3L1XA

Crystal structure of u-box domain of human e4b ubiquitin ligase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
SDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin conjugation factor E4 B
publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1xA01
4A4CA 2XEUA 4ZUXU 1WEUA 3U5MA 2E6RA 2JMDA 2K17A 3ZPV1 2KGGA 1JM7B 1HYIA 4C9ZA 2F6JA 4I7CA 2PNXA 3C5KA 4BHWA 5D1MB 2LRIC 3IHPA 3GV4A 2KWKA 2FUIA 4N4FA 2NAAA 3PURA 1CHCA 2JMJA 4YC9A 5KH9A 3EB5A 4F52B 1RMDA 2ECGA 2K16A 4FO9A 3EB6A 2M3HA 2HYED 2LN0A 4AUQB 5KH7A 4O64A 4FK5A 2H0DB 2VPGA 2QJ0A 3PHDA 2PUYA 2L80A 2YHOA 4YABA 2FUUA 2LDRA 4YBTA 4YAXA 3ZTGA 1X4UA 4A49A 2MUMA 3RPGC 4I7BA 5LKZA 2QICA 4UI9B 4B86C 1JM7A 4Q6FA 3MHSA 4FIPA 2LV9A 2M85A 2YT5A 4LJNA 2KWJA 4LK9A 1G25A 2JMIA 4GNEA 4QF2A 5LKXA 3T6RA 1WEMA 2JRJA 3FL2A 4GNGA 3QZVA 3HCUA 5H1UA 4NN2A 3O7AA 2VP7A 2LGVA 2EODA 2LGGA 3O33A 4S3OC 5AIUA 1HYJA 3O37A 3U5NA 1DVPA 3ZPVE 5H1VA 2MD8C 2LXHC 4ZDTA 1ZBDB 4P5OB 1WGMA 4LADB 1N87A 3C6WA 3N9PA 1WEOA 5G05B 4GB0A 2MA6A 2H0DA 3N9QA 2CSZA 2DX8A 2KFTA 3LQHA 5FEYA 3ZVYA 3I2DA 2G6QA 2MNYA 1BORA 2YHNA 2ECJA 5EYAF 5B79A 5FERA 1X4IA 1K2FA 3DQVR 2YSJA 2F42A 3LQJA 5TDWA 2ECVA 4L58A 3DPLR 2LGKA 1WE9A 3O70A 5G0FA 2YSMA 2F6NA 1FP0A 2KIZA 1V87A 2MT5A 4XI1A 1WEVA 5TABA 4CA1A 2VJEB 3HCSA 1Z2QA 1WENA 4TKPB 2K1JA 4N3WA 2G43A 2L43A 4V3LC 3O36A 1MM3A 4GNFA 3KNVA 3U5OA 4A4BA 3SHBA 3MHHA 5JG6A 2G45A 3HTKC 4UP5A 2CT2A 1WILA 5LCWB 2KE1A 2KWOA 1E4UA 4V3KC 2MNZA 3L1XA 5AITA 2ZETC 3U5PA 1Z60A 2BAYA 1WFKA 5FB0A 4FJCA 1LDKC 2L0BA 3L11A 1VFYA 4I7DA 3NG2A 2YU4A 5B78A 3HCTA 2VJFB 4MVTA 4PPEA 2MIQA 2M6MA 3PUQA 2YQMA 2CKLB 3N9MA 4A0CD 4LKAA 2KR4A 2VPDA 3RPGB 2MA5A 2QIZA 2I50A 1JOCA 4BBQA 1U6GB 2M1RA 3SOUA 4YBSA 4WA6A 3VK6A 2ECNA 3LRQA 4UP0A 4AYCA 1FBVA 3SOWA 2VJEA 1WEQA 2L75A 3ZVZB 5C13A 3RTRB 5B8DA 4YBMA 5TBNA 4R7EA 2K4DA 2LXPC 3T7LA 4YADA 2EA6A 2LQ6A 2VNFA 2YW8A 