3ZVZB

Phd finger of human uhrf1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
GHMRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE UHRF1
publication title The Phd Finger of Human Uhrf1 Reveals a New Subgroup of Unmethylated Histone H3 Tail Readers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 55
sequence length 55
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3zvzB00
4A49A 4YABA 3MHSA 5AITA 2M85A 1WEPA 4UI9B 3V43A 1MM3A 2D8SA 2MIQA 3U5PA 1HYIA 2YURA 3N9LA 5FB1A 3FL2A 4LADB 2G45A 4WZ3B 2OXQC 4N4FA 1WEVA 5KH3A 2ZETC 2QJ0A 4FIPA 1MM2A 2VJEA 2CKLB 2LGGA 5LKXA 2KE1A 2E6RA 5JG6A 5LKUA 2KR4A 5LKTA 3HCUA 1X4JA 2DX8A 1RMDA 4P5OB 5AIUA 4WA6A 3L11A 1LDJB 4FO9A 1XWHA 4TKPB 2VJFB 3DQVR 2MA6A 4N3WA 2MA5A 2L5UA 2VPGA 1JM7B 2EODA 1WEEA 2YHNA 5LKZA 5H1TA 2VJFA 1WEMA 3N9NA 3ZNIA 1WEWA 1WEUA 3T7LA 4CCGX 4QF2A 2H0DB 3SOXA 4R8PK 5J3XA 3T6RA 1JM7A 3L1XA 2YSJA 4IC2A 1X4UA 3LRQA 2ECJA 4I7CA 2VPEA 4AVXA 1WIMA 2YREA 2YHOA 2H0DA 3IHPA 2HYED 1K2FA 2G6QA 2QICA 4YADA 5B8DA 4I7BA 5TBNA 2L0BA 2XEUA 2LQ6A 5B75A 3ZVZB 4ZQLA 2VNFA 2Y43A 3N9OA 2QIZA 3U5NA 2YQLA 3N9QA 2K4DA 4UP0A 4GNGA 4F52B 4LKAA 3I2DA 1T1HA 2YUCA 1VD4A 5B77A 4AP4A 3ZVYA 2Y1MA 4V3LC 4L58A 5D1MB 4GNDA 5C11A 2LN0A 2VJEB 1WENA 5TDWA 4B86C 2LGVA 1HYJA 4R7EA 4YBSA 5H9MA 4ZUXU 3GV4A 5TRBA 1E4UA 1LDKC 1X4IA 2KWKA 4O64A 4S3OC 3ZYQA 4LJNA 3ASLA 2VPDA 3U5OA 3GL6A 2FUIA 2I50A 4YBTA 2YT5A 3L1ZB 2MUMA 3PHDA 2RSDA 5LCWB 2EGPA 3MHHA 4X3GA 5KH9A 4XI1A 2KYUA 3HCSA 2RI7A 4GNEA 4Q6FA 3RTRB 3SHBA 2XB1A 2CT2A 3SOUA 4WZ0A 3ZTGA 4BHWA 2FSAA 2YU4A 4PTBA 3EB6A 3O35A 3C6WA 2E6SA 2MD7B 3O37A 5TABA 2F42A 2KWNA 4S3OB 5TDRA 2LXPC 5B76A 4UP5A 1IYMA 2KWOA 2F6JA 2LRIC 5B78A 4R2YA 2K1JA 5H1UA 2K16A 1VFYA 4FJCA 5B79A 4AUQB 5FB0A 2NAAA 5DINA 3LQJA 4NN2A 2ECTA 4MVTA 5FERA 1DVPA 2YSMA 2M1RA 1VYXA 3PURA 4BBQA 3LQIA 3EB5A 4QF3A 2YQMA 2KWJA 2LGKA 4LK9A 2M3HA 3KNVA 2LGLA 2IDAA 3M99A 2L80A 5H1VA 3O34A 3RPGC 2HDPA 2F6NA 1FP0A 2C2LA 2L43A 5G05B 2YW8A 3M63A 2KGIA 1CHCA 2G43A 4LLBA 2FUUA 4C9ZA 4IC3A 3N9MA 4L7XA 4MSXA 4WZ2A 4CA1A 1G25A 1WFKA 4YC9A 3KV5A 4AYCB 1WESA 4A4BA 1WILA 2JRJA 2PNXA 5KH7A 3N9PA 4PPEA 2M6MA 2KIZA 3SOWA 4YBMA 5FEYA 2KFTA 3ZPVE 3U5MA 2JMJA 3QZVA 2ECVA 4AYCA 1WEOA 5D1LB 2AN6A 4B7YC 5G0FA 2K17A 2MNZA 2BAYA 2KU3A 2CSZA 2CSYA 3O33A 2MT5A 5EYAF 1Z60A 3DPLR 4A4CA 5I3LA 3RPGB 1Z2QA 5G04B 2CKLA 2LV9A 1N87A 4YAXA 3HCTA 2KGGA 1WE9A 2ECIA 1WEQA 2ECWA 1V87A 1F62A 4GB0A 2ECGA 4FK5A 2PUYA 2Y1NA 3HTKC 4ZDTA 1WGMA 2VP7A 3O70A 2LXHC 2KREA 3O7AA 2ECNA 3C5KA 5DKAA 3NG2A 2YYRA 2EA6A 3KQIA 2JMIA 2C2VS 3O36A 1Z6UA 2L75A 4A0CD 2VPBA 1BORA 3ZPV1 3M62A 4YATA 2UZGA 4I7DA 1ZBDB 5C13A 4GNFA 2MD8C 1JOCA 5D1KB 3PUQA 3VK6A 2MNYA 2JMDA 3LQHA 1U6GB 2LDRA 4V3KC 4W4UA 1FBVA 3KV6A
