3L1XA

Crystal structure of u-box domain of human e4b ubiquitin ligase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
SDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin conjugation factor E4 B
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1xA01
2EA6A 2L0BA 2KWOA 4AVXA 3LQHA 4L7XA 2QIZA 4AYCA 2YSJA 5LKTA 1LDKC 2MNYA 4A0CD 5JG6A 2VPGA 5G04B 2MIQA 2KFTA 4IC2A 3T6RA 2YT5A 2K16A 2VJEA 1VFYA 3O33A 2JMJA 4AYCB 4B7YC 3HCTA 3ZTGA 3C6WA 2CKLA 4V3LC 4WZ3B 3DPLR 2M85A 2NAAA 2KU3A 1XWHA 2JMIA 2L43A 3KNVA 1WEPA 2YREA 1VD4A 5H1TA 2YURA 2Y1MA 5H1UA 4N3WA 3L1ZB 5AIUA 3PHDA 2VPEA 2E6SA 3IHPA 4TKPB 4FIPA 4NN2A 1BORA 3L11A 2LRIC 4BHWA 4FJCA 5H1VA 2MUMA 3LQJA 2YQMA 5FB1A 1HYIA 2UZGA 2IDAA 2JMDA 4YBMA 2FSAA 3V43A 2KIZA 2VP7A 2L5UA 4GNGA 2DX8A 2QICA 1Z6UA 2BAYA 2MNZA 4YBSA 1CHCA 1WEMA 2YHOA 5B8DA 3N9NA 1VYXA 2YYRA 4PPEA 3M62A 4PTBA 1V87A 2F42A 4F52B 4CCGX 2HDPA 2KR4A 1WGMA 5B75A 3QZVA 1MM2A 3ZPVE 2QJ0A 2CSYA 2VPBA 2G43A 3ZVZB 1T1HA 1U6GB 1DVPA 5FEYA 2KGIA 4S3OC 1MM3A 2LXHC 3U5NA 2VJEB 5TRBA 1WEUA 1X4IA 2K1JA 5B76A 5TDRA 3U5PA 3PURA 2Y43A 1WEEA 4MVTA 2KWKA 4R7EA 4V3KC 5D1KB 1WFKA 4YAXA 3HCUA 2L75A 2LN0A 5FB0A 4QF2A 3C5KA 3KV5A 1IYMA 4C9ZA 5KH7A 1ZBDB 3EB6A 4YATA 2VJFB 4ZDTA 4FK5A 4WZ2A 5B79A 4WA6A 3RTRB 3ZVYA 1F62A 2MA5A 4LLBA 4AUQB 4YADA 1RMDA 4LK9A 2G45A 4B86C 2OXQC 2LGGA 3O37A 5TABA 2E6RA 2XB1A 5TDWA 4FO9A 2KGGA 4P5OB 2YSMA 4X3GA 4R2YA 3ZYQA 1WEOA 3SHBA 1WEWA 3N9LA 1K2FA 2AN6A 2MD7B 3SOXA 2ECJA 5LKXA 2KE1A 2LGKA 3L1XA 2FUUA 4YBTA 3U5OA 5B77A 3N9OA 1FP0A 4XI1A 2I50A 2ECWA 3ZPV1 1LDJB 3GL6A 2PUYA 4GNDA 1X4JA 2K17A 5D1MB 1JOCA 4GNFA 3LRQA 1WEQA 2ECVA 2CKLB 3I2DA 4N4FA 3O7AA 2MD8C 1WILA 2C2LA 3HCSA 1WENA 4ZQLA 1Z2QA 2KREA 2M1RA 4A49A 5LKZA 2CT2A 4A4CA 3N9PA 4A4BA 2YW8A 3T7LA 3RPGC 4MSXA 2CSZA 2MA6A 5LCWB 2FUIA 4WZ0A 1G25A 5C11A 2H0DA 3FL2A 4UP0A 2VNFA 3ASLA 5AITA 3RPGB 5LKUA 1WE9A 3MHSA 3SOWA 1X4UA 2LV9A 2KYUA 3LQIA 3SOUA 2KWNA 1WIMA 4GNEA 4LKAA 3O34A 4I7BA 1JM7A 5I3LA 2JRJA 1WEVA 4W4UA 2EODA 2ECTA 3N9MA 4I7CA 5KH3A 4UI9B 3VK6A 2RSDA 5C13A 3EB5A 3KV6A 5TBNA 1N87A 2ECIA 3NG2A 4IC3A 4LADB 3HTKC 4GB0A 1JM7B 1FBVA 4CA1A 4Q6FA 5B78A 2LGLA 2HYED 2XEUA 2MT5A 5H9MA 3ZNIA 2YQLA 5D1LB 3O36A 1Z60A 4YC9A 4L58A 2G6QA 4I7DA 4QF3A 2KWJA 3DQVR 3MHHA 5DINA 4AP4A 3O70A 2RI7A 1E4UA 5J3XA 2ECGA 2YU4A 4BBQA 2PNXA 2ECNA 3PUQA 5G0FA 4ZUXU 3M63A 3N9QA 2D8SA 2H0DB 4YABA 3M99A 2M6MA 2VPDA 3U5MA 5DKAA 5FERA 3O35A 5EYAF 2LGVA 2LQ6A 2L80A 2YHNA 3KQIA 1WESA 2K4DA 2VJFA 2LDRA 5KH9A 2LXPC 2EGPA 2Y1NA 2F6NA 4O64A 2C2VS 2ZETC 5G05B 4UP5A 2YUCA 4LJNA 2F6JA 4S3OB 1HYJA 2M3HA 4R8PK 3GV4A