2CSYA 2LGLA 4LLBA 2C2LA 4X3GA 2KGIA 2YREA 2XB1A 2L5UA 1MM2A 4WZ0A 1F62A 2KREA 5G04B 2ECTA 2EGPA 3ZYQA 2UZGA 4QF3A 1WIMA 5I3LA 2Y1NA 4S3OB 3O35A 4B7YC 3L1ZB 2RSDA 4WZ2A 5H9MA 3ASLA 3N9OA 1WESA 4R2YA 1WEWA 3GL6A 3M99A 4AYCB 2KU3A 2VPBA 4YATA 3O34A 1T1HA 2VJFA 4IC2A 2YYRA 5LKUA 4R8PK 4CCGX 4IC3A 2CKLA 5B76A 2D8SA 5D1KB 3V43A 3KV5A 1X4JA 2YUCA 3KQIA 1IYMA 5B77A 5KH3A 4L7XA 2YQLA 4ZQLA 2AN6A 3M63A 1XWHA 2ECIA 2Y43A 5LKTA 4PTBA 3KV6A 2KWNA 2KYUA 5TDRA 3SOXA 1WEPA 2IDAA 2HDPA 4AVXA 2Y1MA 4GNDA 5DINA 3M62A 2FSAA 2VPEA 5C11A 3N9NA 4WZ3B 4AP4A 1VD4A 5FB1A 2MD7B 5DKAA 2E6SA 1WEEA 3LQIA 4W4UA 2C2VS 5TRBA 2YURA 2RI7A 5D1LB 3N9LA 2OXQC 1VYXA 5H1TA 1LDJB 5J3XA 2ECWA 1Z6UA 5B75A 4MSXA 3ZNIA
chains in the Genus database with same CATH superfamily
2L7PA 4A4CA 2XEUA 4ZUXU 1WEUA 2D8UA 3U5MA 2E6RA 3DDTA 2JMDA 2K17A 3ZPV1 2KGGA 1JM7B 1HYIA 4C9ZA 2XP0A 2F6JA 4I7CA 2PNXA 2KKYA 3C5KA 4BHWA 5D1MB 5K3QA 2LRIC 4QQ4A 3IHPA 3GV4A 2KWKA 5SVXA 2FUIA 5SVIA 4N4FA 2NAAA 3PURA 2FD4A 1CHCA 2JMJA 4YC9A 5KH9A 4H9DA 3EB5A 4F52B 1RMDA 2ECGA 2K16A 2DSMA 4FO9A 3EB6A 2M3HA 2HYED 1MBMA 2LN0A 4Z0OA 4AUQB 5KH7A 4O64A 4FK5A 2H0DB 2VPGA 2CONA 2QJ0A 3PHDA 2PUYA 2L80A 2YHOA 4YABA 3DWDA 2FUUA 2LDRA 4YBTA 4YAXA 3ZTGA 1X4UA 4A49A 2MUMA 3RPGC 4I7BA 5LKZA 2QICA 4UI9B 3O47A 4B86C 1JM7A 4Q6FA 3MHSA 4FIPA 2LV9A 2M85A 2YT5A 3FANA 4LJNA 2KWJA 4LK9A 1G25A 2JMIA 4GNEA 4QF2A 5LKXA 3T6RA 4OGCA 1WEMA 2JRJA 3SUBA 3FL2A 4GNGA 3QZVA 3HCUA 5H1UA 3LJUX 4NN2A 3O7AA 2VP7A 2LGVA 2EODA 2LGGA 3O33A 4S3OC 2E61A 5AIUA 1HYJA 2JM3A 3O37A 3U5NA 1DVPA 2EGMA 3ZPVE 5H1VA 2MD8C 2LXHC 4ZDTA 1ZBDB 4P5OB 1WGMA 4LADB 1N87A 3C6WA 3N9PA 1WEOA 5G05B 4GB0A 2MA6A 2H0DA 3LVRE 3N9QA 2CSZA 2DX8A 2KFTA 3LQHA 5FEYA 3ZVYA 3I2DA 3M7KA 2G6QA 2MNYA 1BORA 2YHNA 2ECJA 5EYAF 3FM8C 5B79A 2OWAA 5FERA 1X4IA 1K2FA 3FAOA 3DQVR 2YSJA 2F42A 3LQJA 5TDWA 2ECVA 4L58A 3DPLR 2LGKA 3LVQE 1WE9A 