3L1XA

Crystal structure of u-box domain of human e4b ubiquitin ligase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
b'SDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin conjugation factor E4 B
publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1xA01
2JRJA 4L58A 3KV6A 3SHBA 4YBTA 2CKLA 1LDKC 2M3HA 2KU3A 2KWKA 5LKUA 3C6WA 4P5OB 4A4BA 1JOCA 2M1RA 5D1KB 1WEEA 5B77A 3C5KA 2DX8A 4UP5A 4QF3A 3ASLA 2MA6A 5B79A 3U5OA 5KH9A 2KR4A 1Z2QA 3RPGC 4A4CA 1XWHA 5KH7A 2VP7A 2KGIA 4LLBA 5FERA 4LKAA 3FL2A 1WEMA 4L7XA 2L75A 5KH3A 1WFKA 3PURA 3LQJA 2FUUA 4V3LC 3KNVA 1WEUA 5EYAF 5G0FA 4CCGX 1HYJA 2YQLA 2MT5A 4PTBA 2PUYA 2FSAA 2KREA 5LKXA 3DPLR 3O34A 2JMIA 4Q6FA 1WIMA 2KWNA 5C11A 4YADA 4LK9A 4AYCA 5TRBA 4V3KC 4I7CA 2EODA 1JM7A 2MA5A 4AVXA 2K4DA 3MHSA 4QF2A 4LJNA 1IYMA 3N9LA 2ECWA 2Y1NA 2MUMA 3O33A 1Z60A 1HYIA 3LQIA 2YREA 4R8PK 3LRQA 1WESA 3N9MA 2KIZA 2HDPA 4GNFA 4UI9B 4TKPB 1WE9A 5H9MA 2CSYA 2RSDA 2QIZA 4N4FA 3M63A 2H0DA 4PPEA 1U6GB 2L5UA 1MM2A 3ZTGA 1WEQA 2L80A 2E6SA 2YYRA 5FEYA 1G25A 2LN0A 2G6QA 4X3GA 4S3OB 4W4UA 3N9PA 5FB1A 2IDAA 2BAYA 2ZETC 3O35A 4IC2A 4YBSA 4O64A 5TDRA 2MD8C 2YW8A 2E6RA 3M99A 5I3LA 2ECJA 2LGKA 3PUQA 2AN6A 2YT5A 3O37A 2C2LA 2YU4A 4IC3A 5DINA 2VJFA 2CKLB 3O36A 4LADB 2LXHC 3GL6A 3SOXA 1E4UA 3RTRB 4ZDTA 2VPEA 2I50A 2VPDA 3SOUA 2ECIA 3M62A 4C9ZA 3DQVR 4WZ0A 2KWJA 2Y43A 5C13A 2ECGA 3V43A 5AIUA 2RI7A 3N9QA 2QJ0A 3HCSA 1T1HA 2YSJA 4GB0A 2KGGA 1MM3A 2NAAA 1CHCA 2VPBA 2JMJA 2MNZA 3HCTA 3EB5A 2JMDA 3KQIA 3T6RA 5H1UA 1F62A 2KE1A 2ECVA 4YC9A 2YHNA 5TABA 2G43A 1X4UA 2YURA 5B78A 4YATA 4A0CD 1WEVA 5G04B 3ZVYA 2YUCA 3KV5A 4GNDA 3ZPV1 4A49A 5LKZA 2LV9A 4S3OC 5G05B 3N9OA 4FO9A 2G45A 1Z6UA 3N9NA 4F52B 4AYCB 2XEUA 3ZVZB 2EA6A 5LCWB 3U5PA 5D1LB 3QZVA 2VJEA 4I7BA 2K1JA 1N87A 2LGLA 1JM7B 2ECNA 2KWOA 2MIQA 2MD7B 5DKAA 4XI1A 1FP0A 3HCUA 1VD4A 2PNXA 2D8SA 4WZ2A 2Y1MA 2K16A 1VFYA 4BHWA 2K17A 4AP4A 4GNEA 4UP0A 2LQ6A 1WEOA 1WILA 4I7DA 2LGGA 2L0BA 3ZYQA 1X4JA 4CA1A 4NN2A 3L1XA 5J3XA 1WEWA 1WGMA 2H0DB 3IHPA 2EGPA 4AUQB 4YABA 3EB6A 4N3WA 2L43A 3L11A 3ZPVE 2HYED 5D1MB 3L1ZB 5TDWA 1LDJB 3O70A 2UZGA 4R7EA 3O7AA 2LXPC 2VJEB 4MSXA 3LQHA 5B8DA 4ZQLA 2F6NA 2M6MA 5AITA 1X4IA 4FK5A 3RPGB 1V87A 1RMDA 4WA6A 2VPGA 2CT2A 3PHDA 2YHOA 1WEPA 5LKTA 5FB0A 2LDRA 4GNGA 3MHHA 2KFTA 5B75A 2OXQC 4YAXA 4R2YA 1WENA 3VK6A 2KYUA 4ZUXU 2F42A 2YSMA 2LRIC 2VJFB 3SOWA 4FJCA 2F6JA 2CSZA 3NG2A 1FBVA 2C2VS 4WZ3B 2QICA 2VNFA 5TBNA 1K2FA 4B86C 4BBQA 4YBMA 3ZNIA 3HTKC 5H1TA 5JG6A 2ECTA 3GV4A 3U5NA 5H1VA 1BORA 2MNYA 2LGVA 3U5MA 2XB1A 1ZBDB 2YQMA 2FUIA 1VYXA 1DVPA 4B7YC 3T7LA 4MVTA 3I2DA 5B76A 4FIPA 2M85A
chains in the Genus database with same CATH superfamily
2JRJA 4L58A 3KV6A 3SHBA 4YBTA 2CKLA 1LDKC 2M3HA 2KU3A 2KWKA 5LKUA 3C6WA 4P5OB 4A4BA 1JOCA 2M1RA 5D1KB 1WEEA 4F1PA 5B77A 3C5KA 2DX8A 4UP5A 4QF3A 3ASLA 2MA6A 5B79A 3U5OA 5KH9A 2KR4A 2EXUA 1Z2QA 3RPGC 4A4CA 1XWHA 5KH7A 2VP7A 2KGIA 4LLBA 5FERA 3H7HA 4LKAA 3FL2A 1WEMA 4L7XA 2L75A 5KH3A 1WFKA 3PURA 3LQJA 2FUUA 3LVQE 4V3LC 3KNVA 1WEUA 2YVRA 5EYAF 5G0FA 4CCGX 2B0OE 1HYJA 2YQLA 2MT5A 4PTBA 2PUYA 2FSAA 2KREA 5LKXA 3DPLR 3O34A 2JMIA 4Q6FA 1MBMA 1WIMA 2KWNA 3M7KA 3O47A 3FANA 5C11A 3LVRE 4YADA 4LK9A 4AYCA 2M13A 5TRBA 4V3KC 5SVIB 4I7CA 2EODA 1JM7A 2MA5A 4AVXA 2K4DA 3MHSA 4QF2A 4LJNA 1IYMA 3N9LA 2ECWA 2Y1NA 2MUMA 3O33A 3T9KA 1Z60A 3DDTA 1HYIA 3LQIA 2YREA 4R8PK 3E2DA 3LRQA 1WESA 3N9MA 2KIZA 3JUEA 2HDPA 4GNFA 4UI9B 4TKPB 1WE9A 5H9MA 2CSYA 2RSDA 2XOYA 2QIZA 4N4FA 3M63A 2H0DA 2DSMA 4PPEA 1U6GB 2L5UA 5SVXA 3PLWA 1MM2A 3ZTGA 1WEQA 2L80A 2E6SA 2YYRA 5FEYA 1G25A 2LN0A 2G6QA 4X3GA 4S3OB 4W4UA 3N9PA 5FB1A 2IDAA 2BAYA 2ZETC 3O35A 4IC2A 3Q1DA 3FJUB 4YBSA 3DWDA 4O64A 3LDYA 5TDRA 2FFWA 2MD8C 2YW8A 2CRRA 4O62A 2E6RA 3M99A 5I3LA 2D8UA 2ECJA 2LGKA 3PUQA 2AN6A 2YT5A 3O37A 2C2LA 2YU4A 4IC3A 5DINA 2VJFA 2CKLB 3O36A 4LADB 2LXHC 2E61A 3GL6A 3SOXA 1E4UA 2P57A 2JUNA 3RTRB 2XP0A 4ZDTA 2VPEA 2I50A 2VPDA 3SOUA 2ECIA 3M62A 4C9ZA 4QQ4A 2JM3A 3DQVR 4WZ0A 2KWJA 2Y43A 5C13A 2ECGA 2CSVA 3V43A 5AIUA 2RI7A 3N9QA 2QJ0A 3HCSA 1T1HA 2YSJA 4GB0A 2KGGA 1MM3A 2NAAA 1CHCA 2VPBA 2JMJA 2MNZA 3MDBC 3HCTA 3EB5A 2JMDA 3KQIA 3T6RA 5H1UA 1F62A 2KE1A 2ECVA 4OGCA 4YC9A 2YHNA 5TABA 2G43A 1X4UA 2YURA 5B78A 4YATA 4A0CD 1WEVA 5G04B 3ZVYA 1DCQA 2YUCA 3KV5A 4GNDA 3FAOA 3ZPV1 4A49A 5LKZA 2LV9A 4S3OC 5G05B 3N9OA 4FO9A 2G45A 1Z6UA 4H9DA 3N9NA 2OWAA 4F52B 4AYCB 2XEUA 3ZVZB 2EA6A 5LCWB 3U5PA 5D1LB 3QZVA 2VJEA 4I7BA 3LJUX 2K1JA 1N87A 2LGLA 1JM7B 2KKYA 2ECNA 2KWOA 2MIQA 2MD7B 5DKAA 1FP0A 3HCUA 4XI1A 1VD4A 2PNXA 2D8SA 4WZ2A 2Y1MA 2K16A 1VFYA 4BHWA 2K17A 4AP4A 4GNEA 2EGMA 4UP0A 2LQ6A 1WEOA 1WILA 4I7DA 2LGGA 2L0BA 3ZYQA 1X4JA 4CA1A 4NN2A 3L1XA 5J3XA 2XOCA 1WEWA 1WGMA 2FD4A 2H0DB 3IHPA 2EGPA 4AUQB 2LAUA 4YABA 3EB6A 4N3WA 2L43A 3L11A 3ZPVE 2HYED 5D1MB 3L1ZB 5TDWA 