4R7EA

Structure of bre1 ring domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
DEALVEELANFRTLVYCSLCSKNWKNMAIKTCGHVFCENCCKERLAARMRKCPTCNKAFSSNDLLTVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase BRE1
publication title Structure of the yeast Bre1 RING domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 69
sequence length 69
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4r7eA00
2L75A 2KIZA 2KWOA 3O35A 3QZVA 5KH3A 4FO9A 1V87A 2LGKA 2KYUA 2VPGA 1RMDA 4MVTA 2ECJA 2ECVA 2KE1A 3N9MA 4GNFA 4YBSA 5C11A 3O37A 3IHPA 1WESA 2LV9A 2UZGA 3HCSA 4WZ0A 2LGVA 1CHCA 5DINA 5G0FA 4XI1A 3ZVZB 4FJCA 4LJNA 1WEPA 5AITA 5TDWA 4AYCB 2YSJA 2EGPA 3KQIA 3O33A 2YT5A 4ZUXU 1U6GB 3SOWA 1JM7A 2VJFA 1JOCA 5H1TA 3KV5A 2M6MA 4I7CA 1MM3A 3FL2A 3SOUA 5H9MA 1DVPA 3U5OA 2QICA 1XWHA 5B8DA 2ECNA 3N9OA 5D1KB 2MUMA 2I50A 2LXPC 2YW8A 2KWNA 2VNFA 3HCTA 1IYMA 3RPGB 2K16A 2PUYA 5C13A 1WEVA 2YSMA 3GV4A 2XEUA 1VFYA 4S3OC 3DQVR 2JMIA 2VPBA 3LQIA 3PHDA 2JMDA 3ZNIA 1MM2A 1HYJA 2YURA 2FUUA 1X4JA 3EB6A 2KWKA 5D1LB 4B86C 1N87A 4AP4A 4MSXA 1E4UA 2YQLA 3O70A 3C6WA 2KGGA 2VJEA 4F52B 1G25A 4TKPB 3MHSA 5TDRA 3RPGC 3M62A 2ECGA 4UP0A 3C5KA 1BORA 1Z60A 2Y43A 4YABA 5LCWB 2H0DB 2EODA 3KV6A 2M85A 2VPEA 1K2FA 4O64A 2OXQC 4AUQB 2G6QA 2RSDA 2DX8A 5G04B 2CT2A 5DKAA 3O36A 4ZQLA 5B79A 2KWJA 1WEMA 4S3OB 4Q6FA 2M1RA 2EA6A 1WIMA 2Y1MA 4N3WA 4LKAA 4A4BA 3EB5A 5KH7A 1HYIA 2YUCA 4A4CA 4WZ2A 3O7AA 3U5PA 3LQHA 3SHBA 2FUIA 3ASLA 4AYCA 2XB1A 2AN6A 2KGIA 3I2DA 1WILA 3PURA 1WFKA 4BBQA 4I7BA 3U5MA 1X4UA 2C2LA 2LXHC 2BAYA 2MA5A 2KU3A 2K17A 2CKLB 2RI7A 1ZBDB 1Z2QA 2NAAA 4AVXA 5FERA 1FP0A 2YHOA 2G43A 5KH9A 2QJ0A 2E6SA 2VPDA 3N9NA 4V3KC 4P5OB 2FSAA 4V3LC 4YAXA 4IC3A 5AIUA 1WEUA 2KREA 5FB0A 4IC2A 3HTKC 3L11A 4YADA 3O34A 1VYXA 3ZPV1 5LKTA 4UI9B 4L58A 5LKZA 3N9PA 4BHWA 3KNVA 5LKXA 5H1UA 4WA6A 2M3HA 5TABA 4A0CD 4R2YA 4YATA 4R7EA 2JRJA 5H1VA 2L5UA 5FB1A 4WZ3B 2D8SA 5B77A 2LRIC 2MT5A 4PPEA 2C2VS 1WE9A 4I7DA 2F6JA 4QF2A 3RTRB 2MNYA 2LGGA 4R8PK 3T7LA 3LQJA 4GB0A 4FK5A 2YREA 2LN0A 4FIPA 5FEYA 2PNXA 2YHNA 4UP5A 2E6RA 2Y1NA 5TBNA 4YBMA 1JM7B 2L0BA 3V43A 3N9QA 2VJFB 4YC9A 3PUQA 4X3GA 4B7YC 2ECWA 2H0DA 4A49A 2LQ6A 3L1ZB 3MHHA 3T6RA 2QIZA 2YQMA 1WEOA 2LGLA 2ECTA 3ZVYA 2MIQA 4CA1A 2K4DA 5EYAF 4QF3A 2G45A 5TRBA 4L7XA 4LADB 3SOXA 5JG6A 3M63A 2KFTA 5J3XA 3ZYQA 3LRQA 1Z6UA 2MD8C 1F62A 5B76A 1T1HA 5B78A 3HCUA 2HDPA 3NG2A 1X4IA 2MA6A 3ZTGA 2K1JA 2F6NA 2IDAA 2KR4A 1WEEA 2ECIA 2JMJA 3DPLR 2LDRA 3N9LA 2YYRA 4CCGX 2VP7A 1WGMA 3GL6A 3VK6A 1LDKC 4ZDTA 2CSZA 1WEWA 5B75A 4W4UA 2L43A 4GNEA 4LK9A 1LDJB 3M99A 2CKLA 3L1XA 2ZETC 2CSYA 2MNZA 5D1MB 4GNDA 3ZPVE 1VD4A 1WENA 2VJEB 4C9ZA 4NN2A 5G05B 2L80A 5LKUA 4PTBA 3U5NA 2MD7B 2F42A 4LLBA 1FBVA 4GNGA 4YBTA 1WEQA 5I3LA 4N4FA 2YU4A 2HYED
