4R7EA

Structure of bre1 ring domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
DEALVEELANFRTLVYCSLCSKNWKNMAIKTCGHVFCENCCKERLAARMRKCPTCNKAFSSNDLLTVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase BRE1
publication title Structure of the yeast Bre1 RING domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 20
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4r7eA00
3HTKC 2K17A 3SOUA 1Z2QA 4QF3A 2YT5A 2HYED 5LKUA 2C2LA 4PPEA 3LQJA 2C2VS 4R2YA 1ZBDB 2F42A 2LGKA 4BBQA 2RI7A 2MNZA 4AYCA 1Z60A 3MHHA 4FIPA 1CHCA 2FSAA 4GB0A 3U5OA 2VJEA 2MD7B 4GNFA 1XWHA 3L1XA 1JM7B 3N9OA 3ZNIA 2L75A 3RPGC 2YURA 5AIUA 2KIZA 4AP4A 1U6GB 3RPGB 4ZDTA 2LDRA 5EYAF 5TABA 3O7AA 2KGGA 2CT2A 2PUYA 2YSMA 3I2DA 3LQHA 3IHPA 4NN2A 2YW8A 5TDRA 2EA6A 2L80A 4P5OB 3ZPV1 2EGPA 2D8SA 4YAXA 4CCGX 4QF2A 5H1VA 4YBTA 4LLBA 2KWKA 3O33A 3HCSA 4FK5A 5B75A 1VFYA 5G0FA 3N9LA 5DKAA 5B76A 3N9MA 3C5KA 4YATA 3U5NA 2LQ6A 3KQIA 4PTBA 2JMJA 4CA1A 4ZUXU 3T7LA 3PUQA 2QIZA 3SHBA 1WFKA 3SOXA 1WEPA 2FUUA 3FL2A 1WEOA 3VK6A 5I3LA 2KR4A 3KV5A 4A4BA 2EODA 3ZVYA 2NAAA 4WZ0A 1BORA 3M99A 4TKPB 2JMDA 4YADA 1RMDA 1JM7A 3ZTGA 2VPBA 3L11A 2E6RA 1JOCA 2MA6A 3HCTA 4LK9A 5TDWA 2LV9A 1FBVA 5TRBA 5JG6A 4WZ2A 2ECVA 3T6RA 2JRJA 2VPDA 4UP5A 5B79A 2KYUA 2F6NA 4L7XA 5G04B 2RSDA 4A4CA 2MUMA 5H1TA 4LJNA 5D1MB 2I50A 2AN6A 5KH9A 3SOWA 4GNDA 2KGIA 1WEUA 5KH7A 2CSYA 3ZYQA 3U5MA 1IYMA 4B7YC 2MA5A 3GV4A 3EB5A 2MD8C 2LXPC 3ZVZB 4YBMA 1LDJB 1WENA 4O64A 2YYRA 3M63A 4W4UA 2YSJA 3MHSA 2M1RA 1VD4A 2JMIA 2KE1A 3O35A 3PHDA 4LKAA 2M3HA 4AVXA 3RTRB 1E4UA 2HDPA 1MM3A 1T1HA 1WILA 3KV6A 1WESA 2KREA 1WGMA 2H0DA 4WZ3B 5KH3A 4AUQB 3N9QA 2ECIA 2LGGA 2LRIC 4C9ZA 4UP0A 3O34A 5C11A 2Y1NA 5FEYA 2FUIA 1HYJA 2G45A 3V43A 2VJFB 5TBNA 5G05B 5B78A 1VYXA 4L58A 3LQIA 4IC2A 2LN0A 2YQLA 2L0BA 2H0DB 4I7BA 2IDAA 4S3OC 4FJCA 4FO9A 4S3OB 2UZGA 5H1UA 2CSZA 4LADB 5FB0A 5LKTA 3N9PA 3O36A 4BHWA 4Q6FA 2M85A 3N9NA 1X4UA 4V3KC 4ZQLA 2KWOA 3GL6A 4X3GA 5FERA 1Z6UA 2KU3A 1F62A 2YHNA 2LGLA 3KNVA 3ZPVE 2KFTA 5FB1A 2OXQC 4I7DA 2F6JA 2YHOA 2L5UA 1WEWA 2ZETC 4A49A 4GNGA 2MT5A 5B8DA 2CKLB 2VPEA 2G6QA 1WEVA 4GNEA 5H9MA 2ECNA 4WA6A 2QJ0A 2XEUA 3O70A 2YU4A 1G25A 2ECJA 5D1LB 4YABA 5AITA 5LKZA 2PNXA 4MVTA 5LKXA 2VJFA 1X4JA 3U5PA 4N4FA 2MNYA 3M62A 2LGVA 2YUCA 1WE9A 5C13A 5D1KB 4A0CD 4I7CA 5LCWB 4AYCB 4YC9A 3L1ZB 2QICA 2XB1A 3LRQA 3HCUA 4XI1A 3ASLA 3QZVA 4IC3A 2VJEB 1WEQA 4R7EA 1WIMA 1V87A 4YBSA 2ECTA 1WEEA 4R8PK 1WEMA 3NG2A 2VNFA 2LXHC 2Y43A 3C6WA 2VP7A 3PURA 2ECGA 2BAYA 1LDKC 2MIQA 3DPLR 2ECWA 2KWNA 2K1JA 4V3LC 1X4IA 4UI9B 2DX8A 1HYIA 4F52B 2L43A 5B77A 1K2FA 2K4DA 1FP0A 2K16A 2G43A 1MM2A 3EB6A 2CKLA 4MSXA 1DVPA 4N3WA 3DQVR 5DINA 2Y1MA 2VPGA 2YQMA 1N87A 2M6MA 4B86C 2E6SA 5J3XA 3O37A 2KWJA 2YREA
