5DKAA

A c2hc zinc finger is essential for the activity of the ring ubiquitin ligase rnf125
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
TSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF125
publication title A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 29
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05605 zf-Di19 Drought induced 19 protein (Di19), zinc-binding
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
A PF18574 zf_C2HC_14 C2HC Zing finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5dkaA00
2JMJA 5DINA 2CSYA 4I7CA 1T1HA 4AVXA 1WENA 1HYJA 1WGMA 3KQIA 1WEWA 4NN2A 3O36A 2LQ6A 4V3LC 4UP5A 5H1UA 4R8PK 3RPGC 2G45A 1X4UA 4YBTA 3T7LA 4YADA 5TBNA 5TRBA 2Y1MA 2KWJA 4CA1A 3SOWA 2K1JA 2KIZA 5LKXA 3PURA 4GB0A 1V87A 5TDWA 4AUQB 4A4CA 2C2LA 5DKAA 5B8DA 4X3GA 2BAYA 1WEMA 2XEUA 5G04B 1X4IA 2LGKA 2OXQC 4B7YC 3EB5A 2MNZA 1FP0A 2MUMA 3N9PA 2Y1NA 3O37A 3L11A 3MHSA 4Q6FA 2LGGA 3IHPA 2H0DB 4WZ3B 5G05B 2E6RA 3ZPV1 1WESA 2DX8A 2JMIA 4FO9A 2JRJA 2VPDA 2YT5A 5LCWB 2CKLA 2L75A 3KV6A 4L58A 2VPBA 3FL2A 2KFTA 5B76A 4BHWA 4IC3A 3U5PA 2KREA 1WEEA 3I2DA 3ZTGA 4PTBA 2L80A 5H1TA 5FB1A 3SHBA 2KWKA 4GNEA 4GNDA 4L7XA 1Z6UA 2M1RA 5D1LB 1FBVA 2ECWA 5H9MA 3U5NA 3PUQA 1IYMA 1JM7B 2MT5A 4N3WA 3LQJA 4P5OB 2MNYA 2VP7A 2LXPC 2QIZA 1LDJB 3DQVR 2HDPA 3T6RA 2C2VS 4A49A 3O7AA 1RMDA 2KWNA 2LRIC 3ZVYA 2LXHC 4IC2A 2ECGA 4TKPB 2YSJA 3U5OA 1WEVA 2EODA 3N9QA 4BBQA 2G43A 2KR4A 2K16A 3O70A 2YQLA 4B86C 5C11A 5FERA 2UZGA 2YUCA 4YATA 1G25A 2G6QA 4LK9A 1JOCA 1WEPA 3LQHA 4GNFA 4A0CD 2MIQA 4A4BA 4AYCA 3N9OA 2QJ0A 1ZBDB 4ZDTA 4CCGX 3M99A 3L1ZB 2KU3A 4YBSA 1Z60A 2YURA 2MD7B 5EYAF 3LRQA 3N9LA 3C6WA 4FIPA 2YHOA 1U6GB 3GV4A 5G0FA 2QICA 2YSMA 2CSZA 1WIMA 3DPLR 2PNXA 3M62A 2MA5A 2H0DA 3SOXA 4YBMA 1HYIA 3C5KA 5KH7A 2LGVA 2K17A 4W4UA 5LKUA 3HCUA 2YYRA 2HYED 2ECVA 4V3KC 1WFKA 2ECNA 3MHHA 2ZETC 2EA6A 4S3OB 4XI1A 5LKTA 1X4JA 4MVTA 5JG6A 2VJFA 1WEOA 3ZPVE 5AIUA 4LKAA 2CKLB 2IDAA 2KGIA 1VFYA 4WZ0A 4PPEA 1F62A 2MD8C 3O35A 4UP0A 2NAAA 2JMDA 3V43A 1CHCA 2MA6A 4MSXA 2VJEB 1JM7A 3QZVA 1WE9A 2FUUA 4YABA 3O34A 5FB0A 2YW8A 3RTRB 1WEQA 3NG2A 4LADB 2E6SA 3KNVA 4C9ZA 4WA6A 4F52B 4ZUXU 3PHDA 3SOUA 1N87A 5LKZA 2F6JA 2M6MA 1Z2QA 4LLBA 1MM3A 5H1VA 2VNFA 2VPGA 5C13A 2XB1A 3RPGB 2RSDA 2FSAA 4I7DA 4FJCA 5AITA 2KYUA 2LDRA 3ASLA 5I3LA 4UI9B 4N4FA 3ZNIA 3VK6A 2K4DA 2FUIA 3ZVZB 4R2YA 2LN0A 3N9NA 2YREA 5B79A 4LJNA 2CT2A 4QF3A 4AYCB 