chains in the Genus database with same CATH superfamily
2L75A 2KIZA 2KWOA 3O35A 3QZVA 5KH3A 4FO9A 1V87A 2LGKA 2KYUA 2VPGA 1RMDA 4MVTA 2ECJA 2ECVA 2KE1A 3N9MA 4GNFA 4YBSA 5C11A 3LJUX 3O37A 3IHPA 1WESA 2LV9A 2UZGA 3HCSA 4WZ0A 2LGVA 1CHCA 5DINA 5G0FA 4XI1A 3ZVZB 4FJCA 4LJNA 1WEPA 5AITA 5TDWA 4AYCB 2YSJA 2EGPA 3KQIA 3O33A 2YT5A 4ZUXU 2CONA 1U6GB 2DSMA 3SOWA 1JM7A 2VJFA 1JOCA 5H1TA 3KV5A 2M6MA 4I7CA 3E2DA 1MM3A 3FL2A 3SOUA 5H9MA 1DVPA 3U5OA 2QICA 1XWHA 5B8DA 2ECNA 3N9OA 5D1KB 2MUMA 2I50A 2LXPC 2YW8A 2KWNA 2VNFA 3HCTA 1IYMA 3RPGB 2K16A 2PUYA 2FD4A 5C13A 1WEVA 2YSMA 3GV4A 2XEUA 2DJAA 1VFYA 4S3OC 3DQVR 2JMIA 2VPBA 3LQIA 3PHDA 2JMDA 3ZNIA 1MM2A 1HYJA 2YURA 2FUUA 1X4JA 3EB6A 2KWKA 3LVRE 5D1LB 4B86C 1N87A 4AP4A 4MSXA 2MKEA 1E4UA 2YQLA 3O70A 4F1PA 3C6WA 2KGGA 2VJEA 2XP0A 3KDEC 4F52B 2P57A 1G25A 4TKPB 3MHSA 2CSVA 5TDRA 2EXUA 3RPGC 3M62A 2ECGA 4UP0A 3C5KA 1BORA 2B0OE 1Z60A 2Y43A 4YABA 5LCWB 2H0DB 2EODA 3KV6A 2M85A 2VPEA 1K2FA 4O64A 2OXQC 4AUQB 2G6QA 5SVYA 2RSDA 2DX8A 5G04B 2CT2A 5DKAA 3O36A 4ZQLA 5B79A 2KWJA 1WEMA 4S3OB 4Q6FA 2M1RA 2EA6A 1WIMA 2Y1MA 4N3WA 3LDYA 4LKAA 4A4BA 2JM3A 3EB5A 5KH7A 1HYIA 2YUCA 4A4CA 3O47A 4WZ2A 3O7AA 4Z0OA 3U5PA 3LQHA 3SHBA 2FUIA 3ASLA 4AYCA 2XB1A 2AN6A 2KGIA 3I2DA 1WILA 3PURA 1WFKA 4BBQA 4I7BA 3U5MA 1X4UA 4O62A 2C2LA 2LXHC 2BAYA 2MA5A 2KU3A 2K17A 2CKLB 2RI7A 1ZBDB 1Z2QA 2NAAA 4AVXA 5SVIB 5FERA 4Z0RA 1FP0A 2LAUA 2YHOA 2G43A 5KH9A 2QJ0A 2E6SA 2VPDA 3N9NA 4H9DA 4P5OB 4V3KC 2FSAA 4V3LC 4YAXA 4IC3A 5AIUA 1WEUA 2KREA 3H7HA 5FB0A 4IC2A 3HTKC 2XOCA 3L11A 4YADA 3O34A 1VYXA 3ZPV1 4OGCA 5LKTA 4UI9B 4L58A 5LKZA 3N9PA 2E61A 3KNVA 4BHWA 5LKXA 5H1UA 4WA6A 2M3HA 2CRWA 5TABA 4A0CD 4R2YA 4YATA 4R7EA 2JRJA 5H1VA 2L5UA 5FB1A 4WZ3B 2D8SA 2KKYA 5B77A 2LRIC 2MT5A 2RR4A 4PPEA 2C2VS 1WE9A 4I7DA 2F6JA 4QF2A 3RTRB 2L7PA 5SVXA 2MNYA 3JUEA 2LGGA 3PLWA 4R8PK 3T7LA 3FAOA 3LQJA 4GB0A 4FK5A 2YREA 2LN0A 4FIPA 5FEYA 2PNXA 2YHNA 4UP5A 2E6RA 2Y1NA 2JUNA 5TBNA 4YBMA 3Q1DA 1JM7B 3M7KA 2L0BA 3V43A 3N9QA 2VJFB 4YC9A 3PUQA 4X3GA 5K3QA 4B7YC 2ECWA 2H0DA 4A49A 2LQ6A 3L1ZB 