chains in the Genus database with same CATH superfamily
4A49A 4YABA 3MHSA 5AITA 2M85A 1WEPA 4UI9B 3V43A 2D8UA 1MM3A 2D8SA 2MIQA 5SVXA 3U5PA 1HYIA 2YURA 3N9LA 2XOCA 5FB1A 3FL2A 4LADB 2G45A 4WZ3B 2OXQC 4N4FA 1WEVA 2P57A 5KH3A 2ZETC 2QJ0A 4FIPA 1MM2A 3KDEC 2VJEA 2CKLB 2LGGA 5LKXA 2KE1A 2E6RA 5JG6A 5LKUA 2KR4A 5LKTA 2CONA 3HCUA 1X4JA 2DX8A 1RMDA 4P5OB 5AIUA 4WA6A 3L11A 1LDJB 4FO9A 5SVIB 1XWHA 4TKPB 2VJFB 3DQVR 2EXUA 2MA6A 4N3WA 2MA5A 2L5UA 2VPGA 1JM7B 2YVRA 2EODA 1WEEA 2YHNA 4QQ4A 5LKZA 5H1TA 2VJFA 1WEMA 3N9NA 3ZNIA 1WEWA 1WEUA 3T7LA 4CCGX 4QF2A 2H0DB 3SOXA 4R8PK 5J3XA 3T6RA 1JM7A 3L1XA 2KKYA 2FFWA 2YSJA 4IC2A 1X4UA 3FM8C 2ECJA 3LRQA 4I7CA 2VPEA 4AVXA 2E61A 1WIMA 2YREA 2YHOA 2H0DA 3IHPA 4H9DA 2HYED 1K2FA 2G6QA 2QICA 4YADA 5B8DA 4I7BA 5TBNA 2L0BA 2XEUA 2LQ6A 5B75A 3ZVZB 2DJAA 4ZQLA 2VNFA 2Y43A 3N9OA 2QIZA 3U5NA 2YQLA 3N9QA 2K4DA 4UP0A 4GNGA 4F52B 4LKAA 3I2DA 1T1HA 4OGEA 3DDTA 3DWDA 2KKXA 2FD4A 2YUCA 1VD4A 5B77A 4AP4A 3ZVYA 2Y1MA 4V3LC 4L58A 3FJUB 4GNDA 5D1MB 5C11A 2LN0A 2VJEB 1WENA 5TDWA 4B86C 2LGVA 1HYJA 2B0OE 4R7EA 4YBSA 5H9MA 4ZUXU 3GV4A 5TRBA 1E4UA 1LDKC 1X4IA 2KWKA 4O64A 4S3OC 3ZYQA 4LJNA 3ASLA 2VPDA 3U5OA 3GL6A 2FUIA 2I50A 3T9KA 4YBTA 2YT5A 3L1ZB 4Z0OA 2MUMA 3PHDA 2RSDA 5LCWB 2EGPA 3MHHA 4X3GA 5KH9A 2L7PA 4XI1A 2KYUA 3HCSA 2RI7A 3LDYA 4GNEA 4Q6FA 3RTRB 3SHBA 2XB1A 2CT2A 3SOUA 4WZ0A 3ZTGA 4BHWA 2FSAA 2YU4A 2RR4A 4PTBA 3EB6A 3O35A 3C6WA 2E6SA 2MD7B 3O37A 5TABA 2F42A 4O62A 4OGCA 2XOZA 3M7KA 2KWNA 4S3OB 5TDRA 2LXPC 5B76A 4UP5A 1IYMA 2KWOA 2F6JA 2LRIC 2IQJA 5B78A 4R2YA 2CRWA 3PLWA 2K1JA 3SUBA 5H1UA 3O47A 2K16A 1VFYA 4FJCA 5B79A 3JUEA 3LJUX 4AUQB 5FB0A 2NAAA 5DINA 3LQJA 4NN2A 2ECTA 4MVTA 5FERA 1DVPA 2YSMA 2M1RA 1VYXA 3PURA 3Q1DA 4BBQA 3LQIA 2XP0A 3EB5A 4QF3A 2YQMA 2KWJA 2LGKA 4F1PA 3LVRE 4LK9A 2M3HA 2M13A 3KNVA 2LGLA 2IDAA 3M99A 2L80A 5H1VA 3O34A 3RPGC 2HDPA 2F6NA 1FP0A 2C2LA 2L43A 5G05B 2YW8A 3M63A 3FANA 2KGIA 3FEHA 1CHCA 2G43A 4LLBA 2FUUA 4C9ZA 4IC3A 3N9MA 4L7XA 4MSXA 2EGMA 2LAUA 4WZ2A 4CA1A 1G25A 1WFKA 4YC9A 3KV5A 4AYCB 1WESA 4A4BA 1WILA 3E2DA 2CSVA 