2ECIA 5D1MB 3L1XA 2YHNA 2D8SA 2LGLA 1LDKC 2YQMA 5D1KB 1VYXA 4R7EA 2KE1A 2AN6A 2KGGA 5B78A 2PUYA 2RI7A 4YC9A 1K2FA 2I50A 3GL6A 2Y43A 4YAXA 4I7BA 3LQIA 2M85A 5J3XA 4FK5A 3N9MA 5B75A 2M3HA 2LV9A 5TDRA 1E4UA 4GNGA 4WZ2A 2L0BA 1WEUA 1DVPA 1WILA 3HCTA 4ZQLA 2VJEA 2VJFB 1VD4A 1MM2A 3HCSA 2KWOA 5B77A 3EB6A 4S3OC 2ECTA 5KH3A 2L5UA 3ZYQA 2F42A 3M63A 2F6NA 4QF2A 3O33A 2EGPA 2YU4A 3HTKC 1BORA 5KH9A 5FEYA 2ECJA 5TABA 3KV5A 1XWHA 2L43A 4O64A 2VPEA 4AP4A 3U5MA
chains in the Genus database with same CATH superfamily
2JMJA 5DINA 2CSYA 4I7CA 1T1HA 4AVXA 1WENA 1HYJA 1WGMA 3KQIA 1WEWA 4NN2A 2L7PA 3O36A 2LQ6A 4V3LC 4UP5A 5SVIB 3LDYA 5H1UA 4R8PK 3RPGC 2G45A 1X4UA 4YBTA 3T7LA 3E2DA 2FD4A 4YADA 5TRBA 5TBNA 2Y1MA 2KWJA 3M7KA 3FJUB 4CA1A 3SOWA 2K1JA 2KIZA 3LVRE 2RR4A 5LKXA 3PURA 2JUNA 4GB0A 3DWDA 1V87A 5TDWA 4AUQB 2EXUA 4A4CA 2C2LA 5DKAA 5B8DA 4OGEA 4X3GA 2BAYA 1WEMA 2KKYA 2XEUA 5G04B 1X4IA 2LGKA 2OXQC 4B7YC 3EB5A 2MNZA 1FP0A 2MUMA 3N9PA 3O47A 2Y1NA 3O37A 3L11A 3MHSA 4Q6FA 3FAOA 2LGGA 3IHPA 2H0DB 4WZ3B 5G05B 2E6RA 3ZPV1 1WESA 2DX8A 2JMIA 4FO9A 2JRJA 2VPDA 2YT5A 5LCWB 2CKLA 2L75A 3KV6A 4L58A 2VPBA 3FL2A 2KFTA 5B76A 4BHWA 2JM3A 4IC3A 3U5PA 2KREA 1WEEA 2XOYA 3I2DA 3ZTGA 4Z0RA 4PTBA 2L80A 5H1TA 5FB1A 2D8UA 2KWKA 4GNEA 3SHBA 4GNDA 3LVQE 4L7XA 1Z6UA 2M1RA 5D1LB 1FBVA 2ECWA 5H9MA 2YVRA 3U5NA 3PUQA 1IYMA 1JM7B 2MT5A 4N3WA 3LQJA 4P5OB 2MNYA 2VP7A 2LXPC 2QIZA 1LDJB 2XP0A 3DQVR 2HDPA 3T6RA 2C2VS 4A49A 3O7AA 1RMDA 2KWNA 2LRIC 3ZVYA 2LXHC 4IC2A 2ECGA 4TKPB 2YSJA 3U5OA 1WEVA 2EODA 3N9QA 4O62A 4BBQA 2G43A 2KR4A 2K16A 3O70A 2YQLA 5K3QA 4B86C 5C11A 5FERA 2UZGA 2YUCA 4YATA 1G25A 2G6QA 4LK9A 1JOCA 1WEPA 1MBMA 3LQHA 4GNFA 4A0CD 2MIQA 4A4BA 4AYCA 3N9OA 3SUBA 2QJ0A 1ZBDB 2CRRA 4ZDTA 4CCGX 3M99A 3L1ZB 2KU3A 2M13A 4YBSA 1Z60A 2YURA 2MD7B 5EYAF 3LRQA 4QQ4A 3N9LA 3C6WA 4FIPA 2YHOA 1U6GB 4F1PA 3GV4A 5G0FA 2E61A 2QICA 5SVYA 2YSMA 2CSZA 1WIMA 3DPLR 2PNXA 3M62A 2MA5A 2H0DA 3SOXA 3JUEA 4YBMA 3FEHA 1HYIA 3C5KA 5KH7A 2LGVA 2K17A 4W4UA 3MDBC 3PLWA 5LKUA 3HCUA 2YYRA 2CSVA 2HYED 2ECVA 4V3KC 1WFKA 2ECNA 3MHHA 2ZETC 2EA6A 3FM8C 4S3OB 4XI1A 5LKTA 1X4JA 4MVTA 5JG6A 2VJFA 1WEOA 3ZPVE 5AIUA 4LKAA 2CKLB 2IDAA 2KGIA 1VFYA 4WZ0A 4PPEA 1F62A 4H9DA 2MD8C 3O35A 4UP0A 2NAAA 2JMDA 3V43A 1CHCA 2MA6A 4MSXA 2VJEB 1JM7A 3QZVA 1WE9A 2FUUA 4YABA 3O34A 5FB0A 2YW8A 3RTRB 1WEQA 3NG2A 3H7HA 4LADB 2E6SA 3KNVA 4C9ZA 4WA6A 4F52B 4ZUXU 3PHDA 3SOUA 1N87A 2CONA 5LKZA 