chains in the Genus database with same CATH superfamily
3HTKC 2K17A 3SOUA 1Z2QA 4QF3A 2YT5A 2HYED 5LKUA 2C2LA 4PPEA 3LQJA 2C2VS 4R2YA 1ZBDB 2F42A 2LGKA 4BBQA 2RI7A 2MNZA 4AYCA 1Z60A 3MHHA 4FIPA 1CHCA 2FSAA 4GB0A 3U5OA 2VJEA 2MD7B 2XOZA 5SVIB 4GNFA 1XWHA 3L1XA 1JM7B 2L7PA 3N9OA 3ZNIA 2L75A 3RPGC 2YURA 5AIUA 2KIZA 4AP4A 1U6GB 3RPGB 4ZDTA 2B0OE 2LDRA 5EYAF 5TABA 3O7AA 2KGGA 2CT2A 2PUYA 2YSMA 3I2DA 3LQHA 4F1PA 3IHPA 4NN2A 2YW8A 5TDRA 2EA6A 2L80A 4P5OB 3ZPV1 2EGPA 2D8SA 4YAXA 4CCGX 4QF2A 5H1VA 4YBTA 4LLBA 2KWKA 3O33A 3HCSA 4FK5A 5B75A 1VFYA 5G0FA 3N9LA 5DKAA 2CRRA 5B76A 3N9MA 3C5KA 4YATA 3U5NA 3FM8C 2LQ6A 3KQIA 2JUNA 4PTBA 2JMJA 2FD4A 4CA1A 4ZUXU 3T7LA 2FFWA 3PUQA 2QIZA 3SHBA 1WFKA 3SOXA 1WEPA 2FUUA 3FL2A 1WEOA 3VK6A 5I3LA 2KR4A 3KV5A 4A4BA 2EODA 3ZVYA 2NAAA 4WZ0A 1BORA 3M99A 4TKPB 2JMDA 4YADA 4OGEA 3LVQE 1RMDA 1JM7A 3ZTGA 2VPBA 3L11A 2E6RA 1JOCA 2MA6A 3HCTA 4OGCA 4LK9A 3DWDA 5TDWA 2LV9A 1FBVA 2JM3A 5TRBA 3JUEA 5JG6A 4WZ2A 2ECVA 3T6RA 2JRJA 2VPDA 4UP5A 5B79A 2KYUA 3M7KA 2F6NA 2CSVA 4L7XA 5G04B 2RSDA 4QQ4A 4A4CA 2MUMA 5H1TA 4LJNA 5D1MB 2I50A 2AN6A 2KKXA 3DDTA 5KH9A 3SOWA 4GNDA 4H9DA 2KGIA 2DSMA 1WEUA 5KH7A 2LAUA 2CSYA 3ZYQA 3U5MA 1IYMA 2CRWA 4B7YC 2MA5A 3PLWA 3GV4A 2OWAA 2KKYA 2YVRA 3EB5A 2MD8C 2LXPC 3ZVZB 4YBMA 1LDJB 1WENA 4O64A 2YYRA 3M63A 2D8UA 4W4UA 2YSJA 3MHSA 2M1RA 1VD4A 2JMIA 2KE1A 3O35A 3PHDA 4LKAA 2M3HA 4AVXA 3RTRB 1E4UA 4Z0RA 3KDEC 2HDPA 1MM3A 1T1HA 1WILA 3KV6A 1WESA 2KREA 1WGMA 2H0DA 2M13A 4WZ3B 5KH3A 2CONA 4AUQB 5SVXA 3N9QA 3FJUB 3LDYA 2ECIA 2LGGA 2LRIC 4C9ZA 4UP0A 2P57A 3O34A 5C11A 2Y1NA 5FEYA 2FUIA 1HYJA 2G45A 3FANA 3V43A 2VJFB 5TBNA 5G05B 5SVYA 5B78A 1VYXA 4L58A 3LQIA 4IC2A 2LN0A 3LJUX 2YQLA 2L0BA 2H0DB 4I7BA 2IDAA 4S3OC 4FJCA 4FO9A 4S3OB 3E2DA 2UZGA 5H1UA 2CSZA 4Z0OA 4LADB 5FB0A 2RR4A 5LKTA 3N9PA 3O36A 4BHWA 4Q6FA 2M85A 3N9NA 1X4UA 4V3KC 4ZQLA 2KWOA 3GL6A 4X3GA 5FERA 1Z6UA 2KU3A 2DJAA 1F62A 2YHNA 2LGLA 2MKEA 2IQJA 3KNVA 3Q1DA 3ZPVE 2KFTA 5FB1A 2OXQC 4I7DA 2F6JA 2YHOA 2L5UA 1WEWA 2ZETC 4A49A 4GNGA 2MT5A 5B8DA 2CKLB 2VPEA 2G6QA 3FAOA 1WEVA 4GNEA 