3O70A 3Q1DA 5G0FA 4Z0RA 2IQJA 2YSMA 2F6NA 1FP0A 2KIZA 1V87A 2MT5A 4XI1A 1WEVA 5TABA 4CA1A 2VJEB 3HCSA 1Z2QA 1WENA 4TKPB 2K1JA 2XOZA 2G43A 4N3WA 2L43A 4V3LC 3O36A 1MM3A 4GNFA 3KNVA 3U5OA 4A4BA 3SHBA 3T9KA 3JUEA 3MHHA 5JG6A 2G45A 3HTKC 2JUNA 4UP5A 3FEHA 2CT2A 1WILA 5LCWB 4F1PA 2KE1A 2KWOA 1E4UA 4V3KC 2MNZA 3L1XA 2MKEA 5AITA 2CRRA 2ZETC 3U5PA 1Z60A 2BAYA 2XOCA 1WFKA 5FB0A 2EXUA 4FJCA 1LDKC 2L0BA 3L11A 4I7DA 1VFYA 3NG2A 2YU4A 5B78A 3LDYA 3HCTA 2VJFB 4OGEA 4MVTA 4PPEA 2MIQA 2M6MA 3PUQA 2YQMA 2CKLB 3N9MA 4A0CD 4LKAA 2KR4A 2VPDA 3RPGB 3KDEC 2MA5A 2QIZA 2I50A 1JOCA 4BBQA 1U6GB 2M13A 2M1RA 3SOUA 4YBSA 4WA6A 3VK6A 2ECNA 2B0OE 3LRQA 4UP0A 4AYCA 1FBVA 3SOWA 2VJEA 1WEQA 2L75A 3ZVZB 5C13A 3RTRB 5B8DA 4YBMA 5TBNA 4R7EA 2K4DA 2LXPC 3T7LA 4YADA 2FFWA 2CSVA 2EA6A 2LQ6A 3PLWA 2VNFA 2YW8A 2CSYA 2LGLA 4LLBA 2C2LA 4X3GA 2KGIA 2YREA 2XB1A 2L5UA 1MM2A 4WZ0A 1F62A 2KREA 5G04B 2ECTA 3H7HA 2EGPA 3ZYQA 2UZGA 4QF3A 1WIMA 5I3LA 2Y1NA 4S3OB 3O35A 4B7YC 3L1ZB 2RSDA 4WZ2A 5H9MA 3ASLA 3N9OA 1WESA 4R2YA 1WEWA 5SVYA 3GL6A 3M99A 3MDBC 4AYCB 2KU3A 2VPBA 4YATA 3O34A 1T1HA 2VJFA 4IC2A 2LAUA 2YYRA 5LKUA 4R8PK 2KKXA 4CCGX 4IC3A 2CKLA 5B76A 2D8SA 5D1KB 3V43A 3KV5A 2RR4A 1DCQA 1X4JA 2YUCA 3KQIA 1IYMA 5B77A 5KH3A 4L7XA 2YQLA 4ZQLA 2AN6A 3M63A 1XWHA 2ECIA 3FJUB 5SVIB 2Y43A 5LKTA 4PTBA 3KV6A 2KWNA 2DJAA 2KYUA 2YVRA 5TDRA 3SOXA 1WEPA 2IDAA 2HDPA 4AVXA 4O62A 2Y1MA 4GNDA 3E2DA 5DINA 3M62A 2FSAA 2VPEA 5C11A 3N9NA 4WZ3B 2XOYA 2CRWA 4AP4A 1VD4A 5FB1A 2MD7B 5DKAA 2E6SA 1WEEA 3LQIA 4W4UA 2C2VS 5TRBA 2YURA 2P57A 2RI7A 3N9LA 5D1LB 2OXQC 1VYXA 5H1TA 1LDJB 5J3XA 2ECWA 1Z6UA 5B75A 4MSXA 3ZNIA
chains in the Genus database with same CATH topology