2KKXA 2F6JA 4Z0OA 2M6MA 1Z2QA 4LLBA 1MM3A 5H1VA 2VNFA 2VPGA 5C13A 2XB1A 3RPGB 2RSDA 2FSAA 5SVIA 4I7DA 4FJCA 5AITA 2KYUA 2LDRA 3ASLA 5I3LA 4UI9B 4N4FA 3ZNIA 3VK6A 2DJAA 2K4DA 2FUIA 3ZVZB 3DDTA 4R2YA 2LN0A 2EGMA 2FFWA 3N9NA 2DSMA 2YREA 2B0OE 5B79A 3KDEC 4LJNA 2CT2A 4QF3A 4AYCB 2ECIA 3Q1DA 5D1MB 3L1XA 2XOZA 2YHNA 2D8SA 2LGLA 1LDKC 2XOCA 2YQMA 2OWAA 5D1KB 1VYXA 4R7EA 2KE1A 2AN6A 2KGGA 5B78A 2PUYA 2CRWA 2RI7A 4YC9A 1K2FA 2I50A 3GL6A 2Y43A 4YAXA 4I7BA 3LQIA 2M85A 5J3XA 4FK5A 2MKEA 3N9MA 5B75A 2M3HA 2LV9A 5TDRA 4OGCA 1E4UA 4GNGA 4WZ2A 2L0BA 1WEUA 1DVPA 1WILA 3HCTA 4ZQLA 2VJEA 2VJFB 1VD4A 1MM2A 3HCSA 5SVXA 2KWOA 5B77A 3EB6A 4S3OC 2ECTA 5KH3A 2L5UA 3ZYQA 3LJUX 2F42A 3M63A 2LAUA 2F6NA 4QF2A 3T9KA 3O33A 2EGPA 2YU4A 3HTKC 1DCQA 1BORA 5KH9A 5FEYA 2ECJA 3FANA 5TABA 3KV5A 2IQJA 1XWHA 2L43A 4O64A 2P57A 2VPEA 4AP4A 3U5MA
chains in the Genus database with same CATH topology
2JMJA 5DINA 2CSYA 4I7CA 1T1HA 4AVXA 1WENA 1HYJA 1WGMA 3KQIA 1WEWA 4NN2A 3O36A 2LQ6A 4V3LC 4UP5A 5H1UA 4R8PK 3RPGC 2G45A 1X4UA 4YBTA 3T7LA 4YADA 5TBNA 5TRBA 2Y1MA 2KWJA 4CA1A 3SOWA 2K1JA 2KIZA 5LKXA 3PURA 4GB0A 1V87A 5TDWA 4AUQB 4A4CA 2C2LA 5DKAA 5B8DA 4X3GA 2BAYA 1WEMA 2XEUA 5G04B 1X4IA 2LGKA 2OXQC 4B7YC 3EB5A 2MNZA 1FP0A 2MUMA 3N9PA 2Y1NA 3O37A 3L11A 3MHSA 4Q6FA 2LGGA 3IHPA 2H0DB 4WZ3B 5G05B 2E6RA 3ZPV1 1WESA 2DX8A 2JMIA 4FO9A 2JRJA 2VPDA 2YT5A 5LCWB 2CKLA 2L75A 3KV6A 4L58A 2VPBA 3FL2A 2KFTA 5B76A 4BHWA 4IC3A 3U5PA 2KREA 1WEEA 3I2DA 3ZTGA 4PTBA 2L80A 5H1TA 5FB1A 3SHBA 2KWKA 4GNEA 4GNDA 4L7XA 1Z6UA 2M1RA 5D1LB 1FBVA 2ECWA 5H9MA 3U5NA 3PUQA 1IYMA 1JM7B 2MT5A 4N3WA 3LQJA 4P5OB 2MNYA 2VP7A 2LXPC 2QIZA 1LDJB 3DQVR 2HDPA 3T6RA 2C2VS 4A49A 3O7AA 1RMDA 2KWNA 2LRIC 3ZVYA 2LXHC 4IC2A 2ECGA 4TKPB 2YSJA 3U5OA 1WEVA 2EODA 3N9QA 4BBQA 2G43A 2KR4A 2K16A 3O70A 2YQLA 4B86C 5C11A 5FERA 2UZGA 2YUCA 4YATA 1G25A 2G6QA 4LK9A 1JOCA 1WEPA 3LQHA 4GNFA 4A0CD 2MIQA 4A4BA 4AYCA 3N9OA 2QJ0A 1ZBDB 4ZDTA 4CCGX 3M99A 3L1ZB 2KU3A 4YBSA 1Z60A 2YURA 2MD7B 5EYAF 3LRQA 3N9LA 3C6WA 4FIPA 2YHOA 1U6GB 3GV4A 5G0FA 2QICA 2YSMA 2CSZA 1WIMA 3DPLR 2PNXA 3M62A 2MA5A 2H0DA 3SOXA 4YBMA 1HYIA 3C5KA 5KH7A 2LGVA 2K17A 4W4UA 5LKUA 3HCUA 2YYRA 2HYED 2ECVA 4V3KC 1WFKA 2ECNA 3MHHA 2ZETC 2EA6A 4S3OB 4XI1A 5LKTA 1X4JA 4MVTA 5JG6A 2VJFA 1WEOA 3ZPVE 5AIUA 4LKAA 2CKLB 2IDAA 2KGIA 1VFYA 4WZ0A 4PPEA 1F62A 2MD8C 3O35A 4UP0A 2NAAA 2JMDA 3V43A 1CHCA 2MA6A 4MSXA 2VJEB 1JM7A 3QZVA 1WE9A 2FUUA 