5H9MA 3MDBC 2ECNA 4WA6A 2QJ0A 2XEUA 3O70A 4O62A 2YU4A 1G25A 2ECJA 5D1LB 4YABA 2EGMA 5AITA 5LKZA 2PNXA 4MVTA 5LKXA 2VJFA 1X4JA 1DCQA 3U5PA 3LVRE 4N4FA 2MNYA 3M62A 2XOYA 2LGVA 2YUCA 1WE9A 5C13A 5D1KB 4A0CD 4I7CA 5LCWB 3H7HA 4AYCB 4YC9A 3L1ZB 2QICA 2XB1A 3LRQA 3HCUA 4XI1A 3ASLA 3QZVA 4IC3A 2EXUA 3O47A 2VJEB 1WEQA 4R7EA 1WIMA 1V87A 4YBSA 2ECTA 1MBMA 3FEHA 1WEEA 4R8PK 1WEMA 3NG2A 2E61A 2VNFA 2LXHC 2Y43A 3C6WA 2VP7A 3PURA 2ECGA 5K3QA 2BAYA 1LDKC 2MIQA 2XOCA 3DPLR 2ECWA 2KWNA 2K1JA 4V3LC 1X4IA 4UI9B 3T9KA 2DX8A 1HYIA 4F52B 2L43A 2XP0A 5B77A 1K2FA 2K4DA 1FP0A 2K16A 2G43A 1MM2A 3EB6A 5SVIA 2CKLA 4MSXA 1DVPA 4N3WA 3DQVR 5DINA 2Y1MA 2VPGA 2YQMA 1N87A 2M6MA 4B86C 3SUBA 2E6SA 5J3XA 3O37A 2KWJA 2YREA
chains in the Genus database with same CATH topology
3HTKC 2K17A 3SOUA 1Z2QA 4QF3A 2YT5A 2HYED 5LKUA 2C2LA 4PPEA 3LQJA 2C2VS 4R2YA 1ZBDB 2F42A 2LGKA 4BBQA 2RI7A 2MNZA 4AYCA 1Z60A 3MHHA 4FIPA 1CHCA 2FSAA 4GB0A 3U5OA 2VJEA 2MD7B 4GNFA 1XWHA 3L1XA 1JM7B 3N9OA 3ZNIA 2L75A 3RPGC 2YURA 5AIUA 2KIZA 4AP4A 1U6GB 3RPGB 4ZDTA 2LDRA 5EYAF 5TABA 3O7AA 2KGGA 2CT2A 2PUYA 2YSMA 3I2DA 3LQHA 3IHPA 4NN2A 2YW8A 5TDRA 2EA6A 2L80A 4P5OB 3ZPV1 2EGPA 2D8SA 4YAXA 4CCGX 4QF2A 5H1VA 4YBTA 4LLBA 2KWKA 3O33A 3HCSA 4FK5A 5B75A 1VFYA 5G0FA 3N9LA 5DKAA 5B76A 3N9MA 3C5KA 4YATA 3U5NA 2LQ6A 3KQIA 4PTBA 2JMJA 4CA1A 4ZUXU 3T7LA 3PUQA 2QIZA 3SHBA 1WFKA 3SOXA 1WEPA 2FUUA 3FL2A 1WEOA 3VK6A 5I3LA 2KR4A 3KV5A 4A4BA 2EODA 3ZVYA 2NAAA 4WZ0A 1BORA 3M99A 4TKPB 2JMDA 4YADA 1RMDA 1JM7A 3ZTGA 2VPBA 3L11A 2E6RA 1JOCA 2MA6A 3HCTA 4LK9A 5TDWA 2LV9A 1FBVA 5TRBA 5JG6A 4WZ2A 2ECVA 3T6RA 2JRJA 2VPDA 4UP5A 5B79A 2KYUA 2F6NA 4L7XA 5G04B 2RSDA 4A4CA 2MUMA 5H1TA 4LJNA 5D1MB 2I50A 2AN6A 5KH9A 3SOWA 4GNDA 2KGIA 1WEUA 5KH7A 2CSYA 3ZYQA 3U5MA 1IYMA 4B7YC 2MA5A 3GV4A 3EB5A 2MD8C 2LXPC 3ZVZB 4YBMA 1LDJB 1WENA 4O64A 2YYRA 3M63A 4W4UA 2YSJA 3MHSA 2M1RA 1VD4A 2JMIA 2KE1A 3O35A 3PHDA 4LKAA 2M3HA 4AVXA 3RTRB 1E4UA 2HDPA 1MM3A 1T1HA 1WILA 3KV6A 1WESA 2KREA 1WGMA 2H0DA 4WZ3B 5KH3A 4AUQB 3N9QA 2ECIA 2LGGA 2LRIC 4C9ZA 4UP0A 3O34A 5C11A 2Y1NA 5FEYA 2FUIA 1HYJA 2G45A 3V43A 2VJFB 5TBNA 5G05B 5B78A 1VYXA 4L58A 3LQIA 4IC2A 2LN0A 2YQLA 2L0BA 2H0DB 4I7BA 2IDAA 4S3OC 4FJCA 4FO9A 4S3OB 2UZGA 5H1UA 2CSZA 4LADB 5FB0A 5LKTA 3N9PA 3O36A 4BHWA 4Q6FA 2M85A 3N9NA 1X4UA 4V3KC 4ZQLA 2KWOA 3GL6A 4X3GA 5FERA 1Z6UA 2KU3A 1F62A 2YHNA 2LGLA 3KNVA 3ZPVE 2KFTA 5FB1A 2OXQC 