2JRJA 3LVQE 2PNXA 5KH7A 3N9PA 4PPEA 2M6MA 2KIZA 3MDBC 3SOWA 4YBMA 5FEYA 2KFTA 5SVYA 3ZPVE 3U5MA 2JMJA 3QZVA 2CRRA 2ECVA 4AYCA 1WEOA 5D1LB 5K3QA 2AN6A 4B7YC 5G0FA 2K17A 2MNZA 2BAYA 2KU3A 2CSZA 2CSYA 4Z0RA 3O33A 2MT5A 5EYAF 1Z60A 2MKEA 3DPLR 4A4CA 5I3LA 3RPGB 1Z2QA 1MBMA 5G04B 3FAOA 2CKLA 2LV9A 1N87A 4YAXA 3HCTA 2KGGA 1WE9A 2ECIA 1WEQA 2ECWA 1V87A 1F62A 3H7HA 4GB0A 2JM3A 2ECGA 4FK5A 1DCQA 2PUYA 2Y1NA 2OWAA 3HTKC 4ZDTA 1WGMA 2VP7A 3O70A 2LXHC 2KREA 3O7AA 2ECNA 5SVIA 3C5KA 5DKAA 2XOYA 3NG2A 2YYRA 2EA6A 3KQIA 2JMIA 2C2VS 3O36A 1Z6UA 2L75A 4A0CD 2VPBA 1BORA 3ZPV1 3M62A 4YATA 2UZGA 4I7DA 1ZBDB 5C13A 4GNFA 2MD8C 1JOCA 5D1KB 3PUQA 3VK6A 2MNYA 2DSMA 2JMDA 3LQHA 2JUNA 1U6GB 2LDRA 4V3KC 4W4UA 1FBVA 3KV6A
chains in the Genus database with same CATH topology
4A49A 4YABA 3MHSA 5AITA 2M85A 1WEPA 4UI9B 3V43A 1MM3A 2D8SA 2MIQA 3U5PA 1HYIA 2YURA 3N9LA 5FB1A 3FL2A 4LADB 2G45A 4WZ3B 2OXQC 4N4FA 1WEVA 5KH3A 2ZETC 2QJ0A 4FIPA 1MM2A 2VJEA 2CKLB 2LGGA 5LKXA 2KE1A 2E6RA 5JG6A 5LKUA 2KR4A 5LKTA 3HCUA 1X4JA 2DX8A 1RMDA 4P5OB 5AIUA 4WA6A 3L11A 1LDJB 4FO9A 1XWHA 4TKPB 2VJFB 3DQVR 2MA6A 4N3WA 2MA5A 2L5UA 2VPGA 1JM7B 2EODA 1WEEA 2YHNA 5LKZA 5H1TA 2VJFA 1WEMA 3N9NA 3ZNIA 1WEWA 1WEUA 3T7LA 4CCGX 4QF2A 2H0DB 3SOXA 4R8PK 5J3XA 3T6RA 1JM7A 3L1XA 2YSJA 4IC2A 1X4UA 3LRQA 2ECJA 4I7CA 2VPEA 4AVXA 1WIMA 2YREA 2YHOA 2H0DA 3IHPA 2HYED 1K2FA 2G6QA 2QICA 4YADA 5B8DA 4I7BA 5TBNA 2L0BA 2XEUA 2LQ6A 5B75A 3ZVZB 4ZQLA 2VNFA 2Y43A 3N9OA 2QIZA 3U5NA 2YQLA 3N9QA 2K4DA 4UP0A 4GNGA 4F52B 4LKAA 3I2DA 1T1HA 2YUCA 1VD4A 5B77A 4AP4A 3ZVYA 2Y1MA 4V3LC 4L58A 5D1MB 4GNDA 5C11A 2LN0A 2VJEB 1WENA 5TDWA 4B86C 2LGVA 1HYJA 4R7EA 4YBSA 5H9MA 4ZUXU 3GV4A 5TRBA 1E4UA 1LDKC 1X4IA 2KWKA 4O64A 4S3OC 3ZYQA 4LJNA 3ASLA 2VPDA 3U5OA 3GL6A 2FUIA 2I50A 4YBTA 2YT5A 3L1ZB 2MUMA 3PHDA 2RSDA 5LCWB 2EGPA 3MHHA 4X3GA 5KH9A 4XI1A 2KYUA 3HCSA 2RI7A 4GNEA 4Q6FA 3RTRB 3SHBA 2XB1A 2CT2A 3SOUA 4WZ0A 3ZTGA 4BHWA 2FSAA 2YU4A 4PTBA 3EB6A 3O35A 3C6WA 2E6SA 2MD7B 3O37A 5TABA 2F42A 2KWNA 4S3OB 5TDRA 2LXPC 5B76A 4UP5A 1IYMA 2KWOA 2F6JA 2LRIC 5B78A 4R2YA 2K1JA 5H1UA 2K16A 1VFYA 4FJCA 5B79A 4AUQB 5FB0A 2NAAA 5DINA 3LQJA 4NN2A 2ECTA 4MVTA 5FERA 1DVPA 2YSMA 2M1RA 1VYXA 3PURA 4BBQA 3LQIA 3EB5A 4QF3A 2YQMA 2KWJA 2LGKA 4LK9A 2M3HA 3KNVA 2LGLA 2IDAA 3M99A 2L80A 5H1VA 3O34A 3RPGC 2HDPA 2F6NA 1FP0A 2C2LA 2L43A 5G05B 2YW8A 3M63A 2KGIA 1CHCA 2G43A 4LLBA 2FUUA 4C9ZA 