4YABA 3O34A 5FB0A 2YW8A 3RTRB 1WEQA 3NG2A 4LADB 2E6SA 3KNVA 4C9ZA 4WA6A 4F52B 4ZUXU 3PHDA 3SOUA 1N87A 5LKZA 2F6JA 2M6MA 1Z2QA 4LLBA 1MM3A 5H1VA 2VNFA 2VPGA 5C13A 2XB1A 3RPGB 2RSDA 2FSAA 4I7DA 4FJCA 5AITA 2KYUA 2LDRA 3ASLA 5I3LA 4UI9B 4N4FA 3ZNIA 3VK6A 2K4DA 2FUIA 3ZVZB 4R2YA 2LN0A 3N9NA 2YREA 5B79A 4LJNA 2CT2A 4QF3A 4AYCB 2ECIA 5D1MB 3L1XA 2YHNA 2D8SA 2LGLA 1LDKC 2YQMA 5D1KB 1VYXA 4R7EA 2KE1A 2AN6A 2KGGA 5B78A 2PUYA 2RI7A 4YC9A 1K2FA 2I50A 3GL6A 2Y43A 4YAXA 4I7BA 3LQIA 2M85A 5J3XA 4FK5A 3N9MA 5B75A 2M3HA 2LV9A 5TDRA 1E4UA 4GNGA 4WZ2A 2L0BA 1WEUA 1DVPA 1WILA 3HCTA 4ZQLA 2VJEA 2VJFB 1VD4A 1MM2A 3HCSA 2KWOA 5B77A 3EB6A 4S3OC 2ECTA 5KH3A 2L5UA 3ZYQA 2F42A 3M63A 2F6NA 4QF2A 3O33A 2EGPA 2YU4A 3HTKC 1BORA 5KH9A 5FEYA 2ECJA 5TABA 3KV5A 1XWHA 2L43A 4O64A 2VPEA 4AP4A 3U5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMJ A;  5DIN A;  2CSY A;  4I7C A;  1T1H A;  4AVX A;  1WEN A;  1HYJ A;  1WGM A;  3KQI A;  1WEW A;  4NN2 A;  3O36 A;  2LQ6 A;  4V3L C;  4UP5 A;  5H1U A;  4R8P K;  3RPG C;  2G45 A;  1X4U A;  4YBT A;  3T7L A;  4YAD A;  5TBN A;  5TRB A;  2Y1M A;  2KWJ A;  4CA1 A;  3SOW A;  2K1J A;  2KIZ A;  5LKX A;  3PUR A;  4GB0 A;  1V87 A;  5TDW A;  4AUQ B;  4A4C A;  2C2L A;  5DKA A;  5B8D A;  4X3G A;  2BAY A;  1WEM A;  2XEU A;  5G04 B;  1X4I A;  2LGK A;  2OXQ C;  4B7Y C;  3EB5 A;  2MNZ A;  1FP0 A;  2MUM A;  3N9P A;  2Y1N A;  3O37 A;  3L11 A;  3MHS A;  4Q6F A;  2LGG A;  3IHP A;  2H0D B;  4WZ3 B;  5G05 B;  2E6R A;  3ZPV 1;  1WES A;  2DX8 A;  2JMI A;  4FO9 A;  2JRJ A;  2VPD A;  2YT5 A;  5LCW B;  2CKL A;  2L75 A;  3KV6 A;  4L58 A;  2VPB A;  3FL2 A;  2KFT A;  5B76 A;  4BHW A;  4IC3 A;  3U5P A;  2KRE A;  1WEE A;  3I2D A;  3ZTG A;  4PTB A;  2L80 A;  5H1T A;  5FB1 A;  3SHB A;  2KWK A;  4GNE A;  4GND A;  4L7X A;  1Z6U A;  2M1R A;  5D1L B;  1FBV A;  2ECW A;  5H9M A;  3U5N A;  3PUQ A;  1IYM A;  1JM7 B;  2MT5 A;  4N3W A;  3LQJ A;  4P5O B;  2MNY A;  2VP7 A;  2LXP C;  2QIZ A;  1LDJ B;  3DQV R;  2HDP A;  3T6R A;  2C2V S;  4A49 A;  3O7A A;  1RMD A;  2KWN A;  2LRI C;  3ZVY A;  2LXH C;  4IC2 A;  2ECG A;  4TKP B;  2YSJ A;  3U5O A;  1WEV A;  2EOD A;  3N9Q A;  4BBQ A;  2G43 A;  2KR4 A;  2K16 A;  3O70 A;  2YQL A;  4B86 C;  5C11 A;  5FER A;  2UZG A;  2YUC A;  4YAT A;  1G25 A;  2G6Q A;  4LK9 A;  1JOC A;  1WEP A;  3LQH A;  4GNF A;  4A0C D;  2MIQ A;  4A4B A;  4AYC A;  3N9O A;  2QJ0 A;  1ZBD B;  4ZDT A;  4CCG X;  3M99 