A;  5C13 A;  5B78 A;  5LKT A;  2KE1 A;  1DVP A;  3NG2 A;  4S3O C;  1JM7 B;  4V3K C;  3HTK C;  4P5O B;  3L1Z B;  2KU3 A;  3O36 A;  1LDK C;  4ZDT A;  3GL6 A;  3C5K A;  2F42 A;  2VJF B;  1F62 A;  4IC2 A;  4GNF A;  1BOR A;  4X3G A;  4A0C D;  1U6G B;  2JMD A;  2HYE D;  2CT2 A;  3HCT A;  4WA6 A;  4B7Y C;  5FB0 A;  2VJE A;  2G43 A;  2ECN A;  5FER A;  3RTR B;  1WEP A;  4YAX A;  3VK6 A;  1RMD A;  5FB1 A;  2MA5 A;  3RPG B;  2D8S A;  1E4U A;  4MSX A;  2BAY A;  2XEU A;  1WE9 A;  1WEO A;  2I50 A;  2XB1 A;  2KRE A;  5B75 A;  5G0F A;  2E6S A;  2CSY A;  4AYC B;  3LQJ A;  1WEM A;  2LGL A;  4A4B A;  5H1V A;  4YAT A;  2VJF A;  3PHD A;  3ZPV 1;  3O35 A;  2FUI A;  4UP0 A;  3T7L A;  2KGG A;  2VPB A;  3MHS A;  3RPG C;  5KH9 A;  3M99 A;  2CSZ A;  3DPL R;  4I7C A;  4S3O B;  2YUC A;  3PUR A;  2CKL B;  5AIT A;  2M6M A;  3ZVY A;  5TAB A;  4R8P K;  2ECW A;  2VPD A;  3QZV A;  1T1H A;  2K16 A;  3N9L A;  1WEN A;  4C9Z A;  2MNZ A;  4UP5 A;  1XWH A;  4N4F A;  3ZYQ A;  4AYC A;  5B79 A;  2QJ0 A;  3SOX A;  2LDR A;  4TKP B;  4AUQ B;  3O7A A;  4BBQ A;  2Y1M A;  3EB6 A;  4YBT A;  4YAD A;  1VD4 A;  4BHW A;  4YC9 A;  5TDR A;  5LCW B;  2YRE A;  4FK5 A;  2JRJ A;  4UI9 B;  4LK9 A;  2LN0 A;  4I7B A;  5DKA A;  3KNV A;  2ECG A;  3HCS A;  2MA6 A;  5D1M B;  2MD7 B;  4GNE A;  3ASL A;  3HCU A;  1WEE A;  4R2Y A;  1Z2Q A;  1K2F A;  5I3L A;  2H0D B;  4Q6F A;  3N9O A;  2IDA A;  1V87 A;  2F6N A;  4I7D A;  2L75 A;  2LGK A;  2KWN A;  2DX8 A;  2LRI C;  4AVX A;  1JM7 A;  3C6W A;  3FL2 A;  1WIL A;  3SHB A;  2MNY A;  4FJC A;  3DQV R;  4QF2 A;  2G45 A;  1WGM A;  5TBN A;  5FEY A;  3KQI A;  1MM2 A;  2PUY A;  3ZNI A;  2C2L A;  2YU4 A;  3SOW A;  4CA1 A;  2K17 A;  2JMJ A;  1X4J A;  5EYA F;  4ZUX U;  5C11 A;  4PPE A;  2H0D A;  4AP4 A;  3N9Q A;  1FP0 A;  3KV6 A;  5B77 A;  1N87 A;  2C2V S;  2YQL A;  3IHP A;  4WZ3 B;  5G05 B;  4LLB A;  2EOD A;  1X4I A;  2ECI A;  1Z6U A;  2MT5 A;  2L80 A;  2F6J A;  3U5M A;  4W4U A;  1ZBD B;  4FO9 A;  4LJN A;  3L1X A;  2YT5 A;  1VFY A;  1Z60 A;  2M1R A;  2K4D A;  1WEV A;  3O34 A;  4LAD B;  4B86 C;  2LXH C;  2MUM A;  2EA6 A;  