4A4CA 2XEUA 4ZUXU 1WEUA 3U5MA 2E6RA 2JMDA 2K17A 3ZPV1 2KGGA 1JM7B 1HYIA 4C9ZA 2F6JA 4I7CA 2PNXA 3C5KA 4BHWA 5D1MB 2LRIC 3IHPA 3GV4A 2KWKA 2FUIA 4N4FA 2NAAA 3PURA 1CHCA 2JMJA 4YC9A 5KH9A 3EB5A 4F52B 1RMDA 2ECGA 2K16A 4FO9A 3EB6A 2M3HA 2HYED 2LN0A 4AUQB 5KH7A 4O64A 4FK5A 2H0DB 2VPGA 2QJ0A 3PHDA 2PUYA 2L80A 2YHOA 4YABA 2FUUA 2LDRA 4YBTA 4YAXA 3ZTGA 1X4UA 4A49A 2MUMA 3RPGC 4I7BA 5LKZA 2QICA 4UI9B 4B86C 1JM7A 4Q6FA 3MHSA 4FIPA 2LV9A 2M85A 2YT5A 4LJNA 2KWJA 4LK9A 1G25A 2JMIA 4GNEA 4QF2A 5LKXA 3T6RA 1WEMA 2JRJA 3FL2A 4GNGA 3QZVA 3HCUA 5H1UA 4NN2A 3O7AA 2VP7A 2LGVA 2EODA 2LGGA 3O33A 4S3OC 5AIUA 1HYJA 3O37A 3U5NA 1DVPA 3ZPVE 5H1VA 2MD8C 2LXHC 4ZDTA 1ZBDB 4P5OB 1WGMA 4LADB 1N87A 3C6WA 3N9PA 1WEOA 5G05B 4GB0A 2MA6A 2H0DA 3N9QA 2CSZA 2DX8A 2KFTA 3LQHA 5FEYA 3ZVYA 3I2DA 2G6QA 2MNYA 1BORA 2YHNA 2ECJA 5EYAF 5B79A 5FERA 1X4IA 1K2FA 3DQVR 2YSJA 2F42A 3LQJA 5TDWA 2ECVA 4L58A 3DPLR 2LGKA 1WE9A 3O70A 5G0FA 2YSMA 2F6NA 1FP0A 2KIZA 1V87A 2MT5A 4XI1A 1WEVA 5TABA 4CA1A 2VJEB 3HCSA 1Z2QA 1WENA 4TKPB 2K1JA 4N3WA 2G43A 2L43A 4V3LC 3O36A 1MM3A 4GNFA 3KNVA 3U5OA 4A4BA 3SHBA 3MHHA 5JG6A 2G45A 3HTKC 4UP5A 2CT2A 1WILA 5LCWB 2KE1A 2KWOA 1E4UA 4V3KC 2MNZA 3L1XA 5AITA 2ZETC 3U5PA 1Z60A 2BAYA 1WFKA 5FB0A 4FJCA 1LDKC 2L0BA 3L11A 1VFYA 4I7DA 3NG2A 2YU4A 5B78A 3HCTA 2VJFB 4MVTA 4PPEA 2MIQA 2M6MA 3PUQA 2YQMA 2CKLB 3N9MA 4A0CD 4LKAA 2KR4A 2VPDA 3RPGB 2MA5A 2QIZA 2I50A 1JOCA 4BBQA 1U6GB 2M1RA 3SOUA 4YBSA 4WA6A 3VK6A 2ECNA 3LRQA 4UP0A 4AYCA 1FBVA 3SOWA 2VJEA 1WEQA 2L75A 3ZVZB 5C13A 3RTRB 5B8DA 4YBMA 5TBNA 4R7EA 2K4DA 2LXPC 3T7LA 4YADA 2EA6A 2LQ6A 2VNFA 2YW8A 2CSYA 2LGLA 4LLBA 2C2LA 4X3GA 2KGIA 2YREA 2XB1A 2L5UA 1MM2A 4WZ0A 1F62A 2KREA 5G04B 2ECTA 2EGPA 3ZYQA 2UZGA 4QF3A 1WIMA 5I3LA 2Y1NA 4S3OB 3O35A 4B7YC 3L1ZB 2RSDA 4WZ2A 5H9MA 3ASLA 3N9OA 1WESA 4R2YA 1WEWA 3GL6A 3M99A 4AYCB 2KU3A 2VPBA 4YATA 3O34A 1T1HA 2VJFA 4IC2A 2YYRA 5LKUA 4R8PK 4CCGX 4IC3A 2CKLA 5B76A 2D8SA 5D1KB 3V43A 3KV5A 1X4JA 2YUCA 3KQIA 1IYMA 5B77A 5KH3A 4L7XA 2YQLA 4ZQLA 2AN6A 3M63A 1XWHA 2ECIA 2Y43A 5LKTA 4PTBA 3KV6A 2KWNA 2KYUA 5TDRA 3SOXA 1WEPA 2IDAA 