A;  3L1Z B;  2KU3 A;  4YBS A;  1Z60 A;  2YUR A;  2MD7 B;  5EYA F;  3LRQ A;  3N9L A;  3C6W A;  4FIP A;  2YHO A;  1U6G B;  3GV4 A;  5G0F A;  2QIC A;  2YSM A;  2CSZ A;  1WIM A;  3DPL R;  2PNX A;  3M62 A;  2MA5 A;  2H0D A;  3SOX A;  4YBM A;  1HYI A;  3C5K A;  5KH7 A;  2LGV A;  2K17 A;  4W4U A;  5LKU A;  3HCU A;  2YYR A;  2HYE D;  2ECV A;  4V3K C;  1WFK A;  2ECN A;  3MHH A;  2ZET C;  2EA6 A;  4S3O B;  4XI1 A;  5LKT A;  1X4J A;  4MVT A;  5JG6 A;  2VJF A;  1WEO A;  3ZPV E;  5AIU A;  4LKA A;  2CKL B;  2IDA A;  2KGI A;  1VFY A;  4WZ0 A;  4PPE A;  1F62 A;  2MD8 C;  3O35 A;  4UP0 A;  2NAA A;  2JMD A;  3V43 A;  1CHC A;  2MA6 A;  4MSX A;  2VJE B;  1JM7 A;  3QZV A;  1WE9 A;  2FUU A;  4YAB A;  3O34 A;  5FB0 A;  2YW8 A;  3RTR B;  1WEQ A;  3NG2 A;  4LAD B;  2E6S A;  3KNV A;  4C9Z A;  4WA6 A;  4F52 B;  4ZUX U;  3PHD A;  3SOU A;  1N87 A;  5LKZ A;  2F6J A;  2M6M A;  1Z2Q A;  4LLB A;  1MM3 A;  5H1V A;  2VNF A;  2VPG A;  5C13 A;  2XB1 A;  3RPG B;  2RSD A;  2FSA A;  4I7D A;  4FJC A;  5AIT A;  2KYU A;  2LDR A;  3ASL A;  5I3L A;  4UI9 B;  4N4F A;  3ZNI A;  3VK6 A;  2K4D A;  2FUI A;  3ZVZ B;  4R2Y A;  2LN0 A;  3N9N A;  2YRE A;  5B79 A;  4LJN A;  2CT2 A;  4QF3 A;  4AYC B;  2ECI A;  5D1M B;  3L1X A;  2YHN A;  2D8S A;  2LGL A;  1LDK C;  2YQM A;  5D1K B;  1VYX A;  4R7E A;  2KE1 A;  2AN6 A;  2KGG A;  5B78 A;  2PUY A;  2RI7 A;  4YC9 A;  1K2F A;  2I50 A;  3GL6 A;  2Y43 A;  4YAX A;  4I7B A;  3LQI A;  2M85 A;  5J3X A;  4FK5 A;  3N9M A;  5B75 A;  2M3H A;  2LV9 A;  5TDR A;  1E4U A;  4GNG A;  4WZ2 A;  2L0B A;  1WEU A;  1DVP A;  1WIL A;  3HCT A;  4ZQL A;  2VJE A;  2VJF B;  1VD4 A;  1MM2 A;  3HCS A;  2KWO A;  5B77 A;  3EB6 A;  4S3O C;  2ECT A;  5KH3 A;  2L5U A;  3ZYQ A;  2F42 A;  3M63 A;  2F6N A;  4QF2 A;  3O33 A;  2EGP A;  2YU4 A;  3HTK C;  1BOR A;  5KH9 A;  5FEY A;  2ECJ A;  5TAB A;  3KV5 A;  1XWH A;  2L43 A;  4O64 A;  2VPE A;  4AP4 A;  3U5M A; 
#chains in the Genus database with same CATH topology
 2JMJ A;  5DIN A;  2CSY A;  4I7C A;  1T1H A;  4AVX A;  1WEN A;  1HYJ A;  1WGM A;  3KQI A;  1WEW A;  4NN2 A;  2L7P A;  3O36 A;  2LQ6 A;  4V3L C;  4UP5 A;  5SVI B;  3LDY A;  5H1U A;  4R8P K;  3RPG C;  2G45 A;  1X4U A;  4YBT A;  3T7L A;  3E2D A;  2FD4 A;  4YAD A;  5TRB A;  5TBN A;  2Y1M A;  2KWJ A;  3M7K A;  3FJU B;  4CA1 A;  3SOW A;  2K1J A;  2KIZ A;  3LVR E;  2RR4 A;  5LKX A;  3PUR A;  2JUN A;  4GB0 A;  3DWD A;  1V87 A;  