4IC3A 3N9MA 4L7XA 4MSXA 4WZ2A 4CA1A 1G25A 1WFKA 4YC9A 3KV5A 4AYCB 1WESA 4A4BA 1WILA 2JRJA 2PNXA 5KH7A 3N9PA 4PPEA 2M6MA 2KIZA 3SOWA 4YBMA 5FEYA 2KFTA 3ZPVE 3U5MA 2JMJA 3QZVA 2ECVA 4AYCA 1WEOA 5D1LB 2AN6A 4B7YC 5G0FA 2K17A 2MNZA 2BAYA 2KU3A 2CSZA 2CSYA 3O33A 2MT5A 5EYAF 1Z60A 3DPLR 4A4CA 5I3LA 3RPGB 1Z2QA 5G04B 2CKLA 2LV9A 1N87A 4YAXA 3HCTA 2KGGA 1WE9A 2ECIA 1WEQA 2ECWA 1V87A 1F62A 4GB0A 2ECGA 4FK5A 2PUYA 2Y1NA 3HTKC 4ZDTA 1WGMA 2VP7A 3O70A 2LXHC 2KREA 3O7AA 2ECNA 3C5KA 5DKAA 3NG2A 2YYRA 2EA6A 3KQIA 2JMIA 2C2VS 3O36A 1Z6UA 2L75A 4A0CD 2VPBA 1BORA 3ZPV1 3M62A 4YATA 2UZGA 4I7DA 1ZBDB 5C13A 4GNFA 2MD8C 1JOCA 5D1KB 3PUQA 3VK6A 2MNYA 2JMDA 3LQHA 1U6GB 2LDRA 4V3KC 4W4UA 1FBVA 3KV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A49 A;  4YAB A;  3MHS A;  5AIT A;  2M85 A;  1WEP A;  4UI9 B;  3V43 A;  1MM3 A;  2D8S A;  2MIQ A;  3U5P A;  1HYI A;  2YUR A;  3N9L A;  5FB1 A;  3FL2 A;  4LAD B;  2G45 A;  4WZ3 B;  2OXQ C;  4N4F A;  1WEV A;  5KH3 A;  2ZET C;  2QJ0 A;  4FIP A;  1MM2 A;  2VJE A;  2CKL B;  2LGG A;  5LKX A;  2KE1 A;  2E6R A;  5JG6 A;  5LKU A;  2KR4 A;  5LKT A;  3HCU A;  1X4J A;  2DX8 A;  1RMD A;  4P5O B;  5AIU A;  4WA6 A;  3L11 A;  1LDJ B;  4FO9 A;  1XWH A;  4TKP B;  2VJF B;  3DQV R;  2MA6 A;  4N3W A;  2MA5 A;  2L5U A;  2VPG A;  1JM7 B;  2EOD A;  1WEE A;  2YHN A;  5LKZ A;  5H1T A;  2VJF A;  1WEM A;  3N9N A;  3ZNI A;  1WEW A;  1WEU A;  3T7L A;  4CCG X;  4QF2 A;  2H0D B;  3SOX A;  4R8P K;  5J3X A;  3T6R A;  1JM7 A;  3L1X A;  2YSJ A;  4IC2 A;  1X4U A;  3LRQ A;  2ECJ A;  4I7C A;  2VPE A;  4AVX A;  1WIM A;  2YRE A;  2YHO A;  2H0D A;  3IHP A;  2HYE D;  1K2F A;  2G6Q A;  2QIC A;  4YAD A;  5B8D A;  4I7B A;  5TBN A;  2L0B A;  2XEU A;  2LQ6 A;  5B75 A;  3ZVZ B;  4ZQL A;  2VNF A;  2Y43 A;  3N9O A;  2QIZ A;  3U5N A;  2YQL A;  3N9Q A;  2K4D A;  4UP0 A;  4GNG A;  4F52 B;  4LKA A;  3I2D A;  1T1H A;  2YUC A;  1VD4 A;  5B77 A;  4AP4 A;  3ZVY A;  2Y1M A;  4V3L C;  4L58 A;  5D1M B;  4GND A;  5C11 A;  2LN0 A;  2VJE B;  1WEN A;  5TDW A;  4B86 C;  2LGV A;  1HYJ A;  4R7E A;  4YBS A;  5H9M A;  4ZUX U;  3GV4 A;  5TRB A;  1E4U A;  1LDK C;  1X4I A;  2KWK A;  4O64 A;  4S3O C;  3ZYQ A;  4LJN A;  3ASL A;  2VPD A;  3U5O A;  3GL6 A;  2FUI A;  2I50 A;  4YBT A;  2YT5 A;  3L1Z B;  2MUM A;  3PHD A;  2RSD A;  5LCW B;  2EGP A;  3MHH A;  4X3G A;  5KH9 A;  4XI1 A;  2KYU A;  3HCS A;  2RI7 A;  4GNE A;  4Q6F A;  3RTR B;  3SHB A;  2XB1 A;  2CT2 A;  3SOU A;  4WZ0 A;  3ZTG A;  4BHW A;  2FSA A;  2YU4 A;  4PTB A;  3EB6 A;  3O35 A;  3C6W A;  2E6S A;  2MD7 B;  3O37 A;  5TAB A;  2F42 A;  2KWN A;  4S3O B;  5TDR A;  2LXP C;  5B76 A;  4UP5 A;  1IYM A;  2KWO A;  2F6J A;  2LRI C;  5B78 A;  4R2Y A;  2K1J A;  5H1U A;  2K16 A;  1VFY A;  4FJC A;  5B79 A;  4AUQ B;  5FB0 A;  2NAA A;  5DIN A;  3LQJ A;  4NN2 A;  2ECT A;  4MVT A;  5FER A;  1DVP A;  2YSM A;  2M1R A;  1VYX A;  3PUR A;  4BBQ A;  3LQI A;  3EB5 A;  4QF3 A;  2YQM A;  2KWJ A;  2LGK A;  4LK9 A;  2M3H A;  3KNV A;  2LGL A;  2IDA A;  3M99 A;  2L80 A;  5H1V A;  3O34 A;  3RPG C;  2HDP A;  2F6N A;  1FP0 A;  2C2L A;  2L43 A;  5G05 B;  2YW8 A;  3M63 A;  2KGI A;  1CHC A;  2G43 A;  4LLB A;  2FUU A;  4C9Z A;  4IC3 A;  3N9M A;  4L7X A;  4MSX A;  4WZ2 A;  4CA1 A;  1G25 A;  1WFK A;  4YC9 A;  3KV5 A;  4AYC B;  1WES A;  4A4B A;  1WIL A;  2JRJ A;  2PNX A;  5KH7 A;  3N9P A;  4PPE A;  2M6M A;  2KIZ A;  3SOW A;  4YBM A;  5FEY A;  2KFT A;  3ZPV E;  3U5M A;  2JMJ A;  3QZV A;  2ECV A;  4AYC A;  1WEO A;  5D1L B;  2AN6 A;  4B7Y C;  5G0F A;  2K17 A;  2MNZ A;  2BAY A;  2KU3 A;  2CSZ A;  2CSY A;  3O33 A;  2MT5 A;  5EYA F;  1Z60 A;  3DPL R;  4A4C A;  5I3L A;  3RPG B;  1Z2Q A;  5G04 B;  2CKL A;  2LV9 A;  1N87 A;  4YAX A;  3HCT A;  2KGG A;  1WE9 A;  2ECI A;  1WEQ A;  2ECW A;  1V87 A;  1F62 A;  4GB0 A;  2ECG A;  4FK5 A;  2PUY A;  2Y1N A;  3HTK C;  4ZDT A;  1WGM A;  2VP7 A;  3O70 A;  2LXH C;  2KRE A;  3O7A A;  2ECN A;  3C5K A;  5DKA A;  3NG2 A;  2YYR A;  2EA6 A;  3KQI A;  2JMI A;  2C2V S;  3O36 A;  1Z6U A;  2L75 A;  4A0C D;  2VPB A;  1BOR A;  3ZPV 1;  3M62 A;  4YAT A;  2UZG A;  4I7D A;  1ZBD B;  5C13 A;  4GNF A;  2MD8 C;  1JOC A;  5D1K B;  3PUQ A;  3VK6 A;  2MNY A;  2JMD A;  3LQH A;  1U6G B;  2LDR A;  4V3K C;  4W4U A;  1FBV A;  3KV6 A; 
#chains in the Genus database with same CATH topology
 4A49 A;  4YAB A;  3MHS A;  5AIT A;  2M85 A;  1WEP A;  4UI9 B;  3V43 A;  2D8U A;  1MM3 A;  2D8S A;  2MIQ A;  5SVX A;  3U5P A;  1HYI A;  2YUR A;  3N9L A;  2XOC A;  5FB1 A;  3FL2 A;  4LAD B;  2G45 A;  4WZ3 B;  2OXQ C;  4N4F A;  1WEV A;  2P57 A;  5KH3 A;  2ZET C;  2QJ0 A;  4FIP A;  1MM2 A;  3KDE C;  2VJE A;  2CKL B;  2LGG A;  5LKX A;  2KE1 A;  2E6R A;  5JG6 A;  5LKU A;  2KR4 A;  5LKT A;  2CON A;  3HCU A;  1X4J A;  2DX8 A;  1RMD A;  4P5O B;  5AIU A;  4WA6 A;  3L11 A;  1LDJ B;  4FO9 