1FBV A;  3M62 A;  5KH7 A;  3N9P A;  2AN6 A;  2KWO A;  1HYJ A;  1JOC A;  1WEU A;  2YSM A;  2ECT A;  4V3L C;  3O70 A;  3ZTG A;  2E6R A;  3GV4 A;  4N3W A;  1MM3 A;  5D1L B;  2KIZ A;  2YHN A;  4NN2 A;  2RSD A;  2M3H A;  2G6Q A;  5D1K B;  2VJE B;  5DIN A;  2CKL A;  1G25 A;  4A4C A;  1X4U A;  2ECV A;  2LGG A;  3I2D A;  3L11 A;  2QIZ A;  5LKX A;  5TRB A;  2KYU A;  3LRQ A;  4YBM A;  4WZ0 A;  1WEQ A;  2M85 A;  4L58 A;  3M63 A;  5H1U A;  3N9M A;  4A49 A;  4YAB A;  2VNF A;  2FUU A;  2EGP A;  3V43 A;  1WIM A;  1CHC A;  2L43 A;  2NAA A;  2Y43 A;  2MD8 C;  2ECJ A;  1VYX A;  4IC3 A;  3KV5 A;  2KWK A;  5AIU A;  2JMI A;  3T6R A;  3U5P A;  1WEW A;  4YBS A; 
#chains in the Genus database with same CATH topology
 2KR4 A;  2KKX A;  2CRW A;  2HDP A;  3ZPV E;  2P57 A;  5LKU A;  3PUQ A;  2JUN A;  5JG6 A;  2YHO A;  4F52 B;  2YSJ A;  2L0B A;  4CCG X;  4XI1 A;  5H9M A;  2LV9 A;  2Y1N A;  2KFT A;  2PNX A;  2MIQ A;  4FIP A;  3ZVZ B;  1LDJ B;  1HYI A;  2XOZ A;  2LQ6 A;  1WES A;  2KKY A;  2RI7 A;  4QF3 A;  5SVY A;  4R7E A;  4O64 A;  3MHH A;  2XOC A;  5B76 A;  5J3X A;  2DSM A;  2YUR A;  2VP7 A;  4ZQL A;  3O37 A;  5B8D A;  2YVR A;  2ZET C;  4GB0 A;  2KGI A;  3FM8 C;  4MVT A;  3SOU A;  5LKZ A;  3DWD A;  2K1J A;  2YQM A;  4L7X A;  3M7K A;  5TDW A;  2L7P A;  3EB5 A;  3LQH A;  2EGM A;  4GND A;  2OXQ C;  5KH3 A;  2LGV A;  2L5U A;  5H1T A;  2LXP C;  3O33 A;  2VPE A;  4WZ2 A;  3LQI A;  2QIC A;  2YW8 A;  2VPG A;  5G04 B;  3U5N A;  2YYR A;  3U5O A;  4PTB A;  2IQJ A;  3N9N A;  3LDY A;  4LKA A;  2UZG A;  2KWJ A;  1IYM A;  2FSA A;  1WFK A;  4GNG A;  2LAU A;  5C13 A;  5B78 A;  5LKT A;  3FJU B;  2KE1 A;  1DVP A;  3NG2 A;  4S3O C;  1JM7 B;  4V3K C;  3HTK C;  4P5O B;  2M13 A;  4Z0R A;  3L1Z B;  2RR4 A;  2KU3 A;  3O36 A;  3O47 A;  4O62 A;  1LDK C;  4ZDT A;  3GL6 A;  3FAO A;  3C5K A;  2F42 A;  5SVI B;  2VJF B;  1F62 A;  4IC2 A;  4GNF A;  1BOR A;  4X3G A;  4A0C D;  1U6G B;  2JMD A;  2D8U A;  2HYE D;  2CT2 A;  2OWA A;  3DDT A;  3HCT A;  4WA6 A;  4B7Y C;  5FB0 A;  2VJE A;  2G43 A;  1MBM A;  2ECN A;  5FER A;  3RTR B;  1WEP A;  4YAX A;  3VK6 