5TDW A;  4AUQ B;  2EXU A;  4A4C A;  2C2L A;  5DKA A;  5B8D A;  4OGE A;  4X3G A;  2BAY A;  1WEM A;  2KKY A;  2XEU A;  5G04 B;  1X4I A;  2LGK A;  2OXQ C;  4B7Y C;  3EB5 A;  2MNZ A;  1FP0 A;  2MUM A;  3N9P A;  3O47 A;  2Y1N A;  3O37 A;  3L11 A;  3MHS A;  4Q6F A;  3FAO A;  2LGG A;  3IHP A;  2H0D B;  4WZ3 B;  5G05 B;  2E6R A;  3ZPV 1;  1WES A;  2DX8 A;  2JMI A;  4FO9 A;  2JRJ A;  2VPD A;  2YT5 A;  5LCW B;  2CKL A;  2L75 A;  3KV6 A;  4L58 A;  2VPB A;  3FL2 A;  2KFT A;  5B76 A;  4BHW A;  2JM3 A;  4IC3 A;  3U5P A;  2KRE A;  1WEE A;  2XOY A;  3I2D A;  3ZTG A;  4Z0R A;  4PTB A;  2L80 A;  5H1T A;  5FB1 A;  2D8U A;  2KWK A;  4GNE A;  3SHB A;  4GND A;  3LVQ E;  4L7X A;  1Z6U A;  2M1R A;  5D1L B;  1FBV A;  2ECW A;  5H9M A;  2YVR A;  3U5N A;  3PUQ A;  1IYM A;  1JM7 B;  2MT5 A;  4N3W A;  3LQJ A;  4P5O B;  2MNY A;  2VP7 A;  2LXP C;  2QIZ A;  1LDJ B;  2XP0 A;  3DQV R;  2HDP A;  3T6R A;  2C2V S;  4A49 A;  3O7A A;  1RMD A;  2KWN A;  2LRI C;  3ZVY A;  2LXH C;  4IC2 A;  2ECG A;  4TKP B;  2YSJ A;  3U5O A;  1WEV A;  2EOD A;  3N9Q A;  4O62 A;  4BBQ A;  2G43 A;  2KR4 A;  2K16 A;  3O70 A;  2YQL A;  5K3Q A;  4B86 C;  5C11 A;  5FER A;  2UZG A;  2YUC A;  4YAT A;  1G25 A;  2G6Q A;  4LK9 A;  1JOC A;  1WEP A;  1MBM A;  3LQH A;  4GNF A;  4A0C D;  2MIQ A;  4A4B A;  4AYC A;  3N9O A;  3SUB A;  2QJ0 A;  1ZBD B;  2CRR A;  4ZDT A;  4CCG X;  3M99 A;  3L1Z B;  2KU3 A;  2M13 A;  4YBS A;  1Z60 A;  2YUR A;  2MD7 B;  5EYA F;  3LRQ A;  4QQ4 A;  3N9L A;  3C6W A;  4FIP A;  2YHO A;  1U6G B;  4F1P A;  3GV4 A;  5G0F A;  2E61 A;  2QIC A;  5SVY A;  2YSM A;  2CSZ A;  1WIM A;  3DPL R;  2PNX A;  3M62 A;  2MA5 A;  2H0D A;  3SOX A;  3JUE A;  4YBM A;  3FEH A;  1HYI A;  3C5K A;  5KH7 A;  2LGV A;  2K17 A;  4W4U A;  3MDB C;  3PLW A;  5LKU A;  3HCU A;  2YYR A;  2CSV A;  2HYE D;  2ECV A;  4V3K C;  1WFK A;  2ECN A;  3MHH A;  2ZET C;  2EA6 A;  3FM8 C;  4S3O B;  4XI1 A;  5LKT A;  1X4J A;  4MVT A;  5JG6 A;  2VJF A;  1WEO A;  3ZPV E;  5AIU A;  4LKA A;  2CKL B;  2IDA A;  2KGI A;  1VFY A;  4WZ0 A;  4PPE A;  1F62 A;  4H9D A;  2MD8 C;  3O35 A;  4UP0 A;  2NAA A;  2JMD A;  3V43 A;  1CHC A;  2MA6 A;  4MSX A;  2VJE B;  1JM7 A;  3QZV A;  1WE9 A;  2FUU A;  4YAB A;  3O34 A;  5FB0 A;  2YW8 A;  3RTR B;  1WEQ A;  3NG2 A;  3H7H A;  4LAD B;  2E6S A;  3KNV A;  4C9Z A;  4WA6 A;  4F52 B;  4ZUX U;  3PHD A;  3SOU A;  1N87 A;  2CON A;  5LKZ A;  2KKX A;  2F6J A;  4Z0O A;  