3ZVZB

Phd finger of human uhrf1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
b'GHMRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE UHRF1
publication title The Phd Finger of Human Uhrf1 Reveals a New Subgroup of Unmethylated Histone H3 Tail Readers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 55
sequence length 55
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zvzB00
4R2YA 1WEUA 4W4UA 3O34A 4MVTA 2JMIA 2E6RA 4GB0A 2ECTA 1DVPA 3LQIA 3HTKC 2L43A 2D8SA 2MIQA 1XWHA 3O35A 1FBVA 3L1ZB 4WA6A 3N9OA 3C6WA 2MUMA 2ECNA 1WGMA 2VPBA 1LDKC 4I7CA 3RPGC 2JRJA 3DPLR 2KREA 2IDAA 4TKPB 3GL6A 4V3KC 2YHNA 3PHDA 2MT5A 5LKXA 2VP7A 5H1UA 2UZGA 2C2VS 2K4DA 4N4FA 2F6JA 4R8PK 2YHOA 1JM7B 5B79A 5B8DA 3QZVA 4IC2A 4UI9B 3U5OA 4B7YC 4I7DA 2LGGA 3MHSA 3O7AA 2LN0A 2QICA 4FK5A 4O64A 4R7EA 1JM7A 4WZ0A 2CKLA 3N9QA 1WEVA 2KWOA 1RMDA 2LQ6A 3HCTA 5H9MA 2DX8A 1WEPA 4A4BA 1BORA 2M3HA 1K2FA 2K1JA 3EB6A 2ECGA 1JOCA 4ZDTA 2FUIA 3ZNIA 2EGPA 2QIZA 5DINA 2ECVA 2MA5A 5B75A 5KH9A 3N9NA 1T1HA 2L0BA 2LXPC 2KU3A 3KV6A 1WEWA 1HYIA 4AYCB 5AITA 1WEMA 2LXHC 2Y1MA 3SOWA 2LGVA 2KFTA 4CCGX 4Q6FA 2KIZA 2KWJA 2YYRA 2VNFA 2EODA 3N9PA 2K17A 5KH3A 4LJNA 4AYCA 2YSMA 4F52B 4UP5A 1HYJA 2RI7A 3SOXA 2YSJA 4AVXA 4UP0A 5TBNA 1MM3A 5FERA 2PNXA 5D1LB 2LDRA 4CA1A 2VJFB 5D1KB 4C9ZA 2KWKA 4MSXA 3T7LA 3EB5A 5EYAF 4WZ3B 4LLBA 3N9MA 4NN2A 2BAYA 2ECIA 2VJFA 2YUCA 5JG6A 1WFKA 1ZBDB 2KR4A 5FB0A 3U5NA 2NAAA 2FSAA 2CSYA 2G43A 5B77A 4A0CD 2VPEA 4LKAA 2G6QA 1G25A 2C2LA 1X4IA 5LCWB 2KGGA 4A49A 3VK6A 4AUQB 3PUQA 2ECJA 2VPGA 2XB1A 5J3XA 2QJ0A 2F6NA 2L5UA 2YQLA 2ECWA 3HCUA 1V87A 3ZTGA 2I50A 4PTBA 2YU4A 2E6SA 3M62A 3SHBA 5I3LA 3PURA 4QF3A 2OXQC 3M99A 5FB1A 1WENA 4BHWA 1WIMA 2MD7B 3HCSA 5D1MB 4WZ2A 4LADB 3O37A 1LDJB 2YURA 5DKAA 4XI1A 3KQIA 4FO9A 3T6RA 4QF2A 2VJEB 4YATA 2EA6A 2VPDA 4ZUXU 3KV5A 2LRIC 2RSDA 4LK9A 1WESA 3L11A 4GNEA 3DQVR 3LRQA 1X4UA 4L7XA 4S3OB 5TDRA 1WEEA 5B76A 1WEQA 2PUYA 3U5MA 1WILA 2MNZA 3SOUA 1FP0A 2XEUA 2LV9A 2JMDA 5TDWA 3U5PA 2L75A 4B86C 2YREA 2LGLA 3IHPA 3FL2A 3O70A 3ZPV1 5TABA 3MHHA 3O36A 1E4UA 1VFYA 5C13A 5H1VA 2M6MA 4GNGA 3M63A 4YAXA 4X3GA 3L1XA 4V3LC 3LQJA 5AIUA 4GNDA 2FUUA 4FIPA 1VD4A 2CSZA 4P5OB 5FEYA 2YT5A 3NG2A 4PPEA 2HYED 3RTRB 2KWNA 2Y1NA 2KYUA 2KE1A 4AP4A 5G05B 2F42A 1N87A 2L80A 3KNVA 3GV4A 5LKZA 5TRBA 4YBSA 2Y43A 4IC3A 3ZVYA 4S3OC 2MA6A 2G45A 2CKLB 4A4CA 4YBTA 2JMJA 2MNYA 1IYMA 1U6GB 4YADA 2CT2A 2KGIA 3V43A 2H0DB 4YABA 4FJCA 3RPGB 4YC9A 5H1TA 1Z60A 3ZYQA 4N3WA 2MD8C 2AN6A 1Z2QA 4GNFA 2HDPA 2YW8A 4L58A 2H0DA 1MM2A 5G04B 3ASLA 1WE9A 1X4JA 2YQMA 1CHCA 3O33A 3LQHA 3I2DA 1WEOA 2LGKA 5G0FA 2VJEA 4YBMA 5LKUA 2M85A 3ZPVE 3N9LA 4BBQA 1F62A 1VYXA 2ZETC 1Z6UA 4ZQLA 2K16A 5LKTA 4I7BA 3C5KA 5KH7A 2M1RA 5C11A 3ZVZB 5B78A