2HDPA 4AVXA 2Y1MA 4GNDA 5DINA 3M62A 2FSAA 2VPEA 5C11A 3N9NA 4WZ3B 4AP4A 1VD4A 5FB1A 2MD7B 5DKAA 2E6SA 1WEEA 3LQIA 4W4UA 2C2VS 5TRBA 2YURA 2RI7A 5D1LB 3N9LA 2OXQC 1VYXA 5H1TA 1LDJB 5J3XA 2ECWA 1Z6UA 5B75A 4MSXA 3ZNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4C A;  2XEU A;  4ZUX U;  1WEU A;  3U5M A;  2E6R A;  2JMD A;  2K17 A;  3ZPV 1;  2KGG A;  1JM7 B;  1HYI A;  4C9Z A;  2F6J A;  4I7C A;  2PNX A;  3C5K A;  4BHW A;  5D1M B;  2LRI C;  3IHP A;  3GV4 A;  2KWK A;  2FUI A;  4N4F A;  2NAA A;  3PUR A;  1CHC A;  2JMJ A;  4YC9 A;  5KH9 A;  3EB5 A;  4F52 B;  1RMD A;  2ECG A;  2K16 A;  4FO9 A;  3EB6 A;  2M3H A;  2HYE D;  2LN0 A;  4AUQ B;  5KH7 A;  4O64 A;  4FK5 A;  2H0D B;  2VPG A;  2QJ0 A;  3PHD A;  2PUY A;  2L80 A;  2YHO A;  4YAB A;  2FUU A;  2LDR A;  4YBT A;  4YAX A;  3ZTG A;  1X4U A;  4A49 A;  2MUM A;  3RPG C;  4I7B A;  5LKZ A;  2QIC A;  4UI9 B;  4B86 C;  1JM7 A;  4Q6F A;  3MHS A;  4FIP A;  2LV9 A;  2M85 A;  2YT5 A;  4LJN A;  2KWJ A;  4LK9 A;  1G25 A;  2JMI A;  4GNE A;  4QF2 A;  5LKX A;  3T6R A;  1WEM A;  2JRJ A;  3FL2 A;  4GNG A;  3QZV A;  3HCU A;  5H1U A;  4NN2 A;  3O7A A;  2VP7 A;  2LGV A;  2EOD A;  2LGG A;  3O33 A;  4S3O C;  5AIU A;  1HYJ A;  3O37 A;  3U5N A;  1DVP A;  3ZPV E;  5H1V A;  2MD8 C;  2LXH C;  4ZDT A;  1ZBD B;  4P5O B;  1WGM A;  4LAD B;  1N87 A;  3C6W A;  3N9P A;  1WEO A;  5G05 B;  4GB0 A;  2MA6 A;  2H0D A;  3N9Q A;  2CSZ A;  2DX8 A;  2KFT A;  3LQH A;  5FEY A;  3ZVY A;  3I2D A;  2G6Q A;  2MNY A;  1BOR A;  2YHN A;  2ECJ A;  5EYA F;  5B79 A;  5FER A;  1X4I A;  1K2F A;  3DQV R;  2YSJ A;  2F42 A;  3LQJ A;  5TDW A;  2ECV A;  4L58 A;  3DPL R;  2LGK A;  1WE9 A;  3O70 A;  5G0F A;  2YSM A;  2F6N A;  1FP0 A;  2KIZ A;  1V87 A;  2MT5 A;  4XI1 A;  1WEV A;  5TAB A;  4CA1 A;  2VJE B;  3HCS A;  1Z2Q A;  1WEN A;  4TKP B;  2K1J A;  4N3W A;  2G43 A;  2L43 A;  4V3L C;  3O36 A;  1MM3 A;  