chains in the Genus database with same CATH superfamily
5SVXA 2EA6A 2L0BA 2KWOA 4AVXA 3LQHA 2CONA 4L7XA 2QIZA 4AYCA 2YSJA 5LKTA 1LDKC 2MNYA 4A0CD 5JG6A 2VPGA 5G04B 3FAOA 2JM3A 2MIQA 2KFTA 4IC2A 3T6RA 2YT5A 2K16A 2VJEA 1VFYA 3O33A 2JMJA 4AYCB 4B7YC 3HCTA 2M13A 3ZTGA 3C6WA 2CKLA 4V3LC 4WZ3B 5SVIB 3KDEC 2LAUA 4OGCA 3DPLR 3T9KA 2M85A 2NAAA 2KU3A 1XWHA 2JMIA 2L43A 3KNVA 3SUBA 1WEPA 2YREA 1VD4A 2XOYA 2XOCA 2YURA 5H1TA 2JUNA 2Y1MA 5H1UA 4N3WA 3L1ZB 5AIUA 3PHDA 2VPEA 2DJAA 2E6SA 3IHPA 4TKPB 4FIPA 4NN2A 1BORA 3L11A 3DDTA 2LRIC 2DSMA 4BHWA 2YVRA 4FJCA 5H1VA 2MUMA 3LQJA 2YQMA 5FB1A 1HYIA 2UZGA 2IDAA 2JMDA 4YBMA 2FSAA 3V43A 2KIZA 2VP7A 2L5UA 4GNGA 2DX8A 2QICA 2L7PA 1Z6UA 5SVIA 2BAYA 2MNZA 2D8UA 1CHCA 1WEMA 4H9DA 4YBSA 2YHOA 3LVRE 5B8DA 3DWDA 3N9NA 1VYXA 2YYRA 4PPEA 2CRWA 3M62A 4PTBA 1V87A 2F42A 4F52B 4CCGX 2HDPA 2KR4A 1WGMA 1MBMA 5B75A 3QZVA 1MM2A 3ZPVE 2QJ0A 2CSYA 2VPBA 2G43A 3ZVZB 1T1HA 1U6GB 1DVPA 5FEYA 2KGIA 4S3OC 1MM3A 2LXHC 4Z0OA 3U5NA 2VJEB 3Q1DA 5TRBA 1WEUA 1X4IA 2K1JA 5B76A 5TDRA 3U5PA 3PURA 2Y43A 1WEEA 4MVTA 2KWKA 4R7EA 4V3KC 5D1KB 2EXUA 5SVYA 1WFKA 4YAXA 3HCUA 2L75A 2LN0A 3M7KA 5FB0A 4QF2A 3C5KA 3KV5A 4QQ4A 1IYMA 4C9ZA 5KH7A 1ZBDB 3EB6A 4YATA 2VJFB 4ZDTA 4FK5A 4WZ2A 5B79A 4WA6A 3RTRB 3ZVYA 3MDBC 4O62A 2FD4A 1F62A 2MA5A 4LLBA 4AUQB 4YADA 1RMDA 4LK9A 2G45A 4B86C 2OXQC 2LGGA 3O37A 5TABA 2E6RA 2XB1A 5TDWA 4FO9A 2KGGA 4P5OB 2YSMA 4X3GA 4R2YA 3ZYQA 2CRRA 1WEOA 3SHBA 1WEWA 3N9LA 1K2FA 2AN6A 2MD7B 2E61A 3SOXA 2ECJA 5LKXA 2KE1A 2LGKA 3L1XA 2FUUA 3H7HA 4OGEA 4YBTA 3U5OA 2XP0A 5B77A 3N9OA 1FP0A 4XI1A 2I50A 2ECWA 3ZPV1 1LDJB 3GL6A 2PUYA 4GNDA 3FANA 1X4JA 2B0OE 2K17A 5D1MB 1JOCA 4GNFA 3LRQA 1WEQA 2ECVA 2CKLB 3O47A 3I2DA 3PLWA 4N4FA 3O7AA 2MD8C 1WILA 2C2LA 3HCSA 2KKYA 1WENA 2FFWA 4ZQLA 1Z2QA 2KREA 2M1RA 4A49A 5LKZA 2CT2A 4A4CA 3N9PA 4A4BA 2YW8A 2IQJA 3T7LA 3RPGC 4MSXA 2CSZA 2MA6A 5LCWB 2FUIA 4WZ0A 1G25A 5C11A 2H0DA 3FL2A 4UP0A 2VNFA 3ASLA 5AITA 3RPGB 5LKUA 1WE9A 3MHSA 3FM8C 3SOWA 1X4UA 2RR4A 2LV9A 2KYUA 3LQIA 3SOUA 2KWNA 1WIMA 4GNEA 4LKAA 3O34A 4I7BA 1JM7A 5I3LA 2JRJA 1WEVA 4W4UA 2EODA 2ECTA 3E2DA 3N9MA 4I7CA 5KH3A 4UI9B 3VK6A 2RSDA 5C13A 3EB5A 3KV6A 5TBNA 