2RR4A 1LDJB 3O70A 2UZGA 5SVIA 4R7EA 3O7AA 2LXPC 2VJEB 4Z0OA 3FEHA 4MSXA 3LQHA 5B8DA 4ZQLA 2F6NA 2M6MA 5AITA 1X4IA 4FK5A 3RPGB 1V87A 2XOZA 1RMDA 4WA6A 2VPGA 2CRWA 2CT2A 3PHDA 2YHOA 1WEPA 5LKTA 5FB0A 2LDRA 4GNGA 3MHHA 2KFTA 5B75A 2OXQC 4YAXA 4R2YA 1WENA 2KKXA 3VK6A 2KYUA 4ZUXU 2F42A 2YSMA 2LRIC 2VJFB 3SOWA 4FJCA 2F6JA 2CSZA 2L7PA 3NG2A 1FBVA 2C2VS 4WZ3B 2CONA 2QICA 2IQJA 2VNFA 3SUBA 5TBNA 2MKEA 3FM8C 1K2FA 4B86C 4BBQA 4YBMA 3ZNIA 3HTKC 4OGEA 5H1TA 5JG6A 2ECTA 3GV4A 3U5NA 5H1VA 1BORA 2MNYA 4Z0RA 2LGVA 3U5MA 2XB1A 1ZBDB 2YQMA 2FUIA 5K3QA 1VYXA 1DVPA 4B7YC 3T7LA 4MVTA 3I2DA 5B76A 4FIPA 2DJAA 5SVYA 3KDEC 2M85A
chains in the Genus database with same CATH topology
2JRJA 4L58A 3KV6A 3SHBA 4YBTA 2CKLA 1LDKC 2M3HA 2KU3A 2KWKA 5LKUA 3C6WA 4P5OB 4A4BA 1JOCA 2M1RA 5D1KB 1WEEA 5B77A 3C5KA 2DX8A 4UP5A 4QF3A 3ASLA 2MA6A 5B79A 3U5OA 5KH9A 2KR4A 1Z2QA 3RPGC 4A4CA 1XWHA 5KH7A 2VP7A 2KGIA 4LLBA 5FERA 4LKAA 3FL2A 1WEMA 4L7XA 2L75A 5KH3A 1WFKA 3PURA 3LQJA 2FUUA 4V3LC 3KNVA 1WEUA 5EYAF 5G0FA 4CCGX 1HYJA 2YQLA 2MT5A 4PTBA 2PUYA 2FSAA 2KREA 5LKXA 3DPLR 3O34A 2JMIA 4Q6FA 1WIMA 2KWNA 5C11A 4YADA 4LK9A 4AYCA 5TRBA 4V3KC 4I7CA 2EODA 1JM7A 2MA5A 4AVXA 2K4DA 3MHSA 4QF2A 4LJNA 1IYMA 3N9LA 2ECWA 2Y1NA 2MUMA 3O33A 1Z60A 1HYIA 3LQIA 2YREA 4R8PK 3LRQA 1WESA 3N9MA 2KIZA 2HDPA 4GNFA 4UI9B 4TKPB 1WE9A 5H9MA 2CSYA 2RSDA 2QIZA 4N4FA 3M63A 2H0DA 4PPEA 1U6GB 2L5UA 1MM2A 3ZTGA 1WEQA 2L80A 2E6SA 2YYRA 5FEYA 1G25A 2LN0A 2G6QA 4X3GA 4S3OB 4W4UA 3N9PA 5FB1A 2IDAA 2BAYA 2ZETC 3O35A 4IC2A 4YBSA 4O64A 5TDRA 2MD8C 2YW8A 2E6RA 3M99A 5I3LA 2ECJA 2LGKA 3PUQA 2AN6A 2YT5A 3O37A 2C2LA 2YU4A 4IC3A 5DINA 2VJFA 2CKLB 3O36A 4LADB 2LXHC 3GL6A 3SOXA 1E4UA 3RTRB 4ZDTA 2VPEA 2I50A 2VPDA 3SOUA 2ECIA 3M62A 4C9ZA 3DQVR 4WZ0A 2KWJA 2Y43A 5C13A 2ECGA 3V43A 5AIUA 2RI7A 3N9QA 2QJ0A 3HCSA 1T1HA 2YSJA 4GB0A 2KGGA 1MM3A 2NAAA 1CHCA 2VPBA 2JMJA 2MNZA 3HCTA 3EB5A 2JMDA 3KQIA 3T6RA 5H1UA 1F62A 2KE1A 2ECVA 4YC9A 2YHNA 5TABA 2G43A 1X4UA 2YURA 5B78A 4YATA 4A0CD 1WEVA 5G04B 3ZVYA 2YUCA 3KV5A 4GNDA 3ZPV1 4A49A 5LKZA 2LV9A 4S3OC 5G05B 3N9OA 4FO9A 2G45A 1Z6UA 3N9NA 4F52B 4AYCB 2XEUA 3ZVZB 2EA6A 5LCWB 3U5PA 5D1LB 3QZVA 2VJEA 4I7BA 2K1JA 1N87A 2LGLA 1JM7B 2ECNA 2KWOA 2MIQA 2MD7B 5DKAA 4XI1A 1FP0A 3HCUA 1VD4A 2PNXA 2D8SA 4WZ2A 2Y1MA 2K16A 1VFYA 4BHWA 2K17A 4AP4A 4GNEA 4UP0A 2LQ6A 1WEOA 1WILA 4I7DA 2LGGA 2L0BA 3ZYQA 1X4JA 4CA1A 4NN2A 3L1XA 