A;  5SVI B;  1XWH A;  4TKP B;  2VJF B;  3DQV R;  2EXU A;  2MA6 A;  4N3W A;  2MA5 A;  2L5U A;  2VPG A;  1JM7 B;  2YVR A;  2EOD A;  1WEE A;  2YHN A;  4QQ4 A;  5LKZ A;  5H1T A;  2VJF A;  1WEM A;  3N9N A;  3ZNI A;  1WEW A;  1WEU A;  3T7L A;  4CCG X;  4QF2 A;  2H0D B;  3SOX A;  4R8P K;  5J3X A;  3T6R A;  1JM7 A;  3L1X A;  2KKY A;  2FFW A;  2YSJ A;  4IC2 A;  1X4U A;  3FM8 C;  2ECJ A;  3LRQ A;  4I7C A;  2VPE A;  4AVX A;  2E61 A;  1WIM A;  2YRE A;  2YHO A;  2H0D A;  3IHP A;  4H9D A;  2HYE D;  1K2F A;  2G6Q A;  2QIC A;  4YAD A;  5B8D A;  4I7B A;  5TBN A;  2L0B A;  2XEU A;  2LQ6 A;  5B75 A;  3ZVZ B;  2DJA A;  4ZQL A;  2VNF A;  2Y43 A;  3N9O A;  2QIZ A;  3U5N A;  2YQL A;  3N9Q A;  2K4D A;  4UP0 A;  4GNG A;  4F52 B;  4LKA A;  3I2D A;  1T1H A;  4OGE A;  3DDT A;  3DWD A;  2KKX A;  2FD4 A;  2YUC A;  1VD4 A;  5B77 A;  4AP4 A;  3ZVY A;  2Y1M A;  4V3L C;  4L58 A;  3FJU B;  4GND A;  5D1M B;  5C11 A;  2LN0 A;  2VJE B;  1WEN A;  5TDW A;  4B86 C;  2LGV A;  1HYJ A;  2B0O E;  4R7E A;  4YBS A;  5H9M A;  4ZUX U;  3GV4 A;  5TRB A;  1E4U A;  1LDK C;  1X4I A;  2KWK A;  4O64 A;  4S3O C;  3ZYQ A;  4LJN A;  3ASL A;  2VPD A;  3U5O A;  3GL6 A;  2FUI A;  2I50 A;  3T9K A;  4YBT A;  2YT5 A;  3L1Z B;  4Z0O A;  2MUM A;  3PHD A;  2RSD A;  5LCW B;  2EGP A;  3MHH A;  4X3G A;  5KH9 A;  2L7P A;  4XI1 A;  2KYU A;  3HCS A;  2RI7 A;  3LDY A;  4GNE A;  4Q6F A;  3RTR B;  3SHB A;  2XB1 A;  2CT2 A;  3SOU A;  4WZ0 A;  3ZTG A;  4BHW A;  2FSA A;  2YU4 A;  2RR4 A;  4PTB A;  3EB6 A;  3O35 A;  3C6W A;  2E6S A;  2MD7 B;  3O37 A;  5TAB A;  2F42 A;  4O62 A;  4OGC A;  2XOZ A;  3M7K A;  2KWN A;  4S3O B;  5TDR A;  2LXP C;  5B76 A;  4UP5 A;  1IYM A;  2KWO A;  2F6J A;  2LRI C;  2IQJ A;  5B78 A;  4R2Y A;  2CRW A;  3PLW A;  2K1J A;  3SUB A;  5H1U A;  3O47 A;  2K16 A;  1VFY A;  4FJC A;  5B79 A;  3JUE A;  3LJU X;  4AUQ B;  5FB0 A;  2NAA A;  5DIN A;  3LQJ A;  4NN2 A;  2ECT A;  4MVT A;  5FER A;  1DVP A;  2YSM A;  2M1R A;  1VYX A;  3PUR A;  3Q1D A;  4BBQ A;  3LQI A;  2XP0 A;  3EB5 A;  4QF3 A;  2YQM A;  2KWJ A;  2LGK A;  4F1P A;  3LVR E;  4LK9 A;  2M3H A;  2M13 A;  3KNV A;  2LGL A;  2IDA A;  3M99 A;  2L80 A;  5H1V A;  3O34 A;  3RPG C;  2HDP A;  2F6N A;  1FP0 A;  2C2L A;  2L43 A;  5G05 B;  2YW8 A;  3M63 A;  3FAN A;  2KGI A;  3FEH A;  1CHC A;  2G43 A;  4LLB A;  2FUU A;  4C9Z A;  4IC3 A;  3N9M A;  4L7X A;  4MSX A;  2EGM A;  2LAU A;  