3MHHA 3T6RA 3MDBC 2QIZA 2YQMA 1WEOA 2IQJA 3DDTA 2EGMA 2LGLA 2ECTA 3ZVYA 2MIQA 3SUBA 2XOYA 2K4DA 4CA1A 5EYAF 4QF3A 2G45A 5TRBA 4L7XA 4LADB 3SOXA 5JG6A 3M63A 2KFTA 5J3XA 3ZYQA 3LRQA 1Z6UA 2MD8C 1F62A 5B76A 1T1HA 5B78A 3DWDA 3HCUA 2HDPA 3NG2A 1X4IA 2MA6A 2YVRA 3ZTGA 2K1JA 2F6NA 2IDAA 2KR4A 2XOZA 1WEEA 4QQ4A 2ECIA 2JMJA 3DPLR 2LDRA 3N9LA 4OGEA 2YYRA 4CCGX 2M13A 2VP7A 1WGMA 1DCQA 3FEHA 3FANA 3FM8C 3GL6A 3VK6A 1LDKC 4ZDTA 2CSZA 1WEWA 5B75A 4W4UA 2L43A 4GNEA 4LK9A 1LDJB 3FJUB 3M99A 2CKLA 3L1XA 2ZETC 2CSYA 2KKXA 2MNZA 1MBMA 2D8UA 5D1MB 5SVIA 4GNDA 3ZPVE 1VD4A 1WENA 2VJEB 4C9ZA 3T9KA 4NN2A 5G05B 2CRRA 2L80A 5LKUA 4PTBA 3U5NA 2MD7B 2F42A 2OWAA 4LLBA 1FBVA 4GNGA 4YBTA 3LVQE 2FFWA 1WEQA 5I3LA 4N4FA 2YU4A 2HYED
chains in the Genus database with same CATH topology
2L75A 2KIZA 2KWOA 3O35A 3QZVA 5KH3A 4FO9A 1V87A 2LGKA 2KYUA 2VPGA 1RMDA 4MVTA 2ECJA 2ECVA 2KE1A 3N9MA 4GNFA 4YBSA 5C11A 3O37A 3IHPA 1WESA 2LV9A 2UZGA 3HCSA 4WZ0A 2LGVA 1CHCA 5DINA 5G0FA 4XI1A 3ZVZB 4FJCA 4LJNA 1WEPA 5AITA 5TDWA 4AYCB 2YSJA 2EGPA 3KQIA 3O33A 2YT5A 4ZUXU 1U6GB 3SOWA 1JM7A 2VJFA 1JOCA 5H1TA 3KV5A 2M6MA 4I7CA 1MM3A 3FL2A 3SOUA 5H9MA 1DVPA 3U5OA 2QICA 1XWHA 5B8DA 2ECNA 3N9OA 5D1KB 2MUMA 2I50A 2LXPC 2YW8A 2KWNA 2VNFA 3HCTA 1IYMA 3RPGB 2K16A 2PUYA 5C13A 1WEVA 2YSMA 3GV4A 2XEUA 1VFYA 4S3OC 3DQVR 2JMIA 2VPBA 3LQIA 3PHDA 2JMDA 3ZNIA 1MM2A 1HYJA 2YURA 2FUUA 1X4JA 3EB6A 2KWKA 5D1LB 4B86C 1N87A 4AP4A 4MSXA 1E4UA 2YQLA 3O70A 3C6WA 2KGGA 2VJEA 4F52B 1G25A 4TKPB 3MHSA 5TDRA 3RPGC 3M62A 2ECGA 4UP0A 3C5KA 1BORA 1Z60A 2Y43A 4YABA 5LCWB 2H0DB 2EODA 3KV6A 2M85A 2VPEA 1K2FA 4O64A 2OXQC 4AUQB 2G6QA 2RSDA 2DX8A 5G04B 2CT2A 5DKAA 3O36A 4ZQLA 5B79A 2KWJA 1WEMA 4S3OB 4Q6FA 2M1RA 2EA6A 1WIMA 2Y1MA 4N3WA 4LKAA 4A4BA 3EB5A 5KH7A 1HYIA 2YUCA 4A4CA 4WZ2A 3O7AA 3U5PA 3LQHA 3SHBA 2FUIA 3ASLA 4AYCA 2XB1A 2AN6A 2KGIA 3I2DA 1WILA 3PURA 1WFKA 4BBQA 4I7BA 3U5MA 1X4UA 2C2LA 2LXHC 2BAYA 2MA5A 2KU3A 2K17A 2CKLB 2RI7A 1ZBDB 1Z2QA 2NAAA 4AVXA 5FERA 1FP0A 2YHOA 2G43A 5KH9A 2QJ0A 2E6SA 2VPDA 3N9NA 4V3KC 4P5OB 2FSAA 4V3LC 4YAXA 4IC3A 5AIUA 1WEUA 2KREA 5FB0A 4IC2A 3HTKC 3L11A 4YADA 3O34A 1VYXA 3ZPV1 5LKTA 4UI9B 4L58A 5LKZA 3N9PA 4BHWA 3KNVA 5LKXA 5H1UA 4WA6A 2M3HA 5TABA 4A0CD 4R2YA 4YATA 4R7EA 2JRJA 5H1VA 2L5UA 5FB1A 4WZ3B 2D8SA 5B77A 2LRIC 2MT5A 4PPEA 2C2VS 1WE9A 4I7DA 2F6JA 4QF2A 3RTRB 2MNYA 2LGGA 4R8PK 3T7LA 3LQJA 4GB0A 4FK5A 2YREA 2LN0A 4FIPA 