5J3XA 1WEWA 1WGMA 2H0DB 3IHPA 2EGPA 4AUQB 4YABA 3EB6A 4N3WA 2L43A 3L11A 3ZPVE 2HYED 5D1MB 3L1ZB 5TDWA 1LDJB 3O70A 2UZGA 4R7EA 3O7AA 2LXPC 2VJEB 4MSXA 3LQHA 5B8DA 4ZQLA 2F6NA 2M6MA 5AITA 1X4IA 4FK5A 3RPGB 1V87A 1RMDA 4WA6A 2VPGA 2CT2A 3PHDA 2YHOA 1WEPA 5LKTA 5FB0A 2LDRA 4GNGA 3MHHA 2KFTA 5B75A 2OXQC 4YAXA 4R2YA 1WENA 3VK6A 2KYUA 4ZUXU 2F42A 2YSMA 2LRIC 2VJFB 3SOWA 4FJCA 2F6JA 2CSZA 3NG2A 1FBVA 2C2VS 4WZ3B 2QICA 2VNFA 5TBNA 1K2FA 4B86C 4BBQA 4YBMA 3ZNIA 3HTKC 5H1TA 5JG6A 2ECTA 3GV4A 3U5NA 5H1VA 1BORA 2MNYA 2LGVA 3U5MA 2XB1A 1ZBDB 2YQMA 2FUIA 1VYXA 1DVPA 4B7YC 3T7LA 4MVTA 3I2DA 5B76A 4FIPA 2M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRJ A;  4L58 A;  3KV6 A;  3SHB A;  4YBT A;  2CKL A;  1LDK C;  2M3H A;  2KU3 A;  2KWK A;  5LKU A;  3C6W A;  4P5O B;  4A4B A;  1JOC A;  2M1R A;  5D1K B;  1WEE A;  5B77 A;  3C5K A;  2DX8 A;  4UP5 A;  4QF3 A;  3ASL A;  2MA6 A;  5B79 A;  3U5O A;  5KH9 A;  2KR4 A;  1Z2Q A;  3RPG C;  4A4C A;  1XWH A;  5KH7 A;  2VP7 A;  2KGI A;  4LLB A;  5FER A;  4LKA A;  3FL2 A;  1WEM A;  4L7X A;  2L75 A;  5KH3 A;  1WFK A;  3PUR A;  3LQJ A;  2FUU A;  4V3L C;  3KNV A;  1WEU A;  5EYA F;  5G0F A;  4CCG X;  1HYJ A;  2YQL A;  2MT5 A;  4PTB A;  2PUY A;  2FSA A;  2KRE A;  5LKX A;  3DPL R;  3O34 A;  2JMI A;  4Q6F A;  1WIM A;  2KWN A;  5C11 A;  4YAD A;  4LK9 A;  4AYC A;  5TRB A;  4V3K C;  4I7C A;  2EOD A;  1JM7 A;  2MA5 A;  4AVX A;  2K4D A;  3MHS A;  4QF2 A;  4LJN A;  1IYM A;  3N9L A;  2ECW A;  2Y1N A;  2MUM A;  3O33 A;  1Z60 A;  1HYI A;  3LQI A;  2YRE A;  4R8P K;  3LRQ A;  1WES A;  3N9M A;  2KIZ A;  2HDP A;  4GNF A;  4UI9 B;  4TKP B;  1WE9 A;  5H9M A;  2CSY A;  2RSD A;  2QIZ A;  4N4F A;  3M63 A;  2H0D A;  4PPE A;  1U6G B;  2L5U A;  1MM2 A;  3ZTG A;  1WEQ A;  2L80 A;  2E6S A;  2YYR A;  5FEY A;  1G25 A;  2LN0 A;  2G6Q A;  4X3G A;  4S3O B;  4W4U A;  3N9P A;  5FB1 A;  2IDA A;  2BAY A;  2ZET C;  3O35 A;  4IC2 A;  4YBS A;  4O64 A;  5TDR A;  2MD8 C;  2YW8 A;  2E6R A;  3M99 A;  5I3L A;  2ECJ A;  2LGK A;  3PUQ A;  2AN6 A;  2YT5 A;  3O37 A;  2C2L A;  2YU4 A;  4IC3 A;  5DIN A;  2VJF A;  2CKL B;  3O36 A;  4LAD B;  2LXH C;  3GL6 A;  3SOX A;  1E4U A;  3RTR B;  4ZDT A;  2VPE A;  2I50 A;  2VPD A;  3SOU A;  2ECI A;  3M62 A;  4C9Z A;  3DQV R;  4WZ0 A;  2KWJ A;  2Y43 A;  5C13 A;  2ECG A;  3V43 A;  5AIU A;  2RI7 A;  3N9Q A;  2QJ0 A;  3HCS A;  1T1H A;  2YSJ A;  4GB0 A;  2KGG A;  1MM3 A;  2NAA A;  1CHC A;  2VPB A;  2JMJ A;  2MNZ A;  3HCT A;  3EB5 A;  2JMD A;  3KQI A;  3T6R A;  5H1U A;  1F62 A;  2KE1 A;  2ECV A;  4YC9 A;  2YHN A;  5TAB A;  2G43 A;  1X4U A;  2YUR A;  5B78 A;  4YAT A;  4A0C D;  1WEV A;  5G04 B;  3ZVY A;  2YUC A;  3KV5 A;  4GND A;  3ZPV 1;  4A49 A;  5LKZ A;  2LV9 A;  4S3O C;  5G05 B;  3N9O A;  4FO9 A;  2G45 A;  1Z6U A;  3N9N A;  4F52 B;  4AYC B;  2XEU A;  3ZVZ B;  2EA6 A;  5LCW B;  3U5P A;  5D1L B;  3QZV A;  2VJE A;  4I7B A;  2K1J A;  1N87 A;  2LGL A;  1JM7 B;  2ECN A;  2KWO A;  2MIQ A;  2MD7 B;  5DKA A;  4XI1 A;  1FP0 A;  3HCU A;  1VD4 A;  2PNX A;  2D8S A;  4WZ2 A;  2Y1M A;  2K16 A;  1VFY A;  4BHW A;  2K17 A;  4AP4 A;  4GNE A;  4UP0 A;  2LQ6 A;  1WEO A;  1WIL A;  4I7D A;  2LGG A;  2L0B A;  3ZYQ A;  1X4J A;  4CA1 A;  4NN2 A;  3L1X A;  5J3X A;  1WEW A;  1WGM A;  2H0D B;  3IHP A;  2EGP A;  4AUQ B;  4YAB A;  3EB6 A;  4N3W A;  2L43 A;  3L11 A;  3ZPV E;  2HYE D;  5D1M B;  3L1Z B;  5TDW A;  1LDJ B;  3O70 A;  2UZG A;  4R7E A;  3O7A A;  2LXP C;  2VJE B;  4MSX A;  3LQH A;  5B8D A;  4ZQL A;  2F6N A;  2M6M A;  5AIT A;  1X4I A;  4FK5 A;  3RPG B;  1V87 A;  1RMD A;  4WA6 A;  2VPG A;  2CT2 A;  3PHD A;  2YHO A;  1WEP A;  5LKT A;  5FB0 A;  2LDR A;  4GNG A;  3MHH A;  2KFT A;  5B75 A;  2OXQ C;  4YAX A;  4R2Y A;  1WEN A;  3VK6 A;  2KYU A;  4ZUX U;  2F42 A;  2YSM A;  2LRI C;  2VJF B;  3SOW A;  4FJC A;  2F6J A;  2CSZ A;  3NG2 A;  1FBV A;  2C2V S;  4WZ3 B;  2QIC A;  2VNF A;  5TBN A;  1K2F A;  4B86 C;  4BBQ A;  4YBM A;  3ZNI A;  3HTK C;  5H1T A;  5JG6 A;  2ECT A;  3GV4 A;  3U5N A;  5H1V A;  1BOR A;  2MNY A;  2LGV A;  3U5M A;  2XB1 A;  1ZBD B;  2YQM A;  2FUI A;  1VYX A;  1DVP A;  4B7Y C;  3T7L A;  4MVT A;  3I2D A;  5B76 A;  4FIP A;  2M85 A; 
#chains in the Genus database with same CATH topology
 2JRJ A;  4L58 A;  3KV6 A;  3SHB A;  4YBT A;  2CKL A;  1LDK C;  2M3H A;  2KU3 A;  2KWK A;  5LKU A;  3C6W A;  4P5O B;  4A4B A;  1JOC A;  2M1R A;  5D1K B;  1WEE A;  4F1P A;  5B77 A;  3C5K A;  2DX8 A;  4UP5 A;  4QF3 A;  3ASL A;  2MA6 A;  5B79 A;  3U5O A;  5KH9 A;  2KR4 A;  2EXU A;  1Z2Q A;  3RPG C;  4A4C A;  1XWH A;  5KH7 A;  2VP7 A;  2KGI A;  4LLB A;  5FER A;  3H7H A;  4LKA A;  3FL2 A;  1WEM A;  4L7X A;  2L75 A;  5KH3 A;  1WFK A;  3PUR A;  3LQJ A;  2FUU A;  3LVQ E;  4V3L C;  3KNV A;  1WEU A;  2YVR A;  5EYA F;  5G0F A;  4CCG