1N87A 2ECIA 3NG2A 3FJUB 4IC3A 4LADB 3HTKC 4GB0A 1JM7B 1FBVA 4CA1A 4Q6FA 5B78A 2LGLA 1DCQA 2HYED 2XEUA 2MT5A 2CSVA 5H9MA 2OWAA 3ZNIA 2EGMA 2YQLA 5D1LB 3O36A 4Z0RA 1Z60A 4F1PA 4YC9A 4L58A 2G6QA 4I7DA 4QF3A 2KKXA 2KWJA 3DQVR 3MHHA 5DINA 4AP4A 3O70A 2RI7A 3JUEA 1E4UA 5J3XA 2ECGA 2YU4A 4BBQA 2PNXA 2ECNA 3PUQA 5G0FA 3LJUX 4ZUXU 3M63A 3N9QA 2XOZA 2D8SA 2H0DB 4YABA 3M99A 3LDYA 2M6MA 2VPDA 3U5MA 5DKAA 5FERA 2MKEA 3O35A 5EYAF 2LGVA 2LQ6A 2L80A 2YHNA 3KQIA 1WESA 2K4DA 2P57A 2VJFA 2LDRA 3FEHA 5KH9A 2LXPC 2EGPA 2Y1NA 5K3QA 2F6NA 4O64A 2C2VS 2ZETC 5G05B 4UP5A 2YUCA 4LJNA 2F6JA 4S3OB 1HYJA 2M3HA 3LVQE 4R8PK 3GV4A
chains in the Genus database with same CATH topology
2EA6A 2L0BA 2KWOA 4AVXA 3LQHA 4L7XA 2QIZA 4AYCA 2YSJA 5LKTA 1LDKC 2MNYA 4A0CD 5JG6A 2VPGA 5G04B 2MIQA 2KFTA 4IC2A 3T6RA 2YT5A 2K16A 2VJEA 1VFYA 3O33A 2JMJA 4AYCB 4B7YC 3HCTA 3ZTGA 3C6WA 2CKLA 4V3LC 4WZ3B 3DPLR 2M85A 2NAAA 2KU3A 1XWHA 2JMIA 2L43A 3KNVA 1WEPA 2YREA 1VD4A 5H1TA 2YURA 2Y1MA 5H1UA 4N3WA 3L1ZB 5AIUA 3PHDA 2VPEA 2E6SA 3IHPA 4TKPB 4FIPA 4NN2A 1BORA 3L11A 2LRIC 4BHWA 4FJCA 5H1VA 2MUMA 3LQJA 2YQMA 5FB1A 1HYIA 2UZGA 2IDAA 2JMDA 4YBMA 2FSAA 3V43A 2KIZA 2VP7A 2L5UA 4GNGA 2DX8A 2QICA 1Z6UA 2BAYA 2MNZA 4YBSA 1CHCA 1WEMA 2YHOA 5B8DA 3N9NA 1VYXA 2YYRA 4PPEA 3M62A 4PTBA 1V87A 2F42A 4F52B 4CCGX 2HDPA 2KR4A 1WGMA 5B75A 3QZVA 1MM2A 3ZPVE 2QJ0A 2CSYA 2VPBA 2G43A 3ZVZB 1T1HA 1U6GB 1DVPA 5FEYA 2KGIA 4S3OC 1MM3A 2LXHC 3U5NA 2VJEB 5TRBA 1WEUA 1X4IA 2K1JA 5B76A 5TDRA 3U5PA 3PURA 2Y43A 1WEEA 4MVTA 2KWKA 4R7EA 4V3KC 5D1KB 1WFKA 4YAXA 3HCUA 2L75A 2LN0A 5FB0A 4QF2A 3C5KA 3KV5A 1IYMA 4C9ZA 5KH7A 1ZBDB 3EB6A 4YATA 2VJFB 4ZDTA 4FK5A 4WZ2A 5B79A 4WA6A 3RTRB 3ZVYA 1F62A 2MA5A 4LLBA 4AUQB 4YADA 1RMDA 4LK9A 2G45A 4B86C 2OXQC 2LGGA 3O37A 5TABA 2E6RA 2XB1A 5TDWA 4FO9A 2KGGA 4P5OB 2YSMA 4X3GA 4R2YA 3ZYQA 1WEOA 3SHBA 1WEWA 3N9LA 1K2FA 2AN6A 2MD7B 3SOXA 2ECJA 5LKXA 2KE1A 2LGKA 3L1XA 2FUUA 4YBTA 3U5OA 5B77A 3N9OA 1FP0A 4XI1A 2I50A 2ECWA 3ZPV1 1LDJB 3GL6A 2PUYA 4GNDA 1X4JA 2K17A 5D1MB 1JOCA 4GNFA 3LRQA 1WEQA 2ECVA 2CKLB 3I2DA 4N4FA 3O7AA 2MD8C 1WILA 2C2LA 3HCSA 1WENA 4ZQLA 1Z2QA 2KREA 2M1RA 4A49A 5LKZA 2CT2A 4A4CA 3N9PA 4A4BA 2YW8A 3T7LA 3RPGC 4MSXA 2CSZA 2MA6A 5LCWB 2FUIA 4WZ0A 1G25A 5C11A 2H0DA 3FL2A 4UP0A 2VNFA 3ASLA 5AITA 3RPGB 5LKUA 1WE9A 3MHSA 3SOWA 1X4UA 2LV9A 2KYUA 3LQIA 3SOUA 2KWNA 1WIMA 4GNEA 4LKAA 3O34A 4I7BA 1JM7A 