chains in the Genus database with same CATH superfamily
2EXUA 4R2YA 1WEUA 4W4UA 3O34A 4MVTA 2JMIA 2E6RA 4GB0A 2ECTA 1DVPA 3LQIA 3HTKC 3H7HA 2L43A 2D8SA 2MIQA 1XWHA 3O35A 1FBVA 3L1ZB 4WA6A 3N9OA 3C6WA 2MUMA 2ECNA 1WGMA 2VPBA 1LDKC 4I7CA 3RPGC 2JRJA 3DPLR 4Z0OA 2KREA 2IDAA 4TKPB 3GL6A 4V3KC 2YHNA 2XP0A 3PHDA 2MT5A 5LKXA 2VP7A 5H1UA 2UZGA 2C2VS 2CRRA 2K4DA 4N4FA 2F6JA 1DCQA 3LVQE 4R8PK 2YHOA 1JM7B 5B79A 5B8DA 3QZVA 4IC2A 4UI9B 3U5OA 4B7YC 4I7DA 2LGGA 3O7AA 3MHSA 2LN0A 2QICA 4FK5A 4O64A 4R7EA 1JM7A 2KKYA 4WZ0A 2CKLA 3N9QA 1WEVA 2XOYA 3DWDA 2KWOA 1RMDA 2LQ6A 3HCTA 3FANA 5H9MA 2DX8A 1WEPA 4A4BA 1BORA 2M3HA 3JUEA 1K2FA 2K1JA 3EB6A 2ECGA 1JOCA 4ZDTA 2FUIA 3M7KA 3ZNIA 2EGPA 2QIZA 5DINA 2ECVA 2MA5A 5B75A 5KH9A 3N9NA 1T1HA 2L0BA 2LXPC 2KU3A 2FFWA 3KV6A 4O62A 1WEWA 1HYIA 4AYCB 5AITA 1WEMA 2LXHC 2Y1MA 3SOWA 2LGVA 2KFTA 4CCGX 4Q6FA 2KIZA 2KWJA 2YYRA 2VNFA 2EODA 3N9PA 2K17A 5KH3A 4LJNA 4AYCA 3O47A 2MKEA 2YSMA 4F52B 4UP5A 3Q1DA 1HYJA 2RI7A 3SOXA 2YSJA 4AVXA 4UP0A 5TBNA 1MM3A 5FERA 2PNXA 3KDEC 5SVIB 5D1LB 2LDRA 4CA1A 2VJFB 5D1KB 4C9ZA 3PLWA 2KWKA 4MSXA 3T7LA 3EB5A 5EYAF 4WZ3B 4LLBA 2DJAA 3N9MA 4NN2A 2BAYA 2ECIA 2VJFA 2YUCA 5JG6A 1WFKA 1ZBDB 2KR4A 5FB0A 3U5NA 2NAAA 2FSAA 3DDTA 2CSYA 2G43A 5B77A 4A0CD 2VPEA 4LKAA 2G6QA 1G25A 2C2LA 1X4IA 5LCWB 2KGGA 4A49A 3VK6A 4AUQB 3PUQA 2ECJA 2VPGA 2XB1A 5J3XA 2QJ0A 2F6NA 2L5UA 2YQLA 2ECWA 3HCUA 2OWAA 1V87A 3ZTGA 2I50A 4PTBA 2YU4A 2E6SA 3M62A 3SHBA 2XOCA 5I3LA 3PURA 2JUNA 4QF3A 2OXQC 3M99A 5FB1A 1WENA 2B0OE 2EGMA 4BHWA 2IQJA 1WIMA 4H9DA 2MD7B 3HCSA 5D1MB 4WZ2A 3FM8C 4LADB 3O37A 1LDJB 2YURA 2D8UA 5DKAA 4XI1A 3KQIA 4FO9A 3T6RA 4QF2A 2VJEB 4YATA 2EA6A 2VPDA 4ZUXU 3KV5A 2LRIC 2RSDA 4LK9A 1WESA 2L7PA 3L11A 3DQVR 4GNEA 3LRQA 1X4UA 4L7XA 4S3OB 5TDRA 1WEEA 5B76A 1WEQA 2PUYA 3U5MA 1WILA 2MNZA 3SOUA 1MBMA 1FP0A 2XEUA 2LV9A 2JMDA 5TDWA 3U5PA 2L75A 4B86C 2YREA 2LGLA 3IHPA 3FL2A 3O70A 3ZPV1 5TABA 3MHHA 3O36A 2YVRA 1E4UA 1VFYA 5C13A 5H1VA 2M6MA 4GNGA 3M63A 4YAXA 3LDYA 2LAUA 4X3GA 3FJUB 2CSVA 3L1XA 4V3LC 3LQJA 5AIUA 4GNDA 2FUUA 5SVIA 4FIPA 1VD4A 