4I7DA 2F6JA 2YHOA 2L5UA 1WEWA 2ZETC 4A49A 4GNGA 2MT5A 5B8DA 2CKLB 2VPEA 2G6QA 1WEVA 4GNEA 5H9MA 2ECNA 4WA6A 2QJ0A 2XEUA 3O70A 2YU4A 1G25A 2ECJA 5D1LB 4YABA 5AITA 5LKZA 2PNXA 4MVTA 5LKXA 2VJFA 1X4JA 3U5PA 4N4FA 2MNYA 3M62A 2LGVA 2YUCA 1WE9A 5C13A 5D1KB 4A0CD 4I7CA 5LCWB 4AYCB 4YC9A 3L1ZB 2QICA 2XB1A 3LRQA 3HCUA 4XI1A 3ASLA 3QZVA 4IC3A 2VJEB 1WEQA 4R7EA 1WIMA 1V87A 4YBSA 2ECTA 1WEEA 4R8PK 1WEMA 3NG2A 2VNFA 2LXHC 2Y43A 3C6WA 2VP7A 3PURA 2ECGA 2BAYA 1LDKC 2MIQA 3DPLR 2ECWA 2KWNA 2K1JA 4V3LC 1X4IA 4UI9B 2DX8A 1HYIA 4F52B 2L43A 5B77A 1K2FA 2K4DA 1FP0A 2K16A 2G43A 1MM2A 3EB6A 2CKLA 4MSXA 1DVPA 4N3WA 3DQVR 5DINA 2Y1MA 2VPGA 2YQMA 1N87A 2M6MA 4B86C 2E6SA 5J3XA 3O37A 2KWJA 2YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTK C;  2K17 A;  3SOU A;  1Z2Q A;  4QF3 A;  2YT5 A;  2HYE D;  5LKU A;  2C2L A;  4PPE A;  3LQJ A;  2C2V S;  4R2Y A;  1ZBD B;  2F42 A;  2LGK A;  4BBQ A;  2RI7 A;  2MNZ A;  4AYC A;  1Z60 A;  3MHH A;  4FIP A;  1CHC A;  2FSA A;  4GB0 A;  3U5O A;  2VJE A;  2MD7 B;  4GNF A;  1XWH A;  3L1X A;  1JM7 B;  3N9O A;  3ZNI A;  2L75 A;  3RPG C;  2YUR A;  5AIU A;  2KIZ A;  4AP4 A;  1U6G B;  3RPG B;  4ZDT A;  2LDR A;  5EYA F;  5TAB A;  3O7A A;  2KGG A;  2CT2 A;  2PUY A;  2YSM A;  3I2D A;  3LQH A;  3IHP A;  4NN2 A;  2YW8 A;  5TDR A;  2EA6 A;  2L80 A;  4P5O B;  3ZPV 1;  2EGP A;  2D8S A;  4YAX A;  4CCG X;  4QF2 A;  5H1V A;  4YBT A;  4LLB A;  2KWK A;  3O33 A;  3HCS A;  4FK5 A;  5B75 A;  1VFY A;  5G0F A;  3N9L A;  5DKA A;  5B76 A;  3N9M A;  3C5K A;  4YAT A;  3U5N A;  2LQ6 A;  3KQI A;  4PTB A;  2JMJ A;  4CA1 A;  4ZUX U;  3T7L A;  3PUQ A;  2QIZ A;  3SHB A;  1WFK A;  3SOX A;  1WEP A;  2FUU A;  3FL2 A;  1WEO A;  3VK6 A;  5I3L A;  2KR4 A;  3KV5 A;  4A4B A;  2EOD A;  3ZVY A;  2NAA A;  4WZ0 A;  1BOR A;  3M99 A;  4TKP B;  2JMD A;  4YAD A;  1RMD A;  1JM7 A;  3ZTG A;  2VPB A;  3L11 A;  2E6R A;  1JOC A;  2MA6 A;  3HCT A;  4LK9 A;  5TDW A;  2LV9 A;  1FBV A;  5TRB A;  5JG6 A;  4WZ2 A;  2ECV A;  3T6R A;  2JRJ A;  2VPD A;  4UP5 A;  5B79 A;  2KYU A;  2F6N A;  4L7X A;  5G04 B;  2RSD A;  4A4C A;  2MUM A;  5H1T A;  4LJN A;  5D1M B;  2I50 A;  2AN6 A;  5KH9 A;  3SOW A;  4GND A;  2KGI A;  1WEU A;  5KH7 A;  2CSY A;  3ZYQ A;  3U5M A;  1IYM A;  4B7Y C;  2MA5 A;  3GV4 A;  3EB5 A;  2MD8 C;  2LXP C;  3ZVZ B;  4YBM A;  1LDJ B;  1WEN A;  4O64 A;  2YYR A;  3M63 A;  4W4U A;  2YSJ A;  3MHS A;  2M1R A;  