5I3LA 2JRJA 1WEVA 4W4UA 2EODA 2ECTA 3N9MA 4I7CA 5KH3A 4UI9B 3VK6A 2RSDA 5C13A 3EB5A 3KV6A 5TBNA 1N87A 2ECIA 3NG2A 4IC3A 4LADB 3HTKC 4GB0A 1JM7B 1FBVA 4CA1A 4Q6FA 5B78A 2LGLA 2HYED 2XEUA 2MT5A 5H9MA 3ZNIA 2YQLA 5D1LB 3O36A 1Z60A 4YC9A 4L58A 2G6QA 4I7DA 4QF3A 2KWJA 3DQVR 3MHHA 5DINA 4AP4A 3O70A 2RI7A 1E4UA 5J3XA 2ECGA 2YU4A 4BBQA 2PNXA 2ECNA 3PUQA 5G0FA 4ZUXU 3M63A 3N9QA 2D8SA 2H0DB 4YABA 3M99A 2M6MA 2VPDA 3U5MA 5DKAA 5FERA 3O35A 5EYAF 2LGVA 2LQ6A 2L80A 2YHNA 3KQIA 1WESA 2K4DA 2VJFA 2LDRA 5KH9A 2LXPC 2EGPA 2Y1NA 2F6NA 4O64A 2C2VS 2ZETC 5G05B 4UP5A 2YUCA 4LJNA 2F6JA 4S3OB 1HYJA 2M3HA 4R8PK 3GV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA6 A;  2L0B A;  2KWO A;  4AVX A;  3LQH A;  4L7X A;  2QIZ A;  4AYC A;  2YSJ A;  5LKT A;  1LDK C;  2MNY A;  4A0C D;  5JG6 A;  2VPG A;  5G04 B;  2MIQ A;  2KFT A;  4IC2 A;  3T6R A;  2YT5 A;  2K16 A;  2VJE A;  1VFY A;  3O33 A;  2JMJ A;  4AYC B;  4B7Y C;  3HCT A;  3ZTG A;  3C6W A;  2CKL A;  4V3L C;  4WZ3 B;  3DPL R;  2M85 A;  2NAA A;  2KU3 A;  1XWH A;  2JMI A;  2L43 A;  3KNV A;  1WEP A;  2YRE A;  1VD4 A;  5H1T A;  2YUR A;  2Y1M A;  5H1U A;  4N3W A;  3L1Z B;  5AIU A;  3PHD A;  2VPE A;  2E6S A;  3IHP A;  4TKP B;  4FIP A;  4NN2 A;  1BOR A;  3L11 A;  2LRI C;  4BHW A;  4FJC A;  5H1V A;  2MUM A;  3LQJ A;  2YQM A;  5FB1 A;  1HYI A;  2UZG A;  2IDA A;  2JMD A;  4YBM A;  2FSA A;  3V43 A;  2KIZ A;  2VP7 A;  2L5U A;  4GNG A;  2DX8 A;  2QIC A;  1Z6U A;  2BAY A;  2MNZ A;  4YBS A;  1CHC A;  1WEM A;  2YHO A;  5B8D A;  3N9N A;  1VYX A;  2YYR A;  4PPE A;  3M62 A;  4PTB A;  1V87 A;  2F42 A;  4F52 B;  4CCG X;  2HDP A;  2KR4 A;  1WGM A;  5B75 A;  3QZV A;  1MM2 A;  3ZPV E;  2QJ0 A;  2CSY A;  2VPB A;  2G43 A;  3ZVZ B;  1T1H A;  1U6G B;  1DVP A;  5FEY A;  2KGI A;  4S3O C;  1MM3 A;  2LXH C;  3U5N A;  2VJE B;  5TRB A;  1WEU A;  1X4I A;  2K1J A;  5B76 A;  5TDR A;  3U5P A;  3PUR A;  2Y43 A;  1WEE A;  4MVT A;  2KWK A;  4R7E A;  4V3K C;  5D1K B;  1WFK A;  4YAX A;  3HCU A;  2L75 A;  2LN0 A;  5FB0 A;  4QF2 A;  3C5K A;  3KV5 A;  1IYM A;  4C9Z A;  5KH7 A;  1ZBD B;  3EB6 A;  4YAT A;  2VJF B;  4ZDT A;  4FK5 A;  4WZ2 A;  5B79 A;  4WA6 A;  3RTR B;  3ZVY A;  1F62 A;  2MA5 A;  4LLB A;  4AUQ B;  4YAD A;  1RMD A;  4LK9 A;  2G45 A;  4B86 C;  2OXQ C;  2LGG A;  3O37 A;  5TAB A;  2E6R A;  2XB1 A;  5TDW A;  4FO9 A;  2KGG A;  4P5O B;  2YSM A;  4X3G A;  4R2Y A;  