4GNF A;  3KNV A;  3U5O A;  4A4B A;  3SHB A;  3MHH A;  5JG6 A;  2G45 A;  3HTK C;  4UP5 A;  2CT2 A;  1WIL A;  5LCW B;  2KE1 A;  2KWO A;  1E4U A;  4V3K C;  2MNZ A;  3L1X A;  5AIT A;  2ZET C;  3U5P A;  1Z60 A;  2BAY A;  1WFK A;  5FB0 A;  4FJC A;  1LDK C;  2L0B A;  3L11 A;  1VFY A;  4I7D A;  3NG2 A;  2YU4 A;  5B78 A;  3HCT A;  2VJF B;  4MVT A;  4PPE A;  2MIQ A;  2M6M A;  3PUQ A;  2YQM A;  2CKL B;  3N9M A;  4A0C D;  4LKA A;  2KR4 A;  2VPD A;  3RPG B;  2MA5 A;  2QIZ A;  2I50 A;  1JOC A;  4BBQ A;  1U6G B;  2M1R A;  3SOU A;  4YBS A;  4WA6 A;  3VK6 A;  2ECN A;  3LRQ A;  4UP0 A;  4AYC A;  1FBV A;  3SOW A;  2VJE A;  1WEQ A;  2L75 A;  3ZVZ B;  5C13 A;  3RTR B;  5B8D A;  4YBM A;  5TBN A;  4R7E A;  2K4D A;  2LXP C;  3T7L A;  4YAD A;  2EA6 A;  2LQ6 A;  2VNF A;  2YW8 A;  2CSY A;  2LGL A;  4LLB A;  2C2L A;  4X3G A;  2KGI A;  2YRE A;  2XB1 A;  2L5U A;  1MM2 A;  4WZ0 A;  1F62 A;  2KRE A;  5G04 B;  2ECT A;  2EGP A;  3ZYQ A;  2UZG A;  4QF3 A;  1WIM A;  5I3L A;  2Y1N A;  4S3O B;  3O35 A;  4B7Y C;  3L1Z B;  2RSD A;  4WZ2 A;  5H9M A;  3ASL A;  3N9O A;  1WES A;  4R2Y A;  1WEW A;  3GL6 A;  3M99 A;  4AYC B;  2KU3 A;  2VPB A;  4YAT A;  3O34 A;  1T1H A;  2VJF A;  4IC2 A;  2YYR A;  5LKU A;  4R8P K;  4CCG X;  4IC3 A;  2CKL A;  5B76 A;  2D8S A;  5D1K B;  3V43 A;  3KV5 A;  1X4J A;  2YUC A;  3KQI A;  1IYM A;  5B77 A;  5KH3 A;  4L7X A;  2YQL A;  4ZQL A;  2AN6 A;  3M63 A;  1XWH A;  2ECI A;  2Y43 A;  5LKT A;  4PTB A;  3KV6 A;  2KWN A;  2KYU A;  5TDR A;  3SOX A;  1WEP A;  2IDA A;  2HDP A;  4AVX A;  2Y1M A;  4GND A;  5DIN A;  3M62 A;  2FSA A;  2VPE A;  5C11 A;  3N9N A;  4WZ3 B;  4AP4 A;  1VD4 A;  5FB1 A;  2MD7 B;  5DKA A;  2E6S A;  1WEE A;  3LQI A;  4W4U A;  2C2V S;  5TRB A;  2YUR A;  2RI7 A;  5D1L B;  3N9L A;  2OXQ C;  1VYX A;  5H1T A;  1LDJ B;  5J3X A;  2ECW A;  1Z6U A;  5B75 A;  4MSX A;  3ZNI A; 