1VD4 A;  2JMI A;  2KE1 A;  3O35 A;  3PHD A;  4LKA A;  2M3H A;  4AVX A;  3RTR B;  1E4U A;  2HDP A;  1MM3 A;  1T1H A;  1WIL A;  3KV6 A;  1WES A;  2KRE A;  1WGM A;  2H0D A;  4WZ3 B;  5KH3 A;  4AUQ B;  3N9Q A;  2ECI A;  2LGG A;  2LRI C;  4C9Z A;  4UP0 A;  3O34 A;  5C11 A;  2Y1N A;  5FEY A;  2FUI A;  1HYJ A;  2G45 A;  3V43 A;  2VJF B;  5TBN A;  5G05 B;  5B78 A;  1VYX A;  4L58 A;  3LQI A;  4IC2 A;  2LN0 A;  2YQL A;  2L0B A;  2H0D B;  4I7B A;  2IDA A;  4S3O C;  4FJC A;  4FO9 A;  4S3O B;  2UZG A;  5H1U A;  2CSZ A;  4LAD B;  5FB0 A;  5LKT A;  3N9P A;  3O36 A;  4BHW A;  4Q6F A;  2M85 A;  3N9N A;  1X4U A;  4V3K C;  4ZQL A;  2KWO A;  3GL6 A;  4X3G A;  5FER A;  1Z6U A;  2KU3 A;  1F62 A;  2YHN A;  2LGL A;  3KNV A;  3ZPV E;  2KFT A;  5FB1 A;  2OXQ C;  4I7D A;  2F6J A;  2YHO A;  2L5U A;  1WEW A;  2ZET C;  4A49 A;  4GNG A;  2MT5 A;  5B8D A;  2CKL B;  2VPE A;  2G6Q A;  1WEV A;  4GNE A;  5H9M A;  2ECN A;  4WA6 A;  2QJ0 A;  2XEU A;  3O70 A;  2YU4 A;  1G25 A;  2ECJ A;  5D1L B;  4YAB A;  5AIT A;  5LKZ A;  2PNX A;  4MVT A;  5LKX A;  2VJF A;  1X4J A;  3U5P A;  4N4F A;  2MNY A;  3M62 A;  2LGV A;  2YUC A;  1WE9 A;  5C13 A;  5D1K B;  4A0C D;  4I7C A;  5LCW B;  4AYC B;  4YC9 A;  3L1Z B;  2QIC A;  2XB1 A;  3LRQ A;  3HCU A;  4XI1 A;  3ASL A;  3QZV A;  4IC3 A;  2VJE B;  1WEQ A;  4R7E A;  1WIM A;  1V87 A;  4YBS A;  2ECT A;  1WEE A;  4R8P K;  1WEM A;  3NG2 A;  2VNF A;  2LXH C;  2Y43 A;  3C6W A;  2VP7 A;  3PUR A;  2ECG A;  2BAY A;  1LDK C;  2MIQ A;  3DPL R;  2ECW A;  2KWN A;  2K1J A;  4V3L C;  1X4I A;  4UI9 B;  2DX8 A;  1HYI A;  4F52 B;  2L43 A;  5B77 A;  1K2F A;  2K4D A;  1FP0 A;  2K16 A;  2G43 A;  1MM2 A;  3EB6 A;  2CKL A;  4MSX A;  1DVP A;  4N3W A;  3DQV R;  5DIN A;  2Y1M A;  2VPG A;  2YQM A;  1N87 A;  2M6M A;  4B86 C;  2E6S A;  5J3X A;  3O37 A;  2KWJ A;  2YRE A; 
#chains in the Genus database with same CATH topology
 3HTK C;  2K17 A;  3SOU A;  1Z2Q A;  4QF3 A;  2YT5 A;  2HYE D;  5LKU A;  2C2L A;  4PPE A;  3LQJ A;  2C2V S;  4R2Y A;  1ZBD B;  2F42 A;  2LGK A;  4BBQ A;  2RI7 A;  2MNZ A;  4AYC A;  1Z60 A;  3MHH A;  4FIP A;  1CHC A;  2FSA A;  4GB0 A;  3U5O A;  2VJE A;  2MD7 B;  2XOZ A;  5SVI B;  4GNF A;  1XWH A;  3L1X A;  1JM7 B;  2L7P A;  3N9O A;  3ZNI A;  2L75 A;  3RPG C;  2YUR A;  5AIU A;  2KIZ A;  4AP4 A;  1U6G B;  3RPG B;  4ZDT A;  2B0O E;  2LDR A;  5EYA F;  5TAB A;  3O7A A;  2KGG A;  2CT2 