3ZYQ A;  1WEO A;  3SHB A;  1WEW A;  3N9L A;  1K2F A;  2AN6 A;  2MD7 B;  3SOX A;  2ECJ A;  5LKX A;  2KE1 A;  2LGK A;  3L1X A;  2FUU A;  4YBT A;  3U5O A;  5B77 A;  3N9O A;  1FP0 A;  4XI1 A;  2I50 A;  2ECW A;  3ZPV 1;  1LDJ B;  3GL6 A;  2PUY A;  4GND A;  1X4J A;  2K17 A;  5D1M B;  1JOC A;  4GNF A;  3LRQ A;  1WEQ A;  2ECV A;  2CKL B;  3I2D A;  4N4F A;  3O7A A;  2MD8 C;  1WIL A;  2C2L A;  3HCS A;  1WEN A;  4ZQL A;  1Z2Q A;  2KRE A;  2M1R A;  4A49 A;  5LKZ A;  2CT2 A;  4A4C A;  3N9P A;  4A4B A;  2YW8 A;  3T7L A;  3RPG C;  4MSX A;  2CSZ A;  2MA6 A;  5LCW B;  2FUI A;  4WZ0 A;  1G25 A;  5C11 A;  2H0D A;  3FL2 A;  4UP0 A;  2VNF A;  3ASL A;  5AIT A;  3RPG B;  5LKU A;  1WE9 A;  3MHS A;  3SOW A;  1X4U A;  2LV9 A;  2KYU A;  3LQI A;  3SOU A;  2KWN A;  1WIM A;  4GNE A;  4LKA A;  3O34 A;  4I7B A;  1JM7 A;  5I3L A;  2JRJ A;  1WEV A;  4W4U A;  2EOD A;  2ECT A;  3N9M A;  4I7C A;  5KH3 A;  4UI9 B;  3VK6 A;  2RSD A;  5C13 A;  3EB5 A;  3KV6 A;  5TBN A;  1N87 A;  2ECI A;  3NG2 A;  4IC3 A;  4LAD B;  3HTK C;  4GB0 A;  1JM7 B;  1FBV A;  4CA1 A;  4Q6F A;  5B78 A;  2LGL A;  2HYE D;  2XEU A;  2MT5 A;  5H9M A;  3ZNI A;  2YQL A;  5D1L B;  3O36 A;  1Z60 A;  4YC9 A;  4L58 A;  2G6Q A;  4I7D A;  4QF3 A;  2KWJ A;  3DQV R;  3MHH A;  5DIN A;  4AP4 A;  3O70 A;  2RI7 A;  1E4U A;  5J3X A;  2ECG A;  2YU4 A;  4BBQ A;  2PNX A;  2ECN A;  3PUQ A;  5G0F A;  4ZUX U;  3M63 A;  3N9Q A;  2D8S A;  2H0D B;  4YAB A;  3M99 A;  2M6M A;  2VPD A;  3U5M A;  5DKA A;  5FER A;  3O35 A;  5EYA F;  2LGV A;  2LQ6 A;  2L80 A;  2YHN A;  3KQI A;  1WES A;  2K4D A;  2VJF A;  2LDR A;  5KH9 A;  2LXP C;  2EGP A;  2Y1N A;  2F6N A;  4O64 A;  2C2V S;  2ZET C;  5G05 B;  4UP5 A;  2YUC A;  4LJN A;  2F6J A;  4S3O B;  1HYJ A;  2M3H A;  4R8P K;  3GV4 A; 
#chains in the Genus database with same CATH topology
 5SVX A;  2EA6 A;  2L0B A;  2KWO A;  4AVX A;  3LQH A;  2CON A;  4L7X A;  2QIZ A;  4AYC A;  2YSJ A;  5LKT A;  1LDK C;  2MNY A;  4A0C D;  5JG6 A;  2VPG A;  5G04 B;  3FAO A;  2JM3 A;  2MIQ A;  2KFT A;  4IC2 A;  3T6R A;  2YT5 A;  2K16 A;  2VJE A;  1VFY A;  3O33 A;  2JMJ A;  4AYC B;  4B7Y C;  3HCT A;  2M13 A;  3ZTG A;  3C6W A;  2CKL A;  4V3L C;  4WZ3 B;  5SVI B;  3KDE C;  2LAU A;  4OGC A;  3DPL R;  3T9K A;  2M85 A;  2NAA A;  2KU3 A;  1XWH A;  2JMI A;  2L43 A;  3KNV A;  3SUB A;  1WEP A;  2YRE A;  1VD4 A;  2XOY A;  2XOC A;  2YUR A;  