5FEYA 2PNXA 2YHNA 4UP5A 2E6RA 2Y1NA 5TBNA 4YBMA 1JM7B 2L0BA 3V43A 3N9QA 2VJFB 4YC9A 3PUQA 4X3GA 4B7YC 2ECWA 2H0DA 4A49A 2LQ6A 3L1ZB 3MHHA 3T6RA 2QIZA 2YQMA 1WEOA 2LGLA 2ECTA 3ZVYA 2MIQA 4CA1A 2K4DA 5EYAF 4QF3A 2G45A 5TRBA 4L7XA 4LADB 3SOXA 5JG6A 3M63A 2KFTA 5J3XA 3ZYQA 3LRQA 1Z6UA 2MD8C 1F62A 5B76A 1T1HA 5B78A 3HCUA 2HDPA 3NG2A 1X4IA 2MA6A 3ZTGA 2K1JA 2F6NA 2IDAA 2KR4A 1WEEA 2ECIA 2JMJA 3DPLR 2LDRA 3N9LA 2YYRA 4CCGX 2VP7A 1WGMA 3GL6A 3VK6A 1LDKC 4ZDTA 2CSZA 1WEWA 5B75A 4W4UA 2L43A 4GNEA 4LK9A 1LDJB 3M99A 2CKLA 3L1XA 2ZETC 2CSYA 2MNZA 5D1MB 4GNDA 3ZPVE 1VD4A 1WENA 2VJEB 4C9ZA 4NN2A 5G05B 2L80A 5LKUA 4PTBA 3U5NA 2MD7B 2F42A 4LLBA 1FBVA 4GNGA 4YBTA 1WEQA 5I3LA 4N4FA 2YU4A 2HYED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L75 A;  2KIZ A;  2KWO A;  3O35 A;  3QZV A;  5KH3 A;  4FO9 A;  1V87 A;  2LGK A;  2KYU A;  2VPG A;  1RMD A;  4MVT A;  2ECJ A;  2ECV A;  2KE1 A;  3N9M A;  4GNF A;  4YBS A;  5C11 A;  3O37 A;  3IHP A;  1WES A;  2LV9 A;  2UZG A;  3HCS A;  4WZ0 A;  2LGV A;  1CHC A;  5DIN A;  5G0F A;  4XI1 A;  3ZVZ B;  4FJC A;  4LJN A;  1WEP A;  5AIT A;  5TDW A;  4AYC B;  2YSJ A;  2EGP A;  3KQI A;  3O33 A;  2YT5 A;  4ZUX U;  1U6G B;  3SOW A;  1JM7 A;  2VJF A;  1JOC A;  5H1T A;  3KV5 A;  2M6M A;  4I7C A;  1MM3 A;  3FL2 A;  3SOU A;  5H9M A;  1DVP A;  3U5O A;  2QIC A;  1XWH A;  5B8D A;  2ECN A;  3N9O A;  5D1K B;  2MUM A;  2I50 A;  2LXP C;  2YW8 A;  2KWN A;  2VNF A;  3HCT A;  1IYM A;  3RPG B;  2K16 A;  2PUY A;  5C13 A;  1WEV A;  2YSM A;  3GV4 A;  2XEU A;  1VFY A;  4S3O C;  3DQV R;  2JMI A;  2VPB A;  3LQI A;  3PHD A;  2JMD A;  3ZNI A;  1MM2 A;  1HYJ A;  2YUR A;  2FUU A;  1X4J A;  3EB6 A;  2KWK A;  5D1L B;  4B86 C;  1N87 A;  4AP4 A;  4MSX A;  1E4U A;  2YQL A;  3O70 A;  3C6W A;  2KGG A;  2VJE A;  4F52 B;  1G25 A;  4TKP B;  3MHS A;  5TDR A;  3RPG C;  3M62 A;  2ECG A;  4UP0 A;  3C5K A;  1BOR A;  1Z60 A;  2Y43 A;  4YAB A;  5LCW B;  2H0D B;  2EOD A;  3KV6 A;  2M85 A;  2VPE A;  1K2F A;  4O64 A;  2OXQ C;  4AUQ B;  2G6Q A;  2RSD A;  2DX8 A;  5G04 B;  2CT2 A;  5DKA A;  3O36 A;  4ZQL A;  5B79 A;  2KWJ A;  1WEM A;  4S3O B;  4Q6F A;  2M1R A;  2EA6 A;  1WIM A;  2Y1M A;  4N3W A;  4LKA A;  4A4B A;  3EB5 A;  5KH7 A;  1HYI A;  2YUC A;  4A4C A;  4WZ2 A;  3O7A A;  3U5P A;  3LQH A;  3SHB A;  2FUI A;  3ASL A;  4AYC A;  2XB1 A;  2AN6 A;  2KGI A;  3I2D A;  1WIL A;  3PUR A;  1WFK A;  4BBQ A;  