2CONA 2CSZA 4P5OB 5FEYA 2YT5A 3NG2A 4PPEA 4F1PA 2HYED 3RTRB 2KWNA 2Y1NA 2KYUA 3E2DA 2KE1A 4AP4A 3MDBC 3LVRE 2FD4A 4OGCA 5G05B 2F42A 1N87A 2L80A 2E61A 3KNVA 3GV4A 5SVXA 5LKZA 5TRBA 4YBSA 2Y43A 4IC3A 4OGEA 3ZVYA 2XOZA 4S3OC 2MA6A 2M13A 5K3QA 3LJUX 2KKXA 4Z0RA 2G45A 2CKLB 4A4CA 4YBTA 2JMJA 2MNYA 1IYMA 1U6GB 4YADA 2CT2A 2KGIA 3V43A 2H0DB 4YABA 4FJCA 3RPGB 4YC9A 5H1TA 1Z60A 3ZYQA 4N3WA 2MD8C 2AN6A 1Z2QA 4GNFA 2CRWA 2HDPA 2YW8A 4L58A 2H0DA 1MM2A 5G04B 3ASLA 3SUBA 1WE9A 2JM3A 1X4JA 2YQMA 1CHCA 3O33A 3LQHA 3I2DA 1WEOA 2LGKA 5G0FA 2P57A 2VJEA 3FEHA 4YBMA 5LKUA 2M85A 3ZPVE 5SVYA 3N9LA 4BBQA 1F62A 1VYXA 4QQ4A 2ZETC 2RR4A 1Z6UA 4ZQLA 2K16A 3FAOA 5LKTA 4I7BA 3C5KA 2DSMA 5KH7A 2M1RA 3T9KA 5C11A 3ZVZB 5B78A
chains in the Genus database with same CATH topology
4R2YA 1WEUA 4W4UA 3O34A 4MVTA 2JMIA 2E6RA 4GB0A 2ECTA 1DVPA 3LQIA 3HTKC 2L43A 2D8SA 2MIQA 1XWHA 3O35A 1FBVA 3L1ZB 4WA6A 3N9OA 3C6WA 2MUMA 2ECNA 1WGMA 2VPBA 1LDKC 4I7CA 3RPGC 2JRJA 3DPLR 2KREA 2IDAA 4TKPB 3GL6A 4V3KC 2YHNA 3PHDA 2MT5A 5LKXA 2VP7A 5H1UA 2UZGA 2C2VS 2K4DA 4N4FA 2F6JA 4R8PK 2YHOA 1JM7B 5B79A 5B8DA 3QZVA 4IC2A 4UI9B 3U5OA 4B7YC 4I7DA 2LGGA 3MHSA 3O7AA 2LN0A 2QICA 4FK5A 4O64A 4R7EA 1JM7A 4WZ0A 2CKLA 3N9QA 1WEVA 2KWOA 1RMDA 2LQ6A 3HCTA 5H9MA 2DX8A 1WEPA 4A4BA 1BORA 2M3HA 1K2FA 2K1JA 3EB6A 2ECGA 1JOCA 4ZDTA 2FUIA 3ZNIA 2EGPA 2QIZA 5DINA 2ECVA 2MA5A 5B75A 5KH9A 3N9NA 1T1HA 2L0BA 2LXPC 2KU3A 3KV6A 1WEWA 1HYIA 4AYCB 5AITA 1WEMA 2LXHC 2Y1MA 3SOWA 2LGVA 2KFTA 4CCGX 4Q6FA 2KIZA 2KWJA 2YYRA 2VNFA 2EODA 3N9PA 2K17A 5KH3A 4LJNA 4AYCA 2YSMA 4F52B 4UP5A 1HYJA 2RI7A 3SOXA 2YSJA 4AVXA 4UP0A 5TBNA 1MM3A 5FERA 2PNXA 5D1LB 2LDRA 4CA1A 2VJFB 5D1KB 4C9ZA 2KWKA 4MSXA 3T7LA 3EB5A 5EYAF 4WZ3B 4LLBA 3N9MA 4NN2A 2BAYA 2ECIA 2VJFA 2YUCA 5JG6A 1WFKA 1ZBDB 2KR4A 5FB0A 3U5NA 2NAAA 2FSAA 2CSYA 2G43A 5B77A 4A0CD 2VPEA 4LKAA 2G6QA 1G25A 2C2LA 1X4IA 5LCWB 2KGGA 4A49A 3VK6A 4AUQB 3PUQA 2ECJA 2VPGA 2XB1A 5J3XA 2QJ0A 2F6NA 2L5UA 2YQLA 2ECWA 3HCUA 1V87A 3ZTGA 2I50A 4PTBA 2YU4A 2E6SA 3M62A 3SHBA 5I3LA 3PURA 4QF3A 2OXQC 3M99A 5FB1A 1WENA 4BHWA 1WIMA 2MD7B 3HCSA 5D1MB 4WZ2A 4LADB 3O37A 1LDJB 2YURA 5DKAA 4XI1A 3KQIA 4FO9A 3T6RA 4QF2A 2VJEB 4YATA 2EA6A 2VPDA 4ZUXU 3KV5A 2LRIC 2RSDA 4LK9A 1WESA 3L11A 4GNEA 3DQVR 3LRQA 1X4UA 4L7XA 4S3OB 5TDRA 1WEEA 5B76A 1WEQA 2PUYA 3U5MA 1WILA 2MNZA 3SOUA 1FP0A 2XEUA 2LV9A 2JMDA 5TDWA 3U5PA 2L75A 4B86C 2YREA 2LGLA 3IHPA 