5H1T A;  2JUN A;  2Y1M A;  5H1U A;  4N3W A;  3L1Z B;  5AIU A;  3PHD A;  2VPE A;  2DJA A;  2E6S A;  3IHP A;  4TKP B;  4FIP A;  4NN2 A;  1BOR A;  3L11 A;  3DDT A;  2LRI C;  2DSM A;  4BHW A;  2YVR A;  4FJC A;  5H1V A;  2MUM A;  3LQJ A;  2YQM A;  5FB1 A;  1HYI A;  2UZG A;  2IDA A;  2JMD A;  4YBM A;  2FSA A;  3V43 A;  2KIZ A;  2VP7 A;  2L5U A;  4GNG A;  2DX8 A;  2QIC A;  2L7P A;  1Z6U A;  5SVI A;  2BAY A;  2MNZ A;  2D8U A;  1CHC A;  1WEM A;  4H9D A;  4YBS A;  2YHO A;  3LVR E;  5B8D A;  3DWD A;  3N9N A;  1VYX A;  2YYR A;  4PPE A;  2CRW A;  3M62 A;  4PTB A;  1V87 A;  2F42 A;  4F52 B;  4CCG X;  2HDP A;  2KR4 A;  1WGM A;  1MBM A;  5B75 A;  3QZV A;  1MM2 A;  3ZPV E;  2QJ0 A;  2CSY A;  2VPB A;  2G43 A;  3ZVZ B;  1T1H A;  1U6G B;  1DVP A;  5FEY A;  2KGI A;  4S3O C;  1MM3 A;  2LXH C;  4Z0O A;  3U5N A;  2VJE B;  3Q1D A;  5TRB A;  1WEU A;  1X4I A;  2K1J A;  5B76 A;  5TDR A;  3U5P A;  3PUR A;  2Y43 A;  1WEE A;  4MVT A;  2KWK A;  4R7E A;  4V3K C;  5D1K B;  2EXU A;  5SVY A;  1WFK A;  4YAX A;  3HCU A;  2L75 A;  2LN0 A;  3M7K A;  5FB0 A;  4QF2 A;  3C5K A;  3KV5 A;  4QQ4 A;  1IYM A;  4C9Z A;  5KH7 A;  1ZBD B;  3EB6 A;  4YAT A;  2VJF B;  4ZDT A;  4FK5 A;  4WZ2 A;  5B79 A;  4WA6 A;  3RTR B;  3ZVY A;  3MDB C;  4O62 A;  2FD4 A;  1F62 A;  2MA5 A;  4LLB A;  4AUQ B;  4YAD A;  1RMD A;  4LK9 A;  2G45 A;  4B86 C;  2OXQ C;  2LGG A;  3O37 A;  5TAB A;  2E6R A;  2XB1 A;  5TDW A;  4FO9 A;  2KGG A;  4P5O B;  2YSM A;  4X3G A;  4R2Y A;  3ZYQ A;  2CRR A;  1WEO A;  3SHB A;  1WEW A;  3N9L A;  1K2F A;  2AN6 A;  2MD7 B;  2E61 A;  3SOX A;  2ECJ A;  5LKX A;  2KE1 A;  2LGK A;  3L1X A;  2FUU A;  3H7H A;  4OGE A;  4YBT A;  3U5O A;  2XP0 A;  5B77 A;  3N9O A;  1FP0 A;  4XI1 A;  2I50 A;  2ECW A;  3ZPV 1;  1LDJ B;  3GL6 A;  2PUY A;  4GND A;  3FAN A;  1X4J A;  2B0O E;  2K17 A;  5D1M B;  1JOC A;  4GNF A;  3LRQ A;  1WEQ A;  2ECV A;  2CKL B;  3O47 A;  3I2D A;  3PLW A;  4N4F A;  3O7A A;  2MD8 C;  1WIL A;  2C2L A;  3HCS A;  2KKY A;  1WEN A;  2FFW A;  4ZQL A;  1Z2Q A;  2KRE A;  2M1R A;  4A49 A;  5LKZ A;  2CT2 A;  4A4C A;  3N9P A;  4A4B A;  2YW8 A;  2IQJ A;  3T7L A;  3RPG C;  4MSX A;  2CSZ A;  2MA6 A;  5LCW B;  2FUI A;  4WZ0 A;  1G25 A;  5C11 A;  2H0D A;  3FL2 A;  4UP0 A;  2VNF A;  3ASL A;  5AIT A;  3RPG B;  5LKU A;  1WE9 A;  3MHS A;  3FM8 C;  3SOW A;  1X4U A;  2RR4 A;  2LV9 A;  2KYU A;  3LQI A;  3SOU A;  