#chains in the Genus database with same CATH topology
 2L7P A;  4A4C A;  2XEU A;  4ZUX U;  1WEU A;  2D8U A;  3U5M A;  2E6R A;  3DDT A;  2JMD A;  2K17 A;  3ZPV 1;  2KGG A;  1JM7 B;  1HYI A;  4C9Z A;  2XP0 A;  2F6J A;  4I7C A;  2PNX A;  2KKY A;  3C5K A;  4BHW A;  5D1M B;  5K3Q A;  2LRI C;  4QQ4 A;  3IHP A;  3GV4 A;  2KWK A;  5SVX A;  2FUI A;  5SVI A;  4N4F A;  2NAA A;  3PUR A;  2FD4 A;  1CHC A;  2JMJ A;  4YC9 A;  5KH9 A;  4H9D A;  3EB5 A;  4F52 B;  1RMD A;  2ECG A;  2K16 A;  2DSM A;  4FO9 A;  3EB6 A;  2M3H A;  2HYE D;  1MBM A;  2LN0 A;  4Z0O A;  4AUQ B;  5KH7 A;  4O64 A;  4FK5 A;  2H0D B;  2VPG A;  2CON A;  2QJ0 A;  3PHD A;  2PUY A;  2L80 A;  2YHO A;  4YAB A;  3DWD A;  2FUU A;  2LDR A;  4YBT A;  4YAX A;  3ZTG A;  1X4U A;  4A49 A;  2MUM A;  3RPG C;  4I7B A;  5LKZ A;  2QIC A;  4UI9 B;  3O47 A;  4B86 C;  1JM7 A;  4Q6F A;  3MHS A;  4FIP A;  2LV9 A;  2M85 A;  2YT5 A;  3FAN A;  4LJN A;  2KWJ A;  4LK9 A;  1G25 A;  2JMI A;  4GNE A;  4QF2 A;  5LKX A;  3T6R A;  4OGC A;  1WEM A;  2JRJ A;  3SUB A;  3FL2 A;  4GNG A;  3QZV A;  3HCU A;  5H1U A;  3LJU X;  4NN2 A;  3O7A A;  2VP7 A;  2LGV A;  2EOD A;  2LGG A;  3O33 A;  4S3O C;  2E61 A;  5AIU A;  1HYJ A;  2JM3 A;  3O37 A;  3U5N A;  1DVP A;  2EGM A;  3ZPV E;  5H1V A;  2MD8 C;  2LXH C;  4ZDT A;  1ZBD B;  4P5O B;  1WGM A;  4LAD B;  1N87 A;  3C6W A;  3N9P A;  1WEO A;  5G05 B;  4GB0 A;  2MA6 A;  2H0D A;  3LVR E;  3N9Q A;  2CSZ A;  2DX8 A;  2KFT A;  3LQH A;  5FEY A;  3ZVY A;  3I2D A;  3M7K A;  2G6Q A;  2MNY A;  1BOR A;  2YHN A;  2ECJ A;  5EYA F;  3FM8 C;  5B79 A;  2OWA A;  5FER A;  1X4I A;  1K2F A;  3FAO A;  3DQV R;  2YSJ A;  2F42 A;  3LQJ A;  5TDW A;  2ECV A;  4L58 A;  3DPL R;  2LGK A;  3LVQ E;  1WE9 A;  3O70 A;  3Q1D A;  5G0F A;  4Z0R A;  2IQJ A;  2YSM A;  2F6N A;  1FP0 A;  2KIZ A;  1V87 A;  2MT5 A;  4XI1 A;  1WEV A;  5TAB A;  4CA1 A;  2VJE B;  3HCS A;  1Z2Q A;  1WEN A;  