A;  2PUY A;  2YSM A;  3I2D A;  3LQH A;  4F1P A;  3IHP A;  4NN2 A;  2YW8 A;  5TDR A;  2EA6 A;  2L80 A;  4P5O B;  3ZPV 1;  2EGP A;  2D8S A;  4YAX A;  4CCG X;  4QF2 A;  5H1V A;  4YBT A;  4LLB A;  2KWK A;  3O33 A;  3HCS A;  4FK5 A;  5B75 A;  1VFY A;  5G0F A;  3N9L A;  5DKA A;  2CRR A;  5B76 A;  3N9M A;  3C5K A;  4YAT A;  3U5N A;  3FM8 C;  2LQ6 A;  3KQI A;  2JUN A;  4PTB A;  2JMJ A;  2FD4 A;  4CA1 A;  4ZUX U;  3T7L A;  2FFW A;  3PUQ A;  2QIZ A;  3SHB A;  1WFK A;  3SOX A;  1WEP A;  2FUU A;  3FL2 A;  1WEO A;  3VK6 A;  5I3L A;  2KR4 A;  3KV5 A;  4A4B A;  2EOD A;  3ZVY A;  2NAA A;  4WZ0 A;  1BOR A;  3M99 A;  4TKP B;  2JMD A;  4YAD A;  4OGE A;  3LVQ E;  1RMD A;  1JM7 A;  3ZTG A;  2VPB A;  3L11 A;  2E6R A;  1JOC A;  2MA6 A;  3HCT A;  4OGC A;  4LK9 A;  3DWD A;  5TDW A;  2LV9 A;  1FBV A;  2JM3 A;  5TRB A;  3JUE A;  5JG6 A;  4WZ2 A;  2ECV A;  3T6R A;  2JRJ A;  2VPD A;  4UP5 A;  5B79 A;  2KYU A;  3M7K A;  2F6N A;  2CSV A;  4L7X A;  5G04 B;  2RSD A;  4QQ4 A;  4A4C A;  2MUM A;  5H1T A;  4LJN A;  5D1M B;  2I50 A;  2AN6 A;  2KKX A;  3DDT A;  5KH9 A;  3SOW A;  4GND A;  4H9D A;  2KGI A;  2DSM A;  1WEU A;  5KH7 A;  2LAU A;  2CSY A;  3ZYQ A;  3U5M A;  1IYM A;  2CRW A;  4B7Y C;  2MA5 A;  3PLW A;  3GV4 A;  2OWA A;  2KKY A;  2YVR A;  3EB5 A;  2MD8 C;  2LXP C;  3ZVZ B;  4YBM A;  1LDJ B;  1WEN A;  4O64 A;  2YYR A;  3M63 A;  2D8U A;  4W4U A;  2YSJ A;  3MHS A;  2M1R A;  1VD4 A;  2JMI A;  2KE1 A;  3O35 A;  3PHD A;  4LKA A;  2M3H A;  4AVX A;  3RTR B;  1E4U A;  4Z0R A;  3KDE C;  2HDP A;  1MM3 A;  1T1H A;  1WIL A;  3KV6 A;  1WES A;  2KRE A;  1WGM A;  2H0D A;  2M13 A;  4WZ3 B;  5KH3 A;  2CON A;  4AUQ B;  5SVX A;  3N9Q A;  3FJU B;  3LDY A;  2ECI A;  2LGG A;  2LRI C;  4C9Z A;  4UP0 A;  2P57 A;  3O34 A;  5C11 A;  2Y1N A;  5FEY A;  2FUI A;  1HYJ A;  2G45 A;  3FAN A;  3V43 A;  2VJF B;  5TBN A;  5G05 B;  5SVY A;  5B78 A;  1VYX A;  4L58 A;  3LQI A;  4IC2 A;  2LN0 A;  3LJU X;  2YQL A;  2L0B A;  2H0D B;  4I7B A;  2IDA A;  4S3O C;  4FJC A;  4FO9 A;  4S3O B;  3E2D A;  2UZG A;  5H1U A;  2CSZ A;  4Z0O A;  4LAD B;  5FB0 A;  2RR4 A;  5LKT A;  3N9P A;  3O36 A;  4BHW A;  4Q6F A;  2M85 A;  3N9N A;  1X4U A;  4V3K C;  4ZQL A;  2KWO A;  3GL6 A;  4X3G A;  5FER A;  1Z6U A;  2KU3 A;  2DJA A;  1F62 A;  2YHN A;  2LGL A;  2MKE A;  2IQJ A;  3KNV A;  3Q1D A;  3ZPV E;  2KFT A;  5FB1 A;  2OXQ C;  4I7D A;  2F6J A;  2YHO A;  2L5U