2KWN A;  1WIM A;  4GNE A;  4LKA A;  3O34 A;  4I7B A;  1JM7 A;  5I3L A;  2JRJ A;  1WEV A;  4W4U A;  2EOD A;  2ECT A;  3E2D A;  3N9M A;  4I7C A;  5KH3 A;  4UI9 B;  3VK6 A;  2RSD A;  5C13 A;  3EB5 A;  3KV6 A;  5TBN A;  1N87 A;  2ECI A;  3NG2 A;  3FJU B;  4IC3 A;  4LAD B;  3HTK C;  4GB0 A;  1JM7 B;  1FBV A;  4CA1 A;  4Q6F A;  5B78 A;  2LGL A;  1DCQ A;  2HYE D;  2XEU A;  2MT5 A;  2CSV A;  5H9M A;  2OWA A;  3ZNI A;  2EGM A;  2YQL A;  5D1L B;  3O36 A;  4Z0R A;  1Z60 A;  4F1P A;  4YC9 A;  4L58 A;  2G6Q A;  4I7D A;  4QF3 A;  2KKX A;  2KWJ A;  3DQV R;  3MHH A;  5DIN A;  4AP4 A;  3O70 A;  2RI7 A;  3JUE A;  1E4U A;  5J3X A;  2ECG A;  2YU4 A;  4BBQ A;  2PNX A;  2ECN A;  3PUQ A;  5G0F A;  3LJU X;  4ZUX U;  3M63 A;  3N9Q A;  2XOZ A;  2D8S A;  2H0D B;  4YAB A;  3M99 A;  3LDY A;  2M6M A;  2VPD A;  3U5M A;  5DKA A;  5FER A;  2MKE A;  3O35 A;  5EYA F;  2LGV A;  2LQ6 A;  2L80 A;  2YHN A;  3KQI A;  1WES A;  2K4D A;  2P57 A;  2VJF A;  2LDR A;  3FEH A;  5KH9 A;  2LXP C;  2EGP A;  2Y1N A;  5K3Q A;  2F6N A;  4O64 A;  2C2V S;  2ZET C;  5G05 B;  4UP5 A;  2YUC A;  4LJN A;  2F6J A;  4S3O B;  1HYJ A;  2M3H A;  3LVQ E;  4R8P K;  3GV4 A; 
#chains in the Genus database with same CATH homology
 2EA6 A;  2L0B A;  2KWO A;  4AVX A;  3LQH A;  4L7X A;  2QIZ A;  4AYC A;  2YSJ A;  5LKT A;  1LDK C;  2MNY A;  4A0C D;  5JG6 A;  2VPG A;  5G04 B;  2MIQ A;  2KFT A;  4IC2 A;  3T6R A;  2YT5 A;  2K16 A;  2VJE A;  1VFY A;  3O33 A;  2JMJ A;  4AYC B;  4B7Y C;  3HCT A;  3ZTG A;  3C6W A;  2CKL A;  4V3L C;  4WZ3 B;  3DPL R;  2M85 A;  2NAA A;  2KU3 A;  1XWH A;  2JMI A;  2L43 A;  3KNV A;  1WEP A;  2YRE A;  1VD4 A;  5H1T A;  2YUR A;  2Y1M A;  5H1U A;  4N3W A;  3L1Z B;  5AIU A;  3PHD A;  2VPE A;  2E6S A;  3IHP A;  4TKP B;  4FIP A;  4NN2 A;  1BOR A;  3L11 A;  2LRI C;  4BHW A;  4FJC A;  5H1V A;  2MUM A;  3LQJ A;  2YQM A;  5FB1 A;  1HYI A;  2UZG A;  2IDA A;  2JMD A;  4YBM A;  2FSA A;  3V43 A;  2KIZ A;  2VP7 A;  2L5U A;  4GNG A;  2DX8 A;  2QIC A;  1Z6U A;  2BAY A;  2MNZ A;  4YBS A;  1CHC A;  1WEM A;  2YHO A;  5B8D A;  3N9N A;  1VYX A;  2YYR A;  4PPE A;  3M62 A;  4PTB A;  1V87 A;  2F42 A;  4F52 B;  4CCG X;  2HDP A;  2KR4 A;  1WGM A;  5B75 A;  3QZV A;  1MM2 A;  3ZPV E;  2QJ0 A;  2CSY A;  2VPB A;  2G43 A;  3ZVZ B;  1T1H A;  1U6G B;  1DVP A;  5FEY A;  2KGI A;  4S3O C;  1MM3 A;  2LXH C;  3U5N A;  2VJE B;  5TRB