A;  1RMD A;  5FB1 A;  2MA5 A;  3RPG B;  2D8S A;  1E4U A;  4MSX A;  2BAY A;  2XEU A;  1WE9 A;  1WEO A;  2I50 A;  2XB1 A;  2KRE A;  5B75 A;  5G0F A;  2E6S A;  4Z0O A;  3LVR E;  2CSY A;  4AYC B;  3LQJ A;  1WEM A;  2LGL A;  4A4B A;  5H1V A;  4YAT A;  5SVI A;  2VJF A;  3PHD A;  3ZPV 1;  3O35 A;  2FUI A;  3SUB A;  4UP0 A;  3T7L A;  2KGG A;  2VPB A;  3MHS A;  3RPG C;  5KH9 A;  3M99 A;  2CSZ A;  3DPL R;  4I7C A;  4QQ4 A;  4S3O B;  2YUC A;  3PUR A;  2CKL B;  5AIT A;  2M6M A;  3ZVY A;  5TAB A;  4R8P K;  2ECW A;  2VPD A;  2CRR A;  3QZV A;  1T1H A;  2K16 A;  3N9L A;  1WEN A;  4C9Z A;  2MNZ A;  4UP5 A;  1XWH A;  4N4F A;  3ZYQ A;  4AYC A;  5B79 A;  2QJ0 A;  3SOX A;  2LDR A;  4TKP B;  2MKE A;  4AUQ B;  3FAN A;  3O7A A;  4BBQ A;  2XOY A;  2Y1M A;  3EB6 A;  4YBT A;  4YAD A;  1VD4 A;  4BHW A;  4YC9 A;  5TDR A;  4OGC A;  5LCW B;  2YRE A;  4FK5 A;  2JRJ A;  4UI9 B;  4LK9 A;  2LN0 A;  4I7B A;  5DKA A;  2EXU A;  3KNV A;  2ECG A;  3HCS A;  3JUE A;  2DJA A;  3LJU X;  2MA6 A;  2CON A;  5D1M B;  2MD7 B;  4GNE A;  3ASL A;  3HCU A;  1WEE A;  4R2Y A;  1Z2Q A;  4H9D A;  1K2F A;  5I3L A;  2H0D B;  4Q6F A;  3N9O A;  2IDA A;  1V87 A;  2F6N A;  4I7D A;  2L75 A;  2LGK A;  2KWN A;  2DX8 A;  2LRI C;  4AVX A;  1JM7 A;  3C6W A;  3FL2 A;  1WIL A;  3SHB A;  2MNY A;  5SVX A;  4FJC A;  3DQV R;  4QF2 A;  2G45 A;  1WGM A;  5TBN A;  2FFW A;  5FEY A;  3H7H A;  3KQI A;  1MM2 A;  2PUY A;  3T9K A;  3ZNI A;  2C2L A;  2YU4 A;  3SOW A;  4CA1 A;  2K17 A;  2JMJ A;  1X4J A;  5EYA F;  4ZUX U;  5C11 A;  4PPE A;  2H0D A;  4AP4 A;  3N9Q A;  1FP0 A;  3Q1D A;  3FEH A;  3KV6 A;  5B77 A;  1N87 A;  2C2V S;  2YQL A;  3IHP A;  4WZ3 B;  5G05 B;  4LLB A;  2FD4 A;  2EOD A;  1X4I A;  2JM3 A;  2ECI A;  1Z6U A;  2MT5 A;  2L80 A;  2B0O E;  2F6J A;  3U5M A;  4W4U A;  1ZBD B;  4FO9 A;  4LJN A;  1DCQ A;  3L1X A;  2YT5 A;  1VFY A;  1Z60 A;  5K3Q A;  2M1R A;  3LVQ E;  2K4D A;  1WEV A;  3O34 A;  4LAD B;  4B86 C;  2LXH C;  2MUM A;  2EA6 A;  1FBV A;  3M62 A;  5KH7 A;  3N9P A;  2AN6 A;  2KWO A;  1HYJ A;  1JOC A;  4F1P A;  1WEU A;  2YSM A;  2ECT A;  4V3L C;  3MDB C;  3O70 A;  3ZTG A;  2E6R A;  3GV4 A;  4N3W A;  1MM3 A;  5D1L B;  2KIZ A;  2CSV A;  2YHN A;  4NN2 A;  2RSD A;  2M3H A;  2G6Q A;  5D1K B;  2VJE B;  3KDE C;  5DIN A;  2CKL A;  3PLW A;  1G25 A;  4A4C A;  1X4U A;  2ECV A;  2LGG A;  3I2D A;  3L11 A;  2QIZ A;  5LKX A;  5TRB A;  2KYU A;  2XP0 A;  3LRQ A;  4YBM A;  4WZ0 A;  1WEQ A;  2M85 A;  4L58 A;  3M63 A;  5H1U A;  3N9M A;  2E61 A;  4A49 A;  4OGE A;  4YAB A;  2VNF A;  2FUU A;  2EGP A;  3V43 A;  1WIM A;  1CHC A;  2L43 A;  2NAA A;  2Y43 A;  2MD8 C;  2ECJ A;  1VYX A;  4IC3 A;  3KV5 A;  2KWK A;  5AIU A;  2JMI A;  3T6R A;  3U5P A;  1WEW A;  3E2D A;  4YBS A; 
#chains in the Genus database with same CATH homology
 2KR4 A;  2HDP A;  3ZPV E;  5LKU A;  3PUQ A;  5JG6 A;  2YHO A;  4F52 B;  2YSJ A;  2L0B A;  4CCG X;  4XI1 A;  5H9M A;  2LV9 A;  2Y1N A;  2KFT A;  2PNX A;  2MIQ A;  4FIP A;  3ZVZ B;  1LDJ B;  1HYI A;  2LQ6 A;  1WES A;  2RI7 A;  4QF3 A;  4R7E A;  4O64 A;  3MHH A;  5B76 A;  5J3X A;  2YUR A;  2VP7 A;  4ZQL A;  3O37 A;  5B8D A;  2ZET C;  4GB0 A;  2KGI A;  4MVT A;  3SOU A;  5LKZ A;  2K1J A;  2YQM A;  4L7X A;  5TDW A;  3EB5 A;  3LQH A;  4GND A;  2OXQ C;  5KH3 A;  2LGV A;  2L5U A;  5H1T A;  2LXP C;  3O33 A;  2VPE A;  4WZ2 A;  3LQI A;  2QIC A;  2YW8 A;  2VPG A;  5G04 B;  3U5N A;  2YYR A;  3U5O A;  4PTB A;  3N9N A;  4LKA A;  2UZG A;  2KWJ A;  1IYM A;  2FSA A;  1WFK A;  4GNG A;  5C13 A;  5B78 A;  5LKT A;  2KE1 A;  1DVP A;  3NG2 A;  4S3O C;  1JM7 B;  4V3K C;  3HTK C;  4P5O B;  3L1Z B;  2KU3 A;  3O36 A;  1LDK C;  4ZDT A;  3GL6 A;  3C5K A;  2F42 A;  2VJF B;  1F62 A;  4IC2 A;  4GNF A;  1BOR A;  4X3G A;  4A0C D;  1U6G B;  2JMD A;  2HYE D;  2CT2 A;  3HCT A;  4WA6 A;  4B7Y C;  5FB0 A;  2VJE A;  2G43 A;  2ECN A;  5FER A;  3RTR B;  1WEP A;  4YAX A;  3VK6 A;  1RMD A;  5FB1 A;  2MA5 A;  3RPG B;  2D8S A;  1E4U A;  4MSX A;  2BAY A;  2XEU A;  1WE9 A;  1WEO A;  2I50 A;  2XB1 A;  2KRE A;  5B75 A;  5G0F A;  2E6S A;  2CSY A;  4AYC B;  3LQJ A;  1WEM A;  2LGL A;  4A4B A;  5H1V A;  4YAT A;  2VJF A;  3PHD A;  3ZPV 1;  3O35 A;  2FUI A;  4UP0 A;  3T7L A;  2KGG A;  2VPB A;  3MHS A;  