3FL2A 3O70A 3ZPV1 5TABA 3MHHA 3O36A 1E4UA 1VFYA 5C13A 5H1VA 2M6MA 4GNGA 3M63A 4YAXA 4X3GA 3L1XA 4V3LC 3LQJA 5AIUA 4GNDA 2FUUA 4FIPA 1VD4A 2CSZA 4P5OB 5FEYA 2YT5A 3NG2A 4PPEA 2HYED 3RTRB 2KWNA 2Y1NA 2KYUA 2KE1A 4AP4A 5G05B 2F42A 1N87A 2L80A 3KNVA 3GV4A 5LKZA 5TRBA 4YBSA 2Y43A 4IC3A 3ZVYA 4S3OC 2MA6A 2G45A 2CKLB 4A4CA 4YBTA 2JMJA 2MNYA 1IYMA 1U6GB 4YADA 2CT2A 2KGIA 3V43A 2H0DB 4YABA 4FJCA 3RPGB 4YC9A 5H1TA 1Z60A 3ZYQA 4N3WA 2MD8C 2AN6A 1Z2QA 4GNFA 2HDPA 2YW8A 4L58A 2H0DA 1MM2A 5G04B 3ASLA 1WE9A 1X4JA 2YQMA 1CHCA 3O33A 3LQHA 3I2DA 1WEOA 2LGKA 5G0FA 2VJEA 4YBMA 5LKUA 2M85A 3ZPVE 3N9LA 4BBQA 1F62A 1VYXA 2ZETC 1Z6UA 4ZQLA 2K16A 5LKTA 4I7BA 3C5KA 5KH7A 2M1RA 5C11A 3ZVZB 5B78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R2Y A;  1WEU A;  4W4U A;  3O34 A;  4MVT A;  2JMI A;  2E6R A;  4GB0 A;  2ECT A;  1DVP A;  3LQI A;  3HTK C;  2L43 A;  2D8S A;  2MIQ A;  1XWH A;  3O35 A;  1FBV A;  3L1Z B;  4WA6 A;  3N9O A;  3C6W A;  2MUM A;  2ECN A;  1WGM A;  2VPB A;  1LDK C;  4I7C A;  3RPG C;  2JRJ A;  3DPL R;  2KRE A;  2IDA A;  4TKP B;  3GL6 A;  4V3K C;  2YHN A;  3PHD A;  2MT5 A;  5LKX A;  2VP7 A;  5H1U A;  2UZG A;  2C2V S;  2K4D A;  4N4F A;  2F6J A;  4R8P K;  2YHO A;  1JM7 B;  5B79 A;  5B8D A;  3QZV A;  4IC2 A;  4UI9 B;  3U5O A;  4B7Y C;  4I7D A;  2LGG A;  3MHS A;  3O7A A;  2LN0 A;  2QIC A;  4FK5 A;  4O64 A;  4R7E A;  1JM7 A;  4WZ0 A;  2CKL A;  3N9Q A;  1WEV A;  2KWO A;  1RMD A;  2LQ6 A;  3HCT A;  5H9M A;  2DX8 A;  1WEP A;  4A4B A;  1BOR A;  2M3H A;  1K2F A;  2K1J A;  3EB6 A;  2ECG A;  1JOC A;  4ZDT A;  2FUI A;  3ZNI A;  2EGP A;  2QIZ A;  5DIN A;  2ECV A;  2MA5 A;  5B75 A;  5KH9 A;  3N9N A;  1T1H A;  2L0B A;  2LXP C;  2KU3 A;  3KV6 A;  1WEW A;  1HYI A;  4AYC B;  5AIT A;  1WEM A;  2LXH C;  2Y1M A;  3SOW A;  2LGV A;  2KFT A;  4CCG X;  4Q6F A;  2KIZ A;  2KWJ A;  2YYR A;  2VNF A;  2EOD A;  3N9P A;  2K17 A;  5KH3 A;  4LJN A;  4AYC A;  2YSM A;  4F52 B;  4UP5 A;  1HYJ A;  2RI7 A;  3SOX A;  2YSJ A;  4AVX A;  4UP0 A;  5TBN A;  1MM3 A;  5FER A;  2PNX A;  5D1L B;  2LDR A;  4CA1 A;  2VJF B;  5D1K B;  4C9Z A;  2KWK A;  4MSX A;  3T7L A;  3EB5 A;  5EYA F;  4WZ3 B;  4LLB A;  3N9M A;  4NN2 A;  2BAY A;  2ECI A;  2VJF A;  2YUC A;  5JG6 A;  1WFK A;  1ZBD B;  2KR4 A;  5FB0 A;  3U5N A;  2NAA A;  2FSA A;  2CSY A;  2G43 A;  5B77 A;  4A0C D;  2VPE A;  4LKA A;  2G6Q A;  1G25 A;  2C2L A;  1X4I A;  5LCW