A;  1WEU A;  1X4I A;  2K1J A;  5B76 A;  5TDR A;  3U5P A;  3PUR A;  2Y43 A;  1WEE A;  4MVT A;  2KWK A;  4R7E A;  4V3K C;  5D1K B;  1WFK A;  4YAX A;  3HCU A;  2L75 A;  2LN0 A;  5FB0 A;  4QF2 A;  3C5K A;  3KV5 A;  1IYM A;  4C9Z A;  5KH7 A;  1ZBD B;  3EB6 A;  4YAT A;  2VJF B;  4ZDT A;  4FK5 A;  4WZ2 A;  5B79 A;  4WA6 A;  3RTR B;  3ZVY A;  1F62 A;  2MA5 A;  4LLB A;  4AUQ B;  4YAD A;  1RMD A;  4LK9 A;  2G45 A;  4B86 C;  2OXQ C;  2LGG A;  3O37 A;  5TAB A;  2E6R A;  2XB1 A;  5TDW A;  4FO9 A;  2KGG A;  4P5O B;  2YSM A;  4X3G A;  4R2Y A;  3ZYQ A;  1WEO A;  3SHB A;  1WEW A;  3N9L A;  1K2F A;  2AN6 A;  2MD7 B;  3SOX A;  2ECJ A;  5LKX A;  2KE1 A;  2LGK A;  3L1X A;  2FUU A;  4YBT A;  3U5O A;  5B77 A;  3N9O A;  1FP0 A;  4XI1 A;  2I50 A;  2ECW A;  3ZPV 1;  1LDJ B;  3GL6 A;  2PUY A;  4GND A;  1X4J A;  2K17 A;  5D1M B;  1JOC A;  4GNF A;  3LRQ A;  1WEQ A;  2ECV A;  2CKL B;  3I2D A;  4N4F A;  3O7A A;  2MD8 C;  1WIL A;  2C2L A;  3HCS A;  1WEN A;  4ZQL A;  1Z2Q A;  2KRE A;  2M1R A;  4A49 A;  5LKZ A;  2CT2 A;  4A4C A;  3N9P A;  4A4B A;  2YW8 A;  3T7L A;  3RPG C;  4MSX A;  2CSZ A;  2MA6 A;  5LCW B;  2FUI A;  4WZ0 A;  1G25 A;  5C11 A;  2H0D A;  3FL2 A;  4UP0 A;  2VNF A;  3ASL A;  5AIT A;  3RPG B;  5LKU A;  1WE9 A;  3MHS A;  3SOW A;  1X4U A;  2LV9 A;  2KYU A;  3LQI A;  3SOU A;  2KWN A;  1WIM A;  4GNE A;  4LKA A;  3O34 A;  4I7B A;  1JM7 A;  5I3L A;  2JRJ A;  1WEV A;  4W4U A;  2EOD A;  2ECT A;  3N9M A;  4I7C A;  5KH3 A;  4UI9 B;  3VK6 A;  2RSD A;  5C13 A;  3EB5 A;  3KV6 A;  5TBN A;  1N87 A;  2ECI A;  3NG2 A;  4IC3 A;  4LAD B;  3HTK C;  4GB0 A;  1JM7 B;  1FBV A;  4CA1 A;  4Q6F A;  5B78 A;  2LGL A;  2HYE D;  2XEU A;  2MT5 A;  5H9M A;  3ZNI A;  2YQL A;  5D1L B;  3O36 A;  1Z60 A;  4YC9 A;  4L58 A;  2G6Q A;  4I7D A;  4QF3 A;  2KWJ A;  3DQV R;  3MHH A;  5DIN A;  4AP4 A;  3O70 A;  2RI7 A;  1E4U A;  5J3X A;  2ECG A;  2YU4 A;  4BBQ A;  2PNX A;  2ECN A;  3PUQ A;  5G0F A;  4ZUX U;  3M63 A;  3N9Q A;  2D8S A;  2H0D B;  4YAB A;  3M99 A;  2M6M A;  2VPD A;  3U5M A;  5DKA A;  5FER A;  3O35 A;  5EYA F;  2LGV A;  2LQ6 A;  2L80 A;  2YHN A;  3KQI A;  1WES A;  2K4D A;  2VJF A;  2LDR A;  5KH9 A;  2LXP C;  2EGP A;  2Y1N A;  2F6N A;  4O64 A;  2C2V S;  2ZET C;  5G05 B;  4UP5 A;  2YUC A;  4LJN A;  2F6J A;  4S3O B;  1HYJ A;  2M3H A;  4R8P K;  3GV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...