4I7B A;  3U5M A;  1X4U A;  2C2L A;  2LXH C;  2BAY A;  2MA5 A;  2KU3 A;  2K17 A;  2CKL B;  2RI7 A;  1ZBD B;  1Z2Q A;  2NAA A;  4AVX A;  5FER A;  1FP0 A;  2YHO A;  2G43 A;  5KH9 A;  2QJ0 A;  2E6S A;  2VPD A;  3N9N A;  4V3K C;  4P5O B;  2FSA A;  4V3L C;  4YAX A;  4IC3 A;  5AIU A;  1WEU A;  2KRE A;  5FB0 A;  4IC2 A;  3HTK C;  3L11 A;  4YAD A;  3O34 A;  1VYX A;  3ZPV 1;  5LKT A;  4UI9 B;  4L58 A;  5LKZ A;  3N9P A;  4BHW A;  3KNV A;  5LKX A;  5H1U A;  4WA6 A;  2M3H A;  5TAB A;  4A0C D;  4R2Y A;  4YAT A;  4R7E A;  2JRJ A;  5H1V A;  2L5U A;  5FB1 A;  4WZ3 B;  2D8S A;  5B77 A;  2LRI C;  2MT5 A;  4PPE A;  2C2V S;  1WE9 A;  4I7D A;  2F6J A;  4QF2 A;  3RTR B;  2MNY A;  2LGG A;  4R8P K;  3T7L A;  3LQJ A;  4GB0 A;  4FK5 A;  2YRE A;  2LN0 A;  4FIP A;  5FEY A;  2PNX A;  2YHN A;  4UP5 A;  2E6R A;  2Y1N A;  5TBN A;  4YBM A;  1JM7 B;  2L0B A;  3V43 A;  3N9Q A;  2VJF B;  4YC9 A;  3PUQ A;  4X3G A;  4B7Y C;  2ECW A;  2H0D A;  4A49 A;  2LQ6 A;  3L1Z B;  3MHH A;  3T6R A;  2QIZ A;  2YQM A;  1WEO A;  2LGL A;  2ECT A;  3ZVY A;  2MIQ A;  4CA1 A;  2K4D A;  5EYA F;  4QF3 A;  2G45 A;  5TRB A;  4L7X A;  4LAD B;  3SOX A;  5JG6 A;  3M63 A;  2KFT A;  5J3X A;  3ZYQ A;  3LRQ A;  1Z6U A;  2MD8 C;  1F62 A;  5B76 A;  1T1H A;  5B78 A;  3HCU A;  2HDP A;  3NG2 A;  1X4I A;  2MA6 A;  3ZTG A;  2K1J A;  2F6N A;  2IDA A;  2KR4 A;  1WEE A;  2ECI A;  2JMJ A;  3DPL R;  2LDR A;  3N9L A;  2YYR A;  4CCG X;  2VP7 A;  1WGM A;  3GL6 A;  3VK6 A;  1LDK C;  4ZDT A;  2CSZ A;  1WEW A;  5B75 A;  4W4U A;  2L43 A;  4GNE A;  4LK9 A;  1LDJ B;  3M99 A;  2CKL A;  3L1X A;  2ZET C;  2CSY A;  2MNZ A;  5D1M B;  4GND A;  3ZPV E;  1VD4 A;  1WEN A;  2VJE B;  4C9Z A;  4NN2 A;  5G05 B;  2L80 A;  5LKU A;  4PTB A;  3U5N A;  2MD7 B;  2F42 A;  4LLB A;  1FBV A;  4GNG A;  4YBT A;  1WEQ A;  5I3L A;  4N4F A;  2YU4 A;  2HYE D; 
#chains in the Genus database with same CATH topology
 2L75 A;  2KIZ A;  2KWO A;  3O35 A;  3QZV A;  5KH3 A;  4FO9 A;  1V87 A;  2LGK A;  2KYU A;  2VPG A;  1RMD A;  4MVT A;  2ECJ A;  2ECV A;  2KE1 A;  3N9M A;  4GNF A;  4YBS A;  5C11 A;  3LJU X;  3O37 A;  3IHP A;  1WES A;  2LV9 A;  2UZG A;  3HCS A;  4WZ0 A;  2LGV A;  1CHC A;  5DIN A;  5G0F A;  4XI1 A;  3ZVZ B;  4FJC A;  4LJN A;  1WEP A;  5AIT A;  5TDW A;  4AYC B;  2YSJ A;  2EGP A;  3KQI A;  3O33 A;  2YT5 A;  4ZUX U;  2CON A;  1U6G B;  2DSM A;  3SOW A;  1JM7 A;  2VJF A;  1JOC A;  