B;  2KGG A;  4A49 A;  3VK6 A;  4AUQ B;  3PUQ A;  2ECJ A;  2VPG A;  2XB1 A;  5J3X A;  2QJ0 A;  2F6N A;  2L5U A;  2YQL A;  2ECW A;  3HCU A;  1V87 A;  3ZTG A;  2I50 A;  4PTB A;  2YU4 A;  2E6S A;  3M62 A;  3SHB A;  5I3L A;  3PUR A;  4QF3 A;  2OXQ C;  3M99 A;  5FB1 A;  1WEN A;  4BHW A;  1WIM A;  2MD7 B;  3HCS A;  5D1M B;  4WZ2 A;  4LAD B;  3O37 A;  1LDJ B;  2YUR A;  5DKA A;  4XI1 A;  3KQI A;  4FO9 A;  3T6R A;  4QF2 A;  2VJE B;  4YAT A;  2EA6 A;  2VPD A;  4ZUX U;  3KV5 A;  2LRI C;  2RSD A;  4LK9 A;  1WES A;  3L11 A;  4GNE A;  3DQV R;  3LRQ A;  1X4U A;  4L7X A;  4S3O B;  5TDR A;  1WEE A;  5B76 A;  1WEQ A;  2PUY A;  3U5M A;  1WIL A;  2MNZ A;  3SOU A;  1FP0 A;  2XEU A;  2LV9 A;  2JMD A;  5TDW A;  3U5P A;  2L75 A;  4B86 C;  2YRE A;  2LGL A;  3IHP A;  3FL2 A;  3O70 A;  3ZPV 1;  5TAB A;  3MHH A;  3O36 A;  1E4U A;  1VFY A;  5C13 A;  5H1V A;  2M6M A;  4GNG A;  3M63 A;  4YAX A;  4X3G A;  3L1X A;  4V3L C;  3LQJ A;  5AIU A;  4GND A;  2FUU A;  4FIP A;  1VD4 A;  2CSZ A;  4P5O B;  5FEY A;  2YT5 A;  3NG2 A;  4PPE A;  2HYE D;  3RTR B;  2KWN A;  2Y1N A;  2KYU A;  2KE1 A;  4AP4 A;  5G05 B;  2F42 A;  1N87 A;  2L80 A;  3KNV A;  3GV4 A;  5LKZ A;  5TRB A;  4YBS A;  2Y43 A;  4IC3 A;  3ZVY A;  4S3O C;  2MA6 A;  2G45 A;  2CKL B;  4A4C A;  4YBT A;  2JMJ A;  2MNY A;  1IYM A;  1U6G B;  4YAD A;  2CT2 A;  2KGI A;  3V43 A;  2H0D B;  4YAB A;  4FJC A;  3RPG B;  4YC9 A;  5H1T A;  1Z60 A;  3ZYQ A;  4N3W A;  2MD8 C;  2AN6 A;  1Z2Q A;  4GNF A;  2HDP A;  2YW8 A;  4L58 A;  2H0D A;  1MM2 A;  5G04 B;  3ASL A;  1WE9 A;  1X4J A;  2YQM A;  1CHC A;  3O33 A;  3LQH A;  3I2D A;  1WEO A;  2LGK A;  5G0F A;  2VJE A;  4YBM A;  5LKU A;  2M85 A;  3ZPV E;  3N9L A;  4BBQ A;  1F62 A;  1VYX A;  2ZET C;  1Z6U A;  4ZQL A;  2K16 A;  5LKT A;  4I7B A;  3C5K A;  5KH7 A;  2M1R A;  5C11 A;  3ZVZ B;  5B78 A; 
#chains in the Genus database with same CATH topology
 2EXU A;  4R2Y A;  1WEU A;  4W4U A;  3O34 A;  4MVT A;  2JMI A;  2E6R A;  4GB0 A;  2ECT A;  1DVP A;  3LQI A;  3HTK C;  3H7H A;  2L43 A;  2D8S A;  2MIQ A;  1XWH A;  3O35 A;  1FBV A;  3L1Z B;  4WA6 A;  3N9O A;  3C6W A;  2MUM A;  2ECN A;  1WGM A;  2VPB A;  1LDK C;  4I7C A;  3RPG C;  2JRJ A;  3DPL R;  4Z0O A;  2KRE A;  2IDA A;  4TKP B;  3GL6 A;  4V3K C;  2YHN A;  2XP0 A;  3PHD A;  2MT5 A;  5LKX A;  2VP7 A;  5H1U A;  2UZG A;  2C2V S;  2CRR A;  2K4D A;  4N4F A;  2F6J A;  1DCQ A;  3LVQ E;  4R8P K;  2YHO A;  1JM7 B;  5B79 A;  5B8D A;  3QZV A;  4IC2 A;  4UI9 B;  3U5O A;  4B7Y C;  4I7D A;  2LGG A;  3O7A A;  3MHS A;  2LN0 A;  2QIC A;  4FK5 A;  4O64 A;  4R7E A;  1JM7 A;  2KKY A;  4WZ0 A;  2CKL A;  3N9Q A;  1WEV A;  2XOY A;  3DWD A;  2KWO A;  1RMD A;  2LQ6 A;  3HCT A;  3FAN A;  5H9M A;  2DX8 A;  1WEP A;  4A4B A;  1BOR A;  2M3H A;  3JUE A;  1K2F A;  2K1J A;  3EB6 A;  2ECG A;  1JOC A;  4ZDT A;  2FUI A;  3M7K A;  3ZNI A;  2EGP A;  2QIZ A;  5DIN A;  2ECV A;  2MA5 A;  5B75 A;  5KH9 A;  3N9N A;  1T1H A;  2L0B A;  2LXP C;  2KU3 A;  2FFW A;  3KV6 A;  4O62 A;  1WEW A;  1HYI A;  4AYC B;  5AIT A;  1WEM A;  2LXH C;  2Y1M A;  3SOW A;  2LGV A;  2KFT A;  4CCG X;  4Q6F A;  2KIZ A;  2KWJ A;  2YYR A;  2VNF A;  2EOD A;  3N9P A;  2K17 A;  5KH3 A;  4LJN A;  4AYC A;  3O47 A;  2MKE A;  2YSM A;  4F52 B;  4UP5 A;  3Q1D A;  1HYJ A;  2RI7 A;  3SOX A;  2YSJ A;  4AVX A;  4UP0 A;  5TBN A;  1MM3 A;  5FER A;  2PNX A;  3KDE C;  5SVI B;  5D1L B;  2LDR A;  4CA1 A;  2VJF B;  5D1K B;  4C9Z A;  3PLW A;  2KWK A;  4MSX A;  3T7L A;  3EB5 A;  5EYA F;  4WZ3 B;  4LLB A;  2DJA A;  3N9M A;  4NN2 A;  2BAY A;  2ECI A;  2VJF A;  2YUC A;  5JG6 A;  1WFK A;  1ZBD B;  2KR4 A;  5FB0 A;  3U5N A;  2NAA A;  2FSA A;  3DDT A;  2CSY A;  2G43 A;  5B77 A;  4A0C D;  2VPE A;  4LKA A;  2G6Q A;  1G25 A;  2C2L A;  1X4I A;  5LCW B;  2KGG A;  4A49 A;  3VK6 A;  4AUQ B;  3PUQ A;  2ECJ A;  2VPG A;  2XB1 A;  5J3X A;  2QJ0 A;  2F6N A;  2L5U A;  2YQL A;  2ECW A;  3HCU A;  2OWA A;  1V87 A;  3ZTG A;  2I50 A;  4PTB A;  2YU4 A;  2E6S A;  3M62 A;  3SHB A;  2XOC A;  5I3L A;  3PUR A;  2JUN A;  4QF3 A;  2OXQ C;  3M99 A;  5FB1 A;  1WEN A;  2B0O E;  2EGM A;  4BHW A;  2IQJ A;  1WIM A;  4H9D A;  2MD7 B;  3HCS A;  5D1M B;  4WZ2 A;  3FM8 C;  4LAD B;  3O37 A;  1LDJ B;  2YUR A;  2D8U A;  5DKA A;  4XI1 A;  3KQI A;  4FO9 A;  3T6R A;  4QF2 A;  2VJE B;  4YAT A;  2EA6 A;  2VPD A;  4ZUX U;  3KV5 A;  2LRI C;  2RSD A;  4LK9 A;  1WES A;  2L7P A;  3L11 A;  3DQV R;  4GNE A;  3LRQ A;  1X4U A;  4L7X A;  4S3O B;  5TDR A;  1WEE A;  5B76 A;  1WEQ A;  2PUY A;  3U5M A;  1WIL A;  2MNZ A;  3SOU A;  1MBM A;  1FP0 A;  2XEU A;  2LV9 A;  2JMD A;  5TDW A;  3U5P A;  2L75 A;  4B86 C;  2YRE A;  2LGL A;  3IHP A;  3FL2 A;  3O70 A;  3ZPV 1;  5TAB A;  3MHH A;  3O36 A;  2YVR A;  1E4U A;  1VFY A;  5C13 A;  5H1V A;  2M6M A;  4GNG A;  3M63 A;  4YAX A;  3LDY A;  2LAU A;  