4WZ2 A;  4CA1 A;  1G25 A;  1WFK A;  4YC9 A;  3KV5 A;  4AYC B;  1WES A;  4A4B A;  1WIL A;  3E2D A;  2CSV A;  2JRJ A;  3LVQ E;  2PNX A;  5KH7 A;  3N9P A;  4PPE A;  2M6M A;  2KIZ A;  3MDB C;  3SOW A;  4YBM A;  5FEY A;  2KFT A;  5SVY A;  3ZPV E;  3U5M A;  2JMJ A;  3QZV A;  2CRR A;  2ECV A;  4AYC A;  1WEO A;  5D1L B;  5K3Q A;  2AN6 A;  4B7Y C;  5G0F A;  2K17 A;  2MNZ A;  2BAY A;  2KU3 A;  2CSZ A;  2CSY A;  4Z0R A;  3O33 A;  2MT5 A;  5EYA F;  1Z60 A;  2MKE A;  3DPL R;  4A4C A;  5I3L A;  3RPG B;  1Z2Q A;  1MBM A;  5G04 B;  3FAO A;  2CKL A;  2LV9 A;  1N87 A;  4YAX A;  3HCT A;  2KGG A;  1WE9 A;  2ECI A;  1WEQ A;  2ECW A;  1V87 A;  1F62 A;  3H7H A;  4GB0 A;  2JM3 A;  2ECG A;  4FK5 A;  1DCQ A;  2PUY A;  2Y1N A;  2OWA A;  3HTK C;  4ZDT A;  1WGM A;  2VP7 A;  3O70 A;  2LXH C;  2KRE A;  3O7A A;  2ECN A;  5SVI A;  3C5K A;  5DKA A;  2XOY A;  3NG2 A;  2YYR A;  2EA6 A;  3KQI A;  2JMI A;  2C2V S;  3O36 A;  1Z6U A;  2L75 A;  4A0C D;  2VPB A;  1BOR A;  3ZPV 1;  3M62 A;  4YAT A;  2UZG A;  4I7D A;  1ZBD B;  5C13 A;  4GNF A;  2MD8 C;  1JOC A;  5D1K B;  3PUQ A;  3VK6 A;  2MNY A;  2DSM A;  2JMD A;  3LQH A;  2JUN A;  1U6G B;  2LDR A;  4V3K C;  4W4U A;  1FBV A;  3KV6 A; 
#chains in the Genus database with same CATH homology
 4A49 A;  4YAB A;  3MHS A;  5AIT A;  2M85 A;  1WEP A;  4UI9 B;  3V43 A;  1MM3 A;  2D8S A;  2MIQ A;  3U5P A;  1HYI A;  2YUR A;  3N9L A;  5FB1 A;  3FL2 A;  4LAD B;  2G45 A;  4WZ3 B;  2OXQ C;  4N4F A;  1WEV A;  5KH3 A;  2ZET C;  2QJ0 A;  4FIP A;  1MM2 A;  2VJE A;  2CKL B;  2LGG A;  5LKX A;  2KE1 A;  2E6R A;  5JG6 A;  5LKU A;  2KR4 A;  5LKT A;  3HCU A;  1X4J A;  2DX8 A;  1RMD A;  4P5O B;  5AIU A;  4WA6 A;  3L11 A;  1LDJ B;  4FO9 A;  1XWH A;  4TKP B;  2VJF B;  3DQV R;  2MA6 A;  4N3W A;  2MA5 A;  2L5U A;  2VPG A;  1JM7 B;  2EOD A;  1WEE A;  2YHN A;  5LKZ A;  5H1T A;  2VJF A;  1WEM A;  3N9N A;  3ZNI A;  1WEW A;  1WEU A;  3T7L A;  4CCG X;  4QF2 A;  2H0D B;  3SOX A;  4R8P K;  5J3X A;  3T6R A;  1JM7 A;  3L1X A;  2YSJ A;  4IC2 A;  1X4U A;  3LRQ A;  2ECJ A;  4I7C A;  2VPE A;  4AVX A;  1WIM A;  2YRE A;  2YHO A;  2H0D A;  3IHP A;  2HYE D;  1K2F A;  2G6Q A;  2QIC A;  4YAD A;  5B8D A;  4I7B A;  5TBN A;  2L0B A;  2XEU A;  2LQ6 A;  5B75 A;  3ZVZ B;  4ZQL A;  2VNF A;  2Y43 A;  3N9O A;  2QIZ A;  3U5N A;  2YQL A;  3N9Q A;  2K4D A;  4UP0 A;  4GNG A;  4F52 B;  4LKA A;  3I2D A;  1T1H A;  2YUC