5H1T A;  3KV5 A;  2M6M A;  4I7C A;  3E2D A;  1MM3 A;  3FL2 A;  3SOU A;  5H9M A;  1DVP A;  3U5O A;  2QIC A;  1XWH A;  5B8D A;  2ECN A;  3N9O A;  5D1K B;  2MUM A;  2I50 A;  2LXP C;  2YW8 A;  2KWN A;  2VNF A;  3HCT A;  1IYM A;  3RPG B;  2K16 A;  2PUY A;  2FD4 A;  5C13 A;  1WEV A;  2YSM A;  3GV4 A;  2XEU A;  2DJA A;  1VFY A;  4S3O C;  3DQV R;  2JMI A;  2VPB A;  3LQI A;  3PHD A;  2JMD A;  3ZNI A;  1MM2 A;  1HYJ A;  2YUR A;  2FUU A;  1X4J A;  3EB6 A;  2KWK A;  3LVR E;  5D1L B;  4B86 C;  1N87 A;  4AP4 A;  4MSX A;  2MKE A;  1E4U A;  2YQL A;  3O70 A;  4F1P A;  3C6W A;  2KGG A;  2VJE A;  2XP0 A;  3KDE C;  4F52 B;  2P57 A;  1G25 A;  4TKP B;  3MHS A;  2CSV A;  5TDR A;  2EXU A;  3RPG C;  3M62 A;  2ECG A;  4UP0 A;  3C5K A;  1BOR A;  2B0O E;  1Z60 A;  2Y43 A;  4YAB A;  5LCW B;  2H0D B;  2EOD A;  3KV6 A;  2M85 A;  2VPE A;  1K2F A;  4O64 A;  2OXQ C;  4AUQ B;  2G6Q A;  5SVY A;  2RSD A;  2DX8 A;  5G04 B;  2CT2 A;  5DKA A;  3O36 A;  4ZQL A;  5B79 A;  2KWJ A;  1WEM A;  4S3O B;  4Q6F A;  2M1R A;  2EA6 A;  1WIM A;  2Y1M A;  4N3W A;  3LDY A;  4LKA A;  4A4B A;  2JM3 A;  3EB5 A;  5KH7 A;  1HYI A;  2YUC A;  4A4C A;  3O47 A;  4WZ2 A;  3O7A A;  4Z0O A;  3U5P A;  3LQH A;  3SHB A;  2FUI A;  3ASL A;  4AYC A;  2XB1 A;  2AN6 A;  2KGI A;  3I2D A;  1WIL A;  3PUR A;  1WFK A;  4BBQ A;  4I7B A;  3U5M A;  1X4U A;  4O62 A;  2C2L A;  2LXH C;  2BAY A;  2MA5 A;  2KU3 A;  2K17 A;  2CKL B;  2RI7 A;  1ZBD B;  1Z2Q A;  2NAA A;  4AVX A;  5SVI B;  5FER A;  4Z0R A;  1FP0 A;  2LAU A;  2YHO A;  2G43 A;  5KH9 A;  2QJ0 A;  2E6S A;  2VPD A;  3N9N A;  4H9D A;  4P5O B;  4V3K C;  2FSA A;  4V3L C;  4YAX A;  4IC3 A;  5AIU A;  1WEU A;  2KRE A;  3H7H A;  5FB0 A;  4IC2 A;  3HTK C;  2XOC A;  3L11 A;  4YAD A;  3O34 A;  1VYX A;  3ZPV 1;  4OGC A;  5LKT A;  4UI9 B;  4L58 A;  5LKZ A;  3N9P A;  2E61 A;  3KNV A;  4BHW A;  5LKX A;  5H1U A;  4WA6 A;  2M3H A;  2CRW A;  5TAB A;  4A0C D;  4R2Y A;  4YAT A;  4R7E A;  2JRJ A;  5H1V A;  2L5U A;  5FB1 A;  4WZ3 B;  2D8S A;  2KKY A;  5B77 A;  2LRI C;  2MT5 A;  2RR4 A;  4PPE A;  2C2V S;  1WE9 A;  4I7D A;  2F6J A;  4QF2 A;  3RTR B;  2L7P A;  5SVX A;  2MNY A;  3JUE A;  2LGG A;  3PLW A;  4R8P K;  3T7L A;  3FAO A;  3LQJ A;  4GB0 A;  4FK5 A;  2YRE A;  2LN0 A;  4FIP A;  5FEY A;  2PNX A;  2YHN A;  4UP5 A;  2E6R A;  2Y1N A;  2JUN A;  5TBN A;  4YBM A;  3Q1D A;  1JM7 B;  3M7K A;  2L0B A;  3V43 A;  3N9Q A;  