4X3G A;  3FJU B;  2CSV A;  3L1X A;  4V3L C;  3LQJ A;  5AIU A;  4GND A;  2FUU A;  5SVI A;  4FIP A;  1VD4 A;  2CON A;  2CSZ A;  4P5O B;  5FEY A;  2YT5 A;  3NG2 A;  4PPE A;  4F1P A;  2HYE D;  3RTR B;  2KWN A;  2Y1N A;  2KYU A;  3E2D A;  2KE1 A;  4AP4 A;  3MDB C;  3LVR E;  2FD4 A;  4OGC A;  5G05 B;  2F42 A;  1N87 A;  2L80 A;  2E61 A;  3KNV A;  3GV4 A;  5SVX A;  5LKZ A;  5TRB A;  4YBS A;  2Y43 A;  4IC3 A;  4OGE A;  3ZVY A;  2XOZ A;  4S3O C;  2MA6 A;  2M13 A;  5K3Q A;  3LJU X;  2KKX A;  4Z0R A;  2G45 A;  2CKL B;  4A4C A;  4YBT A;  2JMJ A;  2MNY A;  1IYM A;  1U6G B;  4YAD A;  2CT2 A;  2KGI A;  3V43 A;  2H0D B;  4YAB A;  4FJC A;  3RPG B;  4YC9 A;  5H1T A;  1Z60 A;  3ZYQ A;  4N3W A;  2MD8 C;  2AN6 A;  1Z2Q A;  4GNF A;  2CRW A;  2HDP A;  2YW8 A;  4L58 A;  2H0D A;  1MM2 A;  5G04 B;  3ASL A;  3SUB A;  1WE9 A;  2JM3 A;  1X4J A;  2YQM A;  1CHC A;  3O33 A;  3LQH A;  3I2D A;  1WEO A;  2LGK A;  5G0F A;  2P57 A;  2VJE A;  3FEH A;  4YBM A;  5LKU A;  2M85 A;  3ZPV E;  5SVY A;  3N9L A;  4BBQ A;  1F62 A;  1VYX A;  4QQ4 A;  2ZET C;  2RR4 A;  1Z6U A;  4ZQL A;  2K16 A;  3FAO A;  5LKT A;  4I7B A;  3C5K A;  2DSM A;  5KH7 A;  2M1R A;  3T9K A;  5C11 A;  3ZVZ B;  5B78 A; 
#chains in the Genus database with same CATH homology
 4R2Y A;  1WEU A;  4W4U A;  3O34 A;  4MVT A;  2JMI A;  2E6R A;  4GB0 A;  2ECT A;  1DVP A;  3LQI A;  3HTK C;  2L43 A;  2D8S A;  2MIQ A;  1XWH A;  3O35 A;  1FBV A;  3L1Z B;  4WA6 A;  3N9O A;  3C6W A;  2MUM A;  2ECN A;  1WGM A;  2VPB A;  1LDK C;  4I7C A;  3RPG C;  2JRJ A;  3DPL R;  2KRE A;  2IDA A;  4TKP B;  3GL6 A;  4V3K C;  2YHN A;  3PHD A;  2MT5 A;  5LKX A;  2VP7 A;  5H1U A;  2UZG A;  2C2V S;  2K4D A;  4N4F A;  2F6J A;  4R8P K;  2YHO A;  1JM7 B;  5B79 A;  5B8D A;  3QZV A;  4IC2 A;  4UI9 B;  3U5O A;  4B7Y C;  4I7D A;  2LGG A;  3MHS A;  3O7A A;  2LN0 A;  2QIC A;  4FK5 A;  4O64 A;  4R7E A;  1JM7 A;  4WZ0 A;  2CKL A;  3N9Q A;  1WEV A;  2KWO A;  1RMD A;  2LQ6 A;  3HCT A;  5H9M A;  2DX8 A;  1WEP A;  4A4B A;  1BOR A;  2M3H A;  1K2F A;  2K1J A;  3EB6 A;  2ECG A;  1JOC A;  4ZDT A;  2FUI A;  3ZNI A;  2EGP A;  2QIZ A;  5DIN A;  2ECV A;  2MA5 A;  5B75 A;  5KH9 A;  3N9N A;  1T1H A;  2L0B A;  2LXP C;  2KU3 A;  3KV6 A;  1WEW A;  1HYI A;  4AYC B;  5AIT A;  1WEM A;  2LXH C;  2Y1M A;  3SOW A;  2LGV A;  2KFT A;  4CCG X;  4Q6F A;  2KIZ A;  2KWJ A;  2YYR A;  2VNF A;  2EOD A;  3N9P A;  2K17 A;  