A;  1WEW A;  2ZET C;  4A49 A;  4GNG A;  2MT5 A;  5B8D A;  2CKL B;  2VPE A;  2G6Q A;  3FAO A;  1WEV A;  4GNE A;  5H9M A;  3MDB C;  2ECN A;  4WA6 A;  2QJ0 A;  2XEU A;  3O70 A;  4O62 A;  2YU4 A;  1G25 A;  2ECJ A;  5D1L B;  4YAB A;  2EGM A;  5AIT A;  5LKZ A;  2PNX A;  4MVT A;  5LKX A;  2VJF A;  1X4J A;  1DCQ A;  3U5P A;  3LVR E;  4N4F A;  2MNY A;  3M62 A;  2XOY A;  2LGV A;  2YUC A;  1WE9 A;  5C13 A;  5D1K B;  4A0C D;  4I7C A;  5LCW B;  3H7H A;  4AYC B;  4YC9 A;  3L1Z B;  2QIC A;  2XB1 A;  3LRQ A;  3HCU A;  4XI1 A;  3ASL A;  3QZV A;  4IC3 A;  2EXU A;  3O47 A;  2VJE B;  1WEQ A;  4R7E A;  1WIM A;  1V87 A;  4YBS A;  2ECT A;  1MBM A;  3FEH A;  1WEE A;  4R8P K;  1WEM A;  3NG2 A;  2E61 A;  2VNF A;  2LXH C;  2Y43 A;  3C6W A;  2VP7 A;  3PUR A;  2ECG A;  5K3Q A;  2BAY A;  1LDK C;  2MIQ A;  2XOC A;  3DPL R;  2ECW A;  2KWN A;  2K1J A;  4V3L C;  1X4I A;  4UI9 B;  3T9K A;  2DX8 A;  1HYI A;  4F52 B;  2L43 A;  2XP0 A;  5B77 A;  1K2F A;  2K4D A;  1FP0 A;  2K16 A;  2G43 A;  1MM2 A;  3EB6 A;  5SVI A;  2CKL A;  4MSX A;  1DVP A;  4N3W A;  3DQV R;  5DIN A;  2Y1M A;  2VPG A;  2YQM A;  1N87 A;  2M6M A;  4B86 C;  3SUB A;  2E6S A;  5J3X A;  3O37 A;  2KWJ A;  2YRE A; 
#chains in the Genus database with same CATH homology
 3HTK C;  2K17 A;  3SOU A;  1Z2Q A;  4QF3 A;  2YT5 A;  2HYE D;  5LKU A;  2C2L A;  4PPE A;  3LQJ A;  2C2V S;  4R2Y A;  1ZBD B;  2F42 A;  2LGK A;  4BBQ A;  2RI7 A;  2MNZ A;  4AYC A;  1Z60 A;  3MHH A;  4FIP A;  1CHC A;  2FSA A;  4GB0 A;  3U5O A;  2VJE A;  2MD7 B;  4GNF A;  1XWH A;  3L1X A;  1JM7 B;  3N9O A;  3ZNI A;  2L75 A;  3RPG C;  2YUR A;  5AIU A;  2KIZ A;  4AP4 A;  1U6G B;  3RPG B;  4ZDT A;  2LDR A;  5EYA F;  5TAB A;  3O7A A;  2KGG A;  2CT2 A;  2PUY A;  2YSM A;  3I2D A;  3LQH A;  3IHP A;  4NN2 A;  2YW8 A;  5TDR A;  2EA6 A;  2L80 A;  4P5O B;  3ZPV 1;  2EGP A;  2D8S A;  4YAX A;  4CCG X;  4QF2 A;  5H1V A;  4YBT A;  4LLB A;  2KWK A;  3O33 A;  3HCS A;  4FK5 A;  5B75 A;  1VFY A;  5G0F A;  3N9L A;  5DKA A;  5B76 A;  3N9M A;  3C5K A;  4YAT A;  3U5N A;  2LQ6 A;  3KQI A;  4PTB A;  2JMJ A;  4CA1 A;  4ZUX U;  3T7L A;  3PUQ A;  2QIZ A;  3SHB A;  1WFK A;  3SOX A;  1WEP A;  2FUU A;  3FL2 A;  1WEO A;  3VK6 A;  5I3L A;  2KR4 A;  3KV5 A;  4A4B A;  2EOD A;  3ZVY A;  2NAA A;  4WZ0 A;  1BOR A;  3M99 A;  4TKP B;  2JMD A;  4YAD A;  1RMD A;  1JM7 A;  3ZTG A;  2VPB A;  3L11 A;  2E6R A;  1JOC A;  