2VJF B;  4YC9 A;  3PUQ A;  4X3G A;  5K3Q A;  4B7Y C;  2ECW A;  2H0D A;  4A49 A;  2LQ6 A;  3L1Z B;  3MHH A;  3T6R A;  3MDB C;  2QIZ A;  2YQM A;  1WEO A;  2IQJ A;  3DDT A;  2EGM A;  2LGL A;  2ECT A;  3ZVY A;  2MIQ A;  3SUB A;  2XOY A;  2K4D A;  4CA1 A;  5EYA F;  4QF3 A;  2G45 A;  5TRB A;  4L7X A;  4LAD B;  3SOX A;  5JG6 A;  3M63 A;  2KFT A;  5J3X A;  3ZYQ A;  3LRQ A;  1Z6U A;  2MD8 C;  1F62 A;  5B76 A;  1T1H A;  5B78 A;  3DWD A;  3HCU A;  2HDP A;  3NG2 A;  1X4I A;  2MA6 A;  2YVR A;  3ZTG A;  2K1J A;  2F6N A;  2IDA A;  2KR4 A;  2XOZ A;  1WEE A;  4QQ4 A;  2ECI A;  2JMJ A;  3DPL R;  2LDR A;  3N9L A;  4OGE A;  2YYR A;  4CCG X;  2M13 A;  2VP7 A;  1WGM A;  1DCQ A;  3FEH A;  3FAN A;  3FM8 C;  3GL6 A;  3VK6 A;  1LDK C;  4ZDT A;  2CSZ A;  1WEW A;  5B75 A;  4W4U A;  2L43 A;  4GNE A;  4LK9 A;  1LDJ B;  3FJU B;  3M99 A;  2CKL A;  3L1X A;  2ZET C;  2CSY A;  2KKX A;  2MNZ A;  1MBM A;  2D8U A;  5D1M B;  5SVI A;  4GND A;  3ZPV E;  1VD4 A;  1WEN A;  2VJE B;  4C9Z A;  3T9K A;  4NN2 A;  5G05 B;  2CRR A;  2L80 A;  5LKU A;  4PTB A;  3U5N A;  2MD7 B;  2F42 A;  2OWA A;  4LLB A;  1FBV A;  4GNG A;  4YBT A;  3LVQ E;  2FFW A;  1WEQ A;  5I3L A;  4N4F A;  2YU4 A;  2HYE D; 
#chains in the Genus database with same CATH homology
 2L75 A;  2KIZ A;  2KWO A;  3O35 A;  3QZV A;  5KH3 A;  4FO9 A;  1V87 A;  2LGK A;  2KYU A;  2VPG A;  1RMD A;  4MVT A;  2ECJ A;  2ECV A;  2KE1 A;  3N9M A;  4GNF A;  4YBS A;  5C11 A;  3O37 A;  3IHP A;  1WES A;  2LV9 A;  2UZG A;  3HCS A;  4WZ0 A;  2LGV A;  1CHC A;  5DIN A;  5G0F A;  4XI1 A;  3ZVZ B;  4FJC A;  4LJN A;  1WEP A;  5AIT A;  5TDW A;  4AYC B;  2YSJ A;  2EGP A;  3KQI A;  3O33 A;  2YT5 A;  4ZUX U;  1U6G B;  3SOW A;  1JM7 A;  2VJF A;  1JOC A;  5H1T A;  3KV5 A;  2M6M A;  4I7C A;  1MM3 A;  3FL2 A;  3SOU A;  5H9M A;  1DVP A;  3U5O A;  2QIC A;  1XWH A;  5B8D A;  2ECN A;  3N9O A;  5D1K B;  2MUM A;  2I50 A;  2LXP C;  2YW8 A;  2KWN A;  2VNF A;  3HCT A;  1IYM A;  3RPG B;  2K16 A;  2PUY A;  5C13 A;  1WEV A;  2YSM A;  3GV4 A;  2XEU A;  1VFY A;  4S3O C;  3DQV R;  2JMI A;  2VPB A;  3LQI A;  3PHD A;  2JMD A;  3ZNI A;  1MM2 A;  1HYJ A;  2YUR A;  2FUU A;  1X4J A;  3EB6 A;  2KWK A;  5D1L B;  4B86 C;  1N87 A;  4AP4 A;  4MSX A;  1E4U A;  2YQL A;  3O70 A;  3C6W A;  2KGG A;  2VJE A;  4F52 B;  1G25 A;  4TKP B;  3MHS A;  5TDR A;  3RPG C;  3M62 A;  2ECG A;  4UP0 A;  3C5K A;  1BOR A;  1Z60 