5KH3 A;  4LJN A;  4AYC A;  2YSM A;  4F52 B;  4UP5 A;  1HYJ A;  2RI7 A;  3SOX A;  2YSJ A;  4AVX A;  4UP0 A;  5TBN A;  1MM3 A;  5FER A;  2PNX A;  5D1L B;  2LDR A;  4CA1 A;  2VJF B;  5D1K B;  4C9Z A;  2KWK A;  4MSX A;  3T7L A;  3EB5 A;  5EYA F;  4WZ3 B;  4LLB A;  3N9M A;  4NN2 A;  2BAY A;  2ECI A;  2VJF A;  2YUC A;  5JG6 A;  1WFK A;  1ZBD B;  2KR4 A;  5FB0 A;  3U5N A;  2NAA A;  2FSA A;  2CSY A;  2G43 A;  5B77 A;  4A0C D;  2VPE A;  4LKA A;  2G6Q A;  1G25 A;  2C2L A;  1X4I A;  5LCW B;  2KGG A;  4A49 A;  3VK6 A;  4AUQ B;  3PUQ A;  2ECJ A;  2VPG A;  2XB1 A;  5J3X A;  2QJ0 A;  2F6N A;  2L5U A;  2YQL A;  2ECW A;  3HCU A;  1V87 A;  3ZTG A;  2I50 A;  4PTB A;  2YU4 A;  2E6S A;  3M62 A;  3SHB A;  5I3L A;  3PUR A;  4QF3 A;  2OXQ C;  3M99 A;  5FB1 A;  1WEN A;  4BHW A;  1WIM A;  2MD7 B;  3HCS A;  5D1M B;  4WZ2 A;  4LAD B;  3O37 A;  1LDJ B;  2YUR A;  5DKA A;  4XI1 A;  3KQI A;  4FO9 A;  3T6R A;  4QF2 A;  2VJE B;  4YAT A;  2EA6 A;  2VPD A;  4ZUX U;  3KV5 A;  2LRI C;  2RSD A;  4LK9 A;  1WES A;  3L11 A;  4GNE A;  3DQV R;  3LRQ A;  1X4U A;  4L7X A;  4S3O B;  5TDR A;  1WEE A;  5B76 A;  1WEQ A;  2PUY A;  3U5M A;  1WIL A;  2MNZ A;  3SOU A;  1FP0 A;  2XEU A;  2LV9 A;  2JMD A;  5TDW A;  3U5P A;  2L75 A;  4B86 C;  2YRE A;  2LGL A;  3IHP A;  3FL2 A;  3O70 A;  3ZPV 1;  5TAB A;  3MHH A;  3O36 A;  1E4U A;  1VFY A;  5C13 A;  5H1V A;  2M6M A;  4GNG A;  3M63 A;  4YAX A;  4X3G A;  3L1X A;  4V3L C;  3LQJ A;  5AIU A;  4GND A;  2FUU A;  4FIP A;  1VD4 A;  2CSZ A;  4P5O B;  5FEY A;  2YT5 A;  3NG2 A;  4PPE A;  2HYE D;  3RTR B;  2KWN A;  2Y1N A;  2KYU A;  2KE1 A;  4AP4 A;  5G05 B;  2F42 A;  1N87 A;  2L80 A;  3KNV A;  3GV4 A;  5LKZ A;  5TRB A;  4YBS A;  2Y43 A;  4IC3 A;  3ZVY A;  4S3O C;  2MA6 A;  2G45 A;  2CKL B;  4A4C A;  4YBT A;  2JMJ A;  2MNY A;  1IYM A;  1U6G B;  4YAD A;  2CT2 A;  2KGI A;  3V43 A;  2H0D B;  4YAB A;  4FJC A;  3RPG B;  4YC9 A;  5H1T A;  1Z60 A;  3ZYQ A;  4N3W A;  2MD8 C;  2AN6 A;  1Z2Q A;  4GNF A;  2HDP A;  2YW8 A;  4L58 A;  2H0D A;  1MM2 A;  5G04 B;  3ASL A;  1WE9 A;  1X4J A;  2YQM A;  1CHC A;  3O33 A;  3LQH A;  3I2D A;  1WEO A;  2LGK A;  5G0F A;  2VJE A;  4YBM A;  5LKU A;  2M85 A;  3ZPV E;  3N9L A;  4BBQ A;  1F62 A;  1VYX A;  2ZET C;  1Z6U A;  4ZQL A;  2K16 A;  5LKT A;  4I7B A;  3C5K A;  5KH7 A;  2M1R A;  5C11 A;  3ZVZ B;  5B78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...