3RPG C;  5KH9 A;  3M99 A;  2CSZ A;  3DPL R;  4I7C A;  4S3O B;  2YUC A;  3PUR A;  2CKL B;  5AIT A;  2M6M A;  3ZVY A;  5TAB A;  4R8P K;  2ECW A;  2VPD A;  3QZV A;  1T1H A;  2K16 A;  3N9L A;  1WEN A;  4C9Z A;  2MNZ A;  4UP5 A;  1XWH A;  4N4F A;  3ZYQ A;  4AYC A;  5B79 A;  2QJ0 A;  3SOX A;  2LDR A;  4TKP B;  4AUQ B;  3O7A A;  4BBQ A;  2Y1M A;  3EB6 A;  4YBT A;  4YAD A;  1VD4 A;  4BHW A;  4YC9 A;  5TDR A;  5LCW B;  2YRE A;  4FK5 A;  2JRJ A;  4UI9 B;  4LK9 A;  2LN0 A;  4I7B A;  5DKA A;  3KNV A;  2ECG A;  3HCS A;  2MA6 A;  5D1M B;  2MD7 B;  4GNE A;  3ASL A;  3HCU A;  1WEE A;  4R2Y A;  1Z2Q A;  1K2F A;  5I3L A;  2H0D B;  4Q6F A;  3N9O A;  2IDA A;  1V87 A;  2F6N A;  4I7D A;  2L75 A;  2LGK A;  2KWN A;  2DX8 A;  2LRI C;  4AVX A;  1JM7 A;  3C6W A;  3FL2 A;  1WIL A;  3SHB A;  2MNY A;  4FJC A;  3DQV R;  4QF2 A;  2G45 A;  1WGM A;  5TBN A;  5FEY A;  3KQI A;  1MM2 A;  2PUY A;  3ZNI A;  2C2L A;  2YU4 A;  3SOW A;  4CA1 A;  2K17 A;  2JMJ A;  1X4J A;  5EYA F;  4ZUX U;  5C11 A;  4PPE A;  2H0D A;  4AP4 A;  3N9Q A;  1FP0 A;  3KV6 A;  5B77 A;  1N87 A;  2C2V S;  2YQL A;  3IHP A;  4WZ3 B;  5G05 B;  4LLB A;  2EOD A;  1X4I A;  2ECI A;  1Z6U A;  2MT5 A;  2L80 A;  2F6J A;  3U5M A;  4W4U A;  1ZBD B;  4FO9 A;  4LJN A;  3L1X A;  2YT5 A;  1VFY A;  1Z60 A;  2M1R A;  2K4D A;  1WEV A;  3O34 A;  4LAD B;  4B86 C;  2LXH C;  2MUM A;  2EA6 A;  1FBV A;  3M62 A;  5KH7 A;  3N9P A;  2AN6 A;  2KWO A;  1HYJ A;  1JOC A;  1WEU A;  2YSM A;  2ECT A;  4V3L C;  3O70 A;  3ZTG A;  2E6R A;  3GV4 A;  4N3W A;  1MM3 A;  5D1L B;  2KIZ A;  2YHN A;  4NN2 A;  2RSD A;  2M3H A;  2G6Q A;  5D1K B;  2VJE B;  5DIN A;  2CKL A;  1G25 A;  4A4C A;  1X4U A;  2ECV A;  2LGG A;  3I2D A;  3L11 A;  2QIZ A;  5LKX A;  5TRB A;  2KYU A;  3LRQ A;  4YBM A;  4WZ0 A;  1WEQ A;  2M85 A;  4L58 A;  3M63 A;  5H1U A;  3N9M A;  4A49 A;  4YAB A;  2VNF A;  2FUU A;  2EGP A;  3V43 A;  1WIM A;  1CHC A;  2L43 A;  2NAA A;  2Y43 A;  2MD8 C;  2ECJ A;  1VYX A;  4IC3 A;  3KV5 A;  2KWK A;  5AIU A;  2JMI A;  3T6R A;  3U5P A;  1WEW A;  4YBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...