X;  2B0O E;  1HYJ A;  2YQL A;  2MT5 A;  4PTB A;  2PUY A;  2FSA A;  2KRE A;  5LKX A;  3DPL R;  3O34 A;  2JMI A;  4Q6F A;  1MBM A;  1WIM A;  2KWN A;  3M7K A;  3O47 A;  3FAN A;  5C11 A;  3LVR E;  4YAD A;  4LK9 A;  4AYC A;  2M13 A;  5TRB A;  4V3K C;  5SVI B;  4I7C A;  2EOD A;  1JM7 A;  2MA5 A;  4AVX A;  2K4D A;  3MHS A;  4QF2 A;  4LJN A;  1IYM A;  3N9L A;  2ECW A;  2Y1N A;  2MUM A;  3O33 A;  3T9K A;  1Z60 A;  3DDT A;  1HYI A;  3LQI A;  2YRE A;  4R8P K;  3E2D A;  3LRQ A;  1WES A;  3N9M A;  2KIZ A;  3JUE A;  2HDP A;  4GNF A;  4UI9 B;  4TKP B;  1WE9 A;  5H9M A;  2CSY A;  2RSD A;  2XOY A;  2QIZ A;  4N4F A;  3M63 A;  2H0D A;  2DSM A;  4PPE A;  1U6G B;  2L5U A;  5SVX A;  3PLW A;  1MM2 A;  3ZTG A;  1WEQ A;  2L80 A;  2E6S A;  2YYR A;  5FEY A;  1G25 A;  2LN0 A;  2G6Q A;  4X3G A;  4S3O B;  4W4U A;  3N9P A;  5FB1 A;  2IDA A;  2BAY A;  2ZET C;  3O35 A;  4IC2 A;  3Q1D A;  3FJU B;  4YBS A;  3DWD A;  4O64 A;  3LDY A;  5TDR A;  2FFW A;  2MD8 C;  2YW8 A;  2CRR A;  4O62 A;  2E6R A;  3M99 A;  5I3L A;  2D8U A;  2ECJ A;  2LGK A;  3PUQ A;  2AN6 A;  2YT5 A;  3O37 A;  2C2L A;  2YU4 A;  4IC3 A;  5DIN A;  2VJF A;  2CKL B;  3O36 A;  4LAD B;  2LXH C;  2E61 A;  3GL6 A;  3SOX A;  1E4U A;  2P57 A;  2JUN A;  3RTR B;  2XP0 A;  4ZDT A;  2VPE A;  2I50 A;  2VPD A;  3SOU A;  2ECI A;  3M62 A;  4C9Z A;  4QQ4 A;  2JM3 A;  3DQV R;  4WZ0 A;  2KWJ A;  2Y43 A;  5C13 A;  2ECG A;  2CSV A;  3V43 A;  5AIU A;  2RI7 A;  3N9Q A;  2QJ0 A;  3HCS A;  1T1H A;  2YSJ A;  4GB0 A;  2KGG A;  1MM3 A;  2NAA A;  1CHC A;  2VPB A;  2JMJ A;  2MNZ A;  3MDB C;  3HCT A;  3EB5 A;  2JMD A;  3KQI A;  3T6R A;  5H1U A;  1F62 A;  2KE1 A;  2ECV A;  4OGC A;  4YC9 A;  2YHN A;  5TAB A;  2G43 A;  1X4U A;  2YUR A;  5B78 A;  4YAT A;  4A0C D;  1WEV A;  5G04 B;  3ZVY A;  1DCQ A;  2YUC A;  3KV5 A;  4GND A;  3FAO A;  3ZPV 1;  4A49 A;  5LKZ A;  2LV9 A;  4S3O C;  5G05 B;  3N9O A;  4FO9 A;  2G45 A;  1Z6U A;  4H9D A;  3N9N A;  2OWA A;  4F52 B;  4AYC B;  2XEU A;  3ZVZ B;  2EA6 A;  5LCW B;  3U5P A;  5D1L B;  3QZV A;  2VJE A;  4I7B A;  3LJU X;  2K1J A;  1N87 A;  2LGL A;  1JM7 B;  2KKY A;  2ECN A;  2KWO A;  2MIQ A;  2MD7 B;  5DKA A;  1FP0 A;  3HCU A;  4XI1 A;  1VD4 A;  2PNX A;  2D8S A;  4WZ2 A;  2Y1M A;  2K16 A;  1VFY A;  4BHW A;  2K17 A;  4AP4 A;  4GNE A;  2EGM A;  4UP0 A;  2LQ6 A;  1WEO A;  1WIL A;  4I7D A;  2LGG A;  2L0B A;  3ZYQ A;  1X4J