A;  1VD4 A;  5B77 A;  4AP4 A;  3ZVY A;  2Y1M A;  4V3L C;  4L58 A;  5D1M B;  4GND A;  5C11 A;  2LN0 A;  2VJE B;  1WEN A;  5TDW A;  4B86 C;  2LGV A;  1HYJ A;  4R7E A;  4YBS A;  5H9M A;  4ZUX U;  3GV4 A;  5TRB A;  1E4U A;  1LDK C;  1X4I A;  2KWK A;  4O64 A;  4S3O C;  3ZYQ A;  4LJN A;  3ASL A;  2VPD A;  3U5O A;  3GL6 A;  2FUI A;  2I50 A;  4YBT A;  2YT5 A;  3L1Z B;  2MUM A;  3PHD A;  2RSD A;  5LCW B;  2EGP A;  3MHH A;  4X3G A;  5KH9 A;  4XI1 A;  2KYU A;  3HCS A;  2RI7 A;  4GNE A;  4Q6F A;  3RTR B;  3SHB A;  2XB1 A;  2CT2 A;  3SOU A;  4WZ0 A;  3ZTG A;  4BHW A;  2FSA A;  2YU4 A;  4PTB A;  3EB6 A;  3O35 A;  3C6W A;  2E6S A;  2MD7 B;  3O37 A;  5TAB A;  2F42 A;  2KWN A;  4S3O B;  5TDR A;  2LXP C;  5B76 A;  4UP5 A;  1IYM A;  2KWO A;  2F6J A;  2LRI C;  5B78 A;  4R2Y A;  2K1J A;  5H1U A;  2K16 A;  1VFY A;  4FJC A;  5B79 A;  4AUQ B;  5FB0 A;  2NAA A;  5DIN A;  3LQJ A;  4NN2 A;  2ECT A;  4MVT A;  5FER A;  1DVP A;  2YSM A;  2M1R A;  1VYX A;  3PUR A;  4BBQ A;  3LQI A;  3EB5 A;  4QF3 A;  2YQM A;  2KWJ A;  2LGK A;  4LK9 A;  2M3H A;  3KNV A;  2LGL A;  2IDA A;  3M99 A;  2L80 A;  5H1V A;  3O34 A;  3RPG C;  2HDP A;  2F6N A;  1FP0 A;  2C2L A;  2L43 A;  5G05 B;  2YW8 A;  3M63 A;  2KGI A;  1CHC A;  2G43 A;  4LLB A;  2FUU A;  4C9Z A;  4IC3 A;  3N9M A;  4L7X A;  4MSX A;  4WZ2 A;  4CA1 A;  1G25 A;  1WFK A;  4YC9 A;  3KV5 A;  4AYC B;  1WES A;  4A4B A;  1WIL A;  2JRJ A;  2PNX A;  5KH7 A;  3N9P A;  4PPE A;  2M6M A;  2KIZ A;  3SOW A;  4YBM A;  5FEY A;  2KFT A;  3ZPV E;  3U5M A;  2JMJ A;  3QZV A;  2ECV A;  4AYC A;  1WEO A;  5D1L B;  2AN6 A;  4B7Y C;  5G0F A;  2K17 A;  2MNZ A;  2BAY A;  2KU3 A;  2CSZ A;  2CSY A;  3O33 A;  2MT5 A;  5EYA F;  1Z60 A;  3DPL R;  4A4C A;  5I3L A;  3RPG B;  1Z2Q A;  5G04 B;  2CKL A;  2LV9 A;  1N87 A;  4YAX A;  3HCT A;  2KGG A;  1WE9 A;  2ECI A;  1WEQ A;  2ECW A;  1V87 A;  1F62 A;  4GB0 A;  2ECG A;  4FK5 A;  2PUY A;  2Y1N A;  3HTK C;  4ZDT A;  1WGM A;  2VP7 A;  3O70 A;  2LXH C;  2KRE A;  3O7A A;  2ECN A;  3C5K A;  5DKA A;  3NG2 A;  2YYR A;  2EA6 A;  3KQI A;  2JMI A;  2C2V S;  3O36 A;  1Z6U A;  2L75 A;  4A0C D;  2VPB A;  1BOR A;  3ZPV 1;  3M62 A;  4YAT A;  2UZG A;  4I7D A;  1ZBD B;  5C13 A;  4GNF A;  2MD8 C;  1JOC A;  5D1K B;  3PUQ A;  3VK6 A;  2MNY A;  2JMD A;  3LQH A;  1U6G B;  2LDR A;  4V3K C;  4W4U A;  1FBV A;  3KV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...