2M6M A;  1Z2Q A;  4LLB A;  1MM3 A;  5H1V A;  2VNF A;  2VPG A;  5C13 A;  2XB1 A;  3RPG B;  2RSD A;  2FSA A;  5SVI A;  4I7D A;  4FJC A;  5AIT A;  2KYU A;  2LDR A;  3ASL A;  5I3L A;  4UI9 B;  4N4F A;  3ZNI A;  3VK6 A;  2DJA A;  2K4D A;  2FUI A;  3ZVZ B;  3DDT A;  4R2Y A;  2LN0 A;  2EGM A;  2FFW A;  3N9N A;  2DSM A;  2YRE A;  2B0O E;  5B79 A;  3KDE C;  4LJN A;  2CT2 A;  4QF3 A;  4AYC B;  2ECI A;  3Q1D A;  5D1M B;  3L1X A;  2XOZ A;  2YHN A;  2D8S A;  2LGL A;  1LDK C;  2XOC A;  2YQM A;  2OWA A;  5D1K B;  1VYX A;  4R7E A;  2KE1 A;  2AN6 A;  2KGG A;  5B78 A;  2PUY A;  2CRW A;  2RI7 A;  4YC9 A;  1K2F A;  2I50 A;  3GL6 A;  2Y43 A;  4YAX A;  4I7B A;  3LQI A;  2M85 A;  5J3X A;  4FK5 A;  2MKE A;  3N9M A;  5B75 A;  2M3H A;  2LV9 A;  5TDR A;  4OGC A;  1E4U A;  4GNG A;  4WZ2 A;  2L0B A;  1WEU A;  1DVP A;  1WIL A;  3HCT A;  4ZQL A;  2VJE A;  2VJF B;  1VD4 A;  1MM2 A;  3HCS A;  5SVX A;  2KWO A;  5B77 A;  3EB6 A;  4S3O C;  2ECT A;  5KH3 A;  2L5U A;  3ZYQ A;  3LJU X;  2F42 A;  3M63 A;  2LAU A;  2F6N A;  4QF2 A;  3T9K A;  3O33 A;  2EGP A;  2YU4 A;  3HTK C;  1DCQ A;  1BOR A;  5KH9 A;  5FEY A;  2ECJ A;  3FAN A;  5TAB A;  3KV5 A;  2IQJ A;  1XWH A;  2L43 A;  4O64 A;  2P57 A;  2VPE A;  4AP4 A;  3U5M A; 
#chains in the Genus database with same CATH homology
 2JMJ A;  5DIN A;  2CSY A;  4I7C A;  1T1H A;  4AVX A;  1WEN A;  1HYJ A;  1WGM A;  3KQI A;  1WEW A;  4NN2 A;  3O36 A;  2LQ6 A;  4V3L C;  4UP5 A;  5H1U A;  4R8P K;  3RPG C;  2G45 A;  1X4U A;  4YBT A;  3T7L A;  4YAD A;  5TBN A;  5TRB A;  2Y1M A;  2KWJ A;  4CA1 A;  3SOW A;  2K1J A;  2KIZ A;  5LKX A;  3PUR A;  4GB0 A;  1V87 A;  5TDW A;  4AUQ B;  4A4C A;  2C2L A;  5DKA A;  5B8D A;  4X3G A;  2BAY A;  1WEM A;  2XEU A;  5G04 B;  1X4I A;  2LGK A;  2OXQ C;  4B7Y C;  3EB5 A;  2MNZ A;  1FP0 A;  2MUM A;  3N9P A;  2Y1N A;  3O37 A;  3L11 A;  3MHS A;  4Q6F A;  2LGG A;  3IHP A;  2H0D B;  4WZ3 B;  5G05 B;  2E6R A;  3ZPV 1;  1WES A;  2DX8 A;  2JMI A;  4FO9 A;  2JRJ A;  2VPD A;  2YT5 A;  5LCW B;  2CKL A;  2L75 A;  3KV6 A;  4L58 A;  2VPB A;  3FL2 A;  2KFT A;  5B76 A;  4BHW A;  4IC3 A;  3U5P A;  2KRE A;  1WEE A;  3I2D A;  3ZTG A;  4PTB A;  2L80 A;  5H1T A;  5FB1 A;  3SHB A;  2KWK A;  4GNE A;  4GND A;  4L7X A;  1Z6U A;  2M1R A;  5D1L B;  1FBV A;  2ECW A;  5H9M A;  3U5N A;  3PUQ A;  1IYM A;  1JM7 B;  2MT5 A;  4N3W A;  3LQJ A;  4P5O B;  2MNY A;  2VP7 A;  2LXP C;  2QIZ A;  1LDJ B;  3DQV R;  2HDP A;  3T6R A;  2C2V S;  4A49 A;  3O7A A;  1RMD A;  2KWN A;  2LRI C;  3ZVY A;  2LXH C;  4IC2 A;  2ECG A;  4TKP B;  2YSJ A;  3U5O A;  1WEV A;  2EOD A;  3N9Q A;  4BBQ A;  2G43 A;  2KR4 A;  2K16 A;  3O70 A;  2YQL A;  4B86 C;  5C11 A;  5FER A;  2UZG A;  2YUC A;  4YAT A;  1G25 A;  2G6Q A;  4LK9 A;  1JOC A;  1WEP A;  3LQH A;  4GNF A;  4A0C D;  2MIQ A;  4A4B A;  4AYC A;  3N9O A;  2QJ0 A;  1ZBD B;  4ZDT A;  4CCG X;  3M99 A;  3L1Z B;  2KU3 A;  4YBS A;  1Z60 A;  2YUR A;  2MD7 B;  5EYA F;  3LRQ A;  3N9L A;  3C6W A;  4FIP A;  2YHO A;  1U6G B;  3GV4 A;  5G0F A;  2QIC A;  2YSM A;  2CSZ A;  1WIM A;  3DPL R;  2PNX A;  3M62 A;  2MA5 A;  2H0D A;  3SOX A;  4YBM A;  1HYI A;  3C5K A;  5KH7 A;  2LGV A;  2K17 A;  4W4U A;  5LKU A;  3HCU A;  2YYR A;  2HYE D;  2ECV A;  4V3K C;  1WFK A;  2ECN A;  3MHH A;  2ZET C;  2EA6 A;  4S3O B;  4XI1 A;  5LKT A;  1X4J A;  4MVT A;  5JG6 A;  2VJF A;  1WEO A;  3ZPV E;  5AIU A;  4LKA A;  2CKL B;  2IDA A;  2KGI A;  1VFY A;  4WZ0 A;  4PPE A;  1F62 A;  2MD8 C;  3O35 A;  4UP0 A;  2NAA A;  2JMD A;  3V43 A;  1CHC A;  2MA6 A;  4MSX A;  2VJE B;  1JM7 A;  3QZV A;  1WE9 A;  2FUU A;  4YAB A;  3O34 A;  5FB0 A;  2YW8 A;  3RTR B;  1WEQ A;  3NG2 A;  4LAD B;  2E6S A;  3KNV A;  4C9Z A;  4WA6 A;  4F52 B;  4ZUX U;  3PHD A;  3SOU A;  1N87 A;  5LKZ A;  2F6J A;  2M6M A;  1Z2Q A;  4LLB A;  1MM3 A;  5H1V A;  2VNF A;  2VPG A;  5C13 A;  2XB1 A;  3RPG B;  2RSD A;  2FSA A;  4I7D A;  4FJC A;  5AIT A;  2KYU A;  2LDR A;  3ASL A;  5I3L A;  4UI9 B;  4N4F A;  3ZNI A;  3VK6 A;  2K4D A;  2FUI A;  3ZVZ B;  4R2Y A;  2LN0 A;  3N9N A;  2YRE A;  5B79 A;  4LJN A;  2CT2 A;  4QF3 A;  4AYC B;  2ECI A;  5D1M B;  3L1X A;  2YHN A;  2D8S A;  2LGL A;  1LDK C;  2YQM A;  5D1K B;  1VYX A;  4R7E A;  2KE1 A;  2AN6 A;  2KGG A;  5B78 A;  2PUY A;  2RI7 A;  4YC9 A;  1K2F A;  2I50 A;  3GL6 A;  2Y43 A;  4YAX A;  4I7B A;  3LQI A;  2M85 A;  5J3X A;  4FK5 A;  3N9M A;  5B75 A;  2M3H A;  2LV9 A;  5TDR A;  1E4U A;  4GNG A;  4WZ2 A;  2L0B A;  1WEU A;  1DVP A;  1WIL A;  3HCT A;  4ZQL A;  2VJE A;  2VJF B;  1VD4 A;  1MM2 A;  3HCS A;  2KWO A;  5B77 A;  3EB6 A;  4S3O C;  2ECT A;  5KH3 A;  2L5U A;  3ZYQ A;  2F42 A;  3M63 A;  2F6N A;  4QF2 A;  3O33 A;  2EGP A;  2YU4 A;  3HTK C;  1BOR A;  5KH9 A;  5FEY A;  2ECJ A;  5TAB A;  3KV5 A;  1XWH A;  2L43 A;  4O64 A;  2VPE A;  4AP4 A;  3U5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...