A;  4CA1 A;  4NN2 A;  3L1X A;  5J3X A;  2XOC A;  1WEW A;  1WGM A;  2FD4 A;  2H0D B;  3IHP A;  2EGP A;  4AUQ B;  2LAU A;  4YAB A;  3EB6 A;  4N3W A;  2L43 A;  3L11 A;  3ZPV E;  2HYE D;  5D1M B;  3L1Z B;  5TDW A;  2RR4 A;  1LDJ B;  3O70 A;  2UZG A;  5SVI A;  4R7E A;  3O7A A;  2LXP C;  2VJE B;  4Z0O A;  3FEH A;  4MSX A;  3LQH A;  5B8D A;  4ZQL A;  2F6N A;  2M6M A;  5AIT A;  1X4I A;  4FK5 A;  3RPG B;  1V87 A;  2XOZ A;  1RMD A;  4WA6 A;  2VPG A;  2CRW A;  2CT2 A;  3PHD A;  2YHO A;  1WEP A;  5LKT A;  5FB0 A;  2LDR A;  4GNG A;  3MHH A;  2KFT A;  5B75 A;  2OXQ C;  4YAX A;  4R2Y A;  1WEN A;  2KKX A;  3VK6 A;  2KYU A;  4ZUX U;  2F42 A;  2YSM A;  2LRI C;  2VJF B;  3SOW A;  4FJC A;  2F6J A;  2CSZ A;  2L7P A;  3NG2 A;  1FBV A;  2C2V S;  4WZ3 B;  2CON A;  2QIC A;  2IQJ A;  2VNF A;  3SUB A;  5TBN A;  2MKE A;  3FM8 C;  1K2F A;  4B86 C;  4BBQ A;  4YBM A;  3ZNI A;  3HTK C;  4OGE A;  5H1T A;  5JG6 A;  2ECT A;  3GV4 A;  3U5N A;  5H1V A;  1BOR A;  2MNY A;  4Z0R A;  2LGV A;  3U5M A;  2XB1 A;  1ZBD B;  2YQM A;  2FUI A;  5K3Q A;  1VYX A;  1DVP A;  4B7Y C;  3T7L A;  4MVT A;  3I2D A;  5B76 A;  4FIP A;  2DJA A;  5SVY A;  3KDE C;  2M85 A; 
#chains in the Genus database with same CATH homology
 2JRJ A;  4L58 A;  3KV6 A;  3SHB A;  4YBT A;  2CKL A;  1LDK C;  2M3H A;  2KU3 A;  2KWK A;  5LKU A;  3C6W A;  4P5O B;  4A4B A;  1JOC A;  2M1R A;  5D1K B;  1WEE A;  5B77 A;  3C5K A;  2DX8 A;  4UP5 A;  4QF3 A;  3ASL A;  2MA6 A;  5B79 A;  3U5O A;  5KH9 A;  2KR4 A;  1Z2Q A;  3RPG C;  4A4C A;  1XWH A;  5KH7 A;  2VP7 A;  2KGI A;  4LLB A;  5FER A;  4LKA A;  3FL2 A;  1WEM A;  4L7X A;  2L75 A;  5KH3 A;  1WFK A;  3PUR A;  3LQJ A;  2FUU A;  4V3L C;  3KNV A;  1WEU A;  5EYA F;  5G0F A;  4CCG X;  1HYJ A;  2YQL A;  2MT5 A;  4PTB A;  2PUY A;  2FSA A;  2KRE A;  5LKX A;  3DPL R;  3O34 A;  2JMI A;  4Q6F A;  1WIM A;  2KWN A;  5C11 A;  4YAD A;  4LK9 A;  4AYC A;  5TRB A;  4V3K C;  4I7C A;  2EOD A;  1JM7 A;  2MA5 A;  4AVX A;  2K4D A;  3MHS A;  4QF2 A;  4LJN A;  1IYM A;  3N9L A;  2ECW A;  2Y1N A;  2MUM A;  3O33 A;  1Z60 A;  1HYI A;  3LQI A;  2YRE A;  4R8P K;  3LRQ A;  1WES A;  3N9M A;  2KIZ A;  2HDP A;  4GNF A;  4UI9 B;  4TKP B;  1WE9 A;  5H9M A;  2CSY A;  2RSD A;  2QIZ A;  4N4F A;  3M63 A;  2H0D A;  4PPE A;  1U6G B;  2L5U A;  1MM2 A;  3ZTG A;  1WEQ A;  2L80 A;  2E6S A;  2YYR A;  5FEY A;  1G25 A;  2LN0 A;  2G6Q