2MA6 A;  3HCT A;  4LK9 A;  5TDW A;  2LV9 A;  1FBV A;  5TRB A;  5JG6 A;  4WZ2 A;  2ECV A;  3T6R A;  2JRJ A;  2VPD A;  4UP5 A;  5B79 A;  2KYU A;  2F6N A;  4L7X A;  5G04 B;  2RSD A;  4A4C A;  2MUM A;  5H1T A;  4LJN A;  5D1M B;  2I50 A;  2AN6 A;  5KH9 A;  3SOW A;  4GND A;  2KGI A;  1WEU A;  5KH7 A;  2CSY A;  3ZYQ A;  3U5M A;  1IYM A;  4B7Y C;  2MA5 A;  3GV4 A;  3EB5 A;  2MD8 C;  2LXP C;  3ZVZ B;  4YBM A;  1LDJ B;  1WEN A;  4O64 A;  2YYR A;  3M63 A;  4W4U A;  2YSJ A;  3MHS A;  2M1R A;  1VD4 A;  2JMI A;  2KE1 A;  3O35 A;  3PHD A;  4LKA A;  2M3H A;  4AVX A;  3RTR B;  1E4U A;  2HDP A;  1MM3 A;  1T1H A;  1WIL A;  3KV6 A;  1WES A;  2KRE A;  1WGM A;  2H0D A;  4WZ3 B;  5KH3 A;  4AUQ B;  3N9Q A;  2ECI A;  2LGG A;  2LRI C;  4C9Z A;  4UP0 A;  3O34 A;  5C11 A;  2Y1N A;  5FEY A;  2FUI A;  1HYJ A;  2G45 A;  3V43 A;  2VJF B;  5TBN A;  5G05 B;  5B78 A;  1VYX A;  4L58 A;  3LQI A;  4IC2 A;  2LN0 A;  2YQL A;  2L0B A;  2H0D B;  4I7B A;  2IDA A;  4S3O C;  4FJC A;  4FO9 A;  4S3O B;  2UZG A;  5H1U A;  2CSZ A;  4LAD B;  5FB0 A;  5LKT A;  3N9P A;  3O36 A;  4BHW A;  4Q6F A;  2M85 A;  3N9N A;  1X4U A;  4V3K C;  4ZQL A;  2KWO A;  3GL6 A;  4X3G A;  5FER A;  1Z6U A;  2KU3 A;  1F62 A;  2YHN A;  2LGL A;  3KNV A;  3ZPV E;  2KFT A;  5FB1 A;  2OXQ C;  4I7D A;  2F6J A;  2YHO A;  2L5U A;  1WEW A;  2ZET C;  4A49 A;  4GNG A;  2MT5 A;  5B8D A;  2CKL B;  2VPE A;  2G6Q A;  1WEV A;  4GNE A;  5H9M A;  2ECN A;  4WA6 A;  2QJ0 A;  2XEU A;  3O70 A;  2YU4 A;  1G25 A;  2ECJ A;  5D1L B;  4YAB A;  5AIT A;  5LKZ A;  2PNX A;  4MVT A;  5LKX A;  2VJF A;  1X4J A;  3U5P A;  4N4F A;  2MNY A;  3M62 A;  2LGV A;  2YUC A;  1WE9 A;  5C13 A;  5D1K B;  4A0C D;  4I7C A;  5LCW B;  4AYC B;  4YC9 A;  3L1Z B;  2QIC A;  2XB1 A;  3LRQ A;  3HCU A;  4XI1 A;  3ASL A;  3QZV A;  4IC3 A;  2VJE B;  1WEQ A;  4R7E A;  1WIM A;  1V87 A;  4YBS A;  2ECT A;  1WEE A;  4R8P K;  1WEM A;  3NG2 A;  2VNF A;  2LXH C;  2Y43 A;  3C6W A;  2VP7 A;  3PUR A;  2ECG A;  2BAY A;  1LDK C;  2MIQ A;  3DPL R;  2ECW A;  2KWN A;  2K1J A;  4V3L C;  1X4I A;  4UI9 B;  2DX8 A;  1HYI A;  4F52 B;  2L43 A;  5B77 A;  1K2F A;  2K4D A;  1FP0 A;  2K16 A;  2G43 A;  1MM2 A;  3EB6 A;  2CKL A;  4MSX A;  1DVP A;  4N3W A;  3DQV R;  5DIN A;  2Y1M A;  2VPG A;  2YQM A;  1N87 A;  2M6M A;  4B86 C;  2E6S A;  5J3X A;  3O37 A;  2KWJ A;  2YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...