A;  2Y43 A;  4YAB A;  5LCW B;  2H0D B;  2EOD A;  3KV6 A;  2M85 A;  2VPE A;  1K2F A;  4O64 A;  2OXQ C;  4AUQ B;  2G6Q A;  2RSD A;  2DX8 A;  5G04 B;  2CT2 A;  5DKA A;  3O36 A;  4ZQL A;  5B79 A;  2KWJ A;  1WEM A;  4S3O B;  4Q6F A;  2M1R A;  2EA6 A;  1WIM A;  2Y1M A;  4N3W A;  4LKA A;  4A4B A;  3EB5 A;  5KH7 A;  1HYI A;  2YUC A;  4A4C A;  4WZ2 A;  3O7A A;  3U5P A;  3LQH A;  3SHB A;  2FUI A;  3ASL A;  4AYC A;  2XB1 A;  2AN6 A;  2KGI A;  3I2D A;  1WIL A;  3PUR A;  1WFK A;  4BBQ A;  4I7B A;  3U5M A;  1X4U A;  2C2L A;  2LXH C;  2BAY A;  2MA5 A;  2KU3 A;  2K17 A;  2CKL B;  2RI7 A;  1ZBD B;  1Z2Q A;  2NAA A;  4AVX A;  5FER A;  1FP0 A;  2YHO A;  2G43 A;  5KH9 A;  2QJ0 A;  2E6S A;  2VPD A;  3N9N A;  4V3K C;  4P5O B;  2FSA A;  4V3L C;  4YAX A;  4IC3 A;  5AIU A;  1WEU A;  2KRE A;  5FB0 A;  4IC2 A;  3HTK C;  3L11 A;  4YAD A;  3O34 A;  1VYX A;  3ZPV 1;  5LKT A;  4UI9 B;  4L58 A;  5LKZ A;  3N9P A;  4BHW A;  3KNV A;  5LKX A;  5H1U A;  4WA6 A;  2M3H A;  5TAB A;  4A0C D;  4R2Y A;  4YAT A;  4R7E A;  2JRJ A;  5H1V A;  2L5U A;  5FB1 A;  4WZ3 B;  2D8S A;  5B77 A;  2LRI C;  2MT5 A;  4PPE A;  2C2V S;  1WE9 A;  4I7D A;  2F6J A;  4QF2 A;  3RTR B;  2MNY A;  2LGG A;  4R8P K;  3T7L A;  3LQJ A;  4GB0 A;  4FK5 A;  2YRE A;  2LN0 A;  4FIP A;  5FEY A;  2PNX A;  2YHN A;  4UP5 A;  2E6R A;  2Y1N A;  5TBN A;  4YBM A;  1JM7 B;  2L0B A;  3V43 A;  3N9Q A;  2VJF B;  4YC9 A;  3PUQ A;  4X3G A;  4B7Y C;  2ECW A;  2H0D A;  4A49 A;  2LQ6 A;  3L1Z B;  3MHH A;  3T6R A;  2QIZ A;  2YQM A;  1WEO A;  2LGL A;  2ECT A;  3ZVY A;  2MIQ A;  4CA1 A;  2K4D A;  5EYA F;  4QF3 A;  2G45 A;  5TRB A;  4L7X A;  4LAD B;  3SOX A;  5JG6 A;  3M63 A;  2KFT A;  5J3X A;  3ZYQ A;  3LRQ A;  1Z6U A;  2MD8 C;  1F62 A;  5B76 A;  1T1H A;  5B78 A;  3HCU A;  2HDP A;  3NG2 A;  1X4I A;  2MA6 A;  3ZTG A;  2K1J A;  2F6N A;  2IDA A;  2KR4 A;  1WEE A;  2ECI A;  2JMJ A;  3DPL R;  2LDR A;  3N9L A;  2YYR A;  4CCG X;  2VP7 A;  1WGM A;  3GL6 A;  3VK6 A;  1LDK C;  4ZDT A;  2CSZ A;  1WEW A;  5B75 A;  4W4U A;  2L43 A;  4GNE A;  4LK9 A;  1LDJ B;  3M99 A;  2CKL A;  3L1X A;  2ZET C;  2CSY A;  2MNZ A;  5D1M B;  4GND A;  3ZPV E;  1VD4 A;  1WEN A;  2VJE B;  4C9Z A;  4NN2 A;  5G05 B;  2L80 A;  5LKU A;  4PTB A;  3U5N A;  2MD7 B;  2F42 A;  4LLB A;  1FBV A;  4GNG A;  4YBT A;  1WEQ A;  5I3L A;  4N4F A;  2YU4 A;  2HYE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...