A;  4X3G A;  4S3O B;  4W4U A;  3N9P A;  5FB1 A;  2IDA A;  2BAY A;  2ZET C;  3O35 A;  4IC2 A;  4YBS A;  4O64 A;  5TDR A;  2MD8 C;  2YW8 A;  2E6R A;  3M99 A;  5I3L A;  2ECJ A;  2LGK A;  3PUQ A;  2AN6 A;  2YT5 A;  3O37 A;  2C2L A;  2YU4 A;  4IC3 A;  5DIN A;  2VJF A;  2CKL B;  3O36 A;  4LAD B;  2LXH C;  3GL6 A;  3SOX A;  1E4U A;  3RTR B;  4ZDT A;  2VPE A;  2I50 A;  2VPD A;  3SOU A;  2ECI A;  3M62 A;  4C9Z A;  3DQV R;  4WZ0 A;  2KWJ A;  2Y43 A;  5C13 A;  2ECG A;  3V43 A;  5AIU A;  2RI7 A;  3N9Q A;  2QJ0 A;  3HCS A;  1T1H A;  2YSJ A;  4GB0 A;  2KGG A;  1MM3 A;  2NAA A;  1CHC A;  2VPB A;  2JMJ A;  2MNZ A;  3HCT A;  3EB5 A;  2JMD A;  3KQI A;  3T6R A;  5H1U A;  1F62 A;  2KE1 A;  2ECV A;  4YC9 A;  2YHN A;  5TAB A;  2G43 A;  1X4U A;  2YUR A;  5B78 A;  4YAT A;  4A0C D;  1WEV A;  5G04 B;  3ZVY A;  2YUC A;  3KV5 A;  4GND A;  3ZPV 1;  4A49 A;  5LKZ A;  2LV9 A;  4S3O C;  5G05 B;  3N9O A;  4FO9 A;  2G45 A;  1Z6U A;  3N9N A;  4F52 B;  4AYC B;  2XEU A;  3ZVZ B;  2EA6 A;  5LCW B;  3U5P A;  5D1L B;  3QZV A;  2VJE A;  4I7B A;  2K1J A;  1N87 A;  2LGL A;  1JM7 B;  2ECN A;  2KWO A;  2MIQ A;  2MD7 B;  5DKA A;  4XI1 A;  1FP0 A;  3HCU A;  1VD4 A;  2PNX A;  2D8S A;  4WZ2 A;  2Y1M A;  2K16 A;  1VFY A;  4BHW A;  2K17 A;  4AP4 A;  4GNE A;  4UP0 A;  2LQ6 A;  1WEO A;  1WIL A;  4I7D A;  2LGG A;  2L0B A;  3ZYQ A;  1X4J A;  4CA1 A;  4NN2 A;  3L1X A;  5J3X A;  1WEW A;  1WGM A;  2H0D B;  3IHP A;  2EGP A;  4AUQ B;  4YAB A;  3EB6 A;  4N3W A;  2L43 A;  3L11 A;  3ZPV E;  2HYE D;  5D1M B;  3L1Z B;  5TDW A;  1LDJ B;  3O70 A;  2UZG A;  4R7E A;  3O7A A;  2LXP C;  2VJE B;  4MSX A;  3LQH A;  5B8D A;  4ZQL A;  2F6N A;  2M6M A;  5AIT A;  1X4I A;  4FK5 A;  3RPG B;  1V87 A;  1RMD A;  4WA6 A;  2VPG A;  2CT2 A;  3PHD A;  2YHO A;  1WEP A;  5LKT A;  5FB0 A;  2LDR A;  4GNG A;  3MHH A;  2KFT A;  5B75 A;  2OXQ C;  4YAX A;  4R2Y A;  1WEN A;  3VK6 A;  2KYU A;  4ZUX U;  2F42 A;  2YSM A;  2LRI C;  2VJF B;  3SOW A;  4FJC A;  2F6J A;  2CSZ A;  3NG2 A;  1FBV A;  2C2V S;  4WZ3 B;  2QIC A;  2VNF A;  5TBN A;  1K2F A;  4B86 C;  4BBQ A;  4YBM A;  3ZNI A;  3HTK C;  5H1T A;  5JG6 A;  2ECT A;  3GV4 A;  3U5N A;  5H1V A;  1BOR A;  2MNY A;  2LGV A;  3U5M A;  2XB1 A;  1ZBD B;  2YQM A;  2FUI A;  1VYX A;  1DVP A;  4B7Y C;  3T7L A;  4MVT A;  3I2D A;  5B76 A;  4FIP A;  2M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...