4TKP B;  2K1J A;  2XOZ A;  2G43 A;  4N3W A;  2L43 A;  4V3L C;  3O36 A;  1MM3 A;  4GNF A;  3KNV A;  3U5O A;  4A4B A;  3SHB A;  3T9K A;  3JUE A;  3MHH A;  5JG6 A;  2G45 A;  3HTK C;  2JUN A;  4UP5 A;  3FEH A;  2CT2 A;  1WIL A;  5LCW B;  4F1P A;  2KE1 A;  2KWO A;  1E4U A;  4V3K C;  2MNZ A;  3L1X A;  2MKE A;  5AIT A;  2CRR A;  2ZET C;  3U5P A;  1Z60 A;  2BAY A;  2XOC A;  1WFK A;  5FB0 A;  2EXU A;  4FJC A;  1LDK C;  2L0B A;  3L11 A;  4I7D A;  1VFY A;  3NG2 A;  2YU4 A;  5B78 A;  3LDY A;  3HCT A;  2VJF B;  4OGE A;  4MVT A;  4PPE A;  2MIQ A;  2M6M A;  3PUQ A;  2YQM A;  2CKL B;  3N9M A;  4A0C D;  4LKA A;  2KR4 A;  2VPD A;  3RPG B;  3KDE C;  2MA5 A;  2QIZ A;  2I50 A;  1JOC A;  4BBQ A;  1U6G B;  2M13 A;  2M1R A;  3SOU A;  4YBS A;  4WA6 A;  3VK6 A;  2ECN A;  2B0O E;  3LRQ A;  4UP0 A;  4AYC A;  1FBV A;  3SOW A;  2VJE A;  1WEQ A;  2L75 A;  3ZVZ B;  5C13 A;  3RTR B;  5B8D A;  4YBM A;  5TBN A;  4R7E A;  2K4D A;  2LXP C;  3T7L A;  4YAD A;  2FFW A;  2CSV A;  2EA6 A;  2LQ6 A;  3PLW A;  2VNF A;  2YW8 A;  2CSY A;  2LGL A;  4LLB A;  2C2L A;  4X3G A;  2KGI A;  2YRE A;  2XB1 A;  2L5U A;  1MM2 A;  4WZ0 A;  1F62 A;  2KRE A;  5G04 B;  2ECT A;  3H7H A;  2EGP A;  3ZYQ A;  2UZG A;  4QF3 A;  1WIM A;  5I3L A;  2Y1N A;  4S3O B;  3O35 A;  4B7Y C;  3L1Z B;  2RSD A;  4WZ2 A;  5H9M A;  3ASL A;  3N9O A;  1WES A;  4R2Y A;  1WEW A;  5SVY A;  3GL6 A;  3M99 A;  3MDB C;  4AYC B;  2KU3 A;  2VPB A;  4YAT A;  3O34 A;  1T1H A;  2VJF A;  4IC2 A;  2LAU A;  2YYR A;  5LKU A;  4R8P K;  2KKX A;  4CCG X;  4IC3 A;  2CKL A;  5B76 A;  2D8S A;  5D1K B;  3V43 A;  3KV5 A;  2RR4 A;  1DCQ A;  1X4J A;  2YUC A;  3KQI A;  1IYM A;  5B77 A;  5KH3 A;  4L7X A;  2YQL A;  4ZQL A;  2AN6 A;  3M63 A;  1XWH A;  2ECI A;  3FJU B;  5SVI B;  2Y43 A;  5LKT A;  4PTB A;  3KV6 A;  2KWN A;  2DJA A;  2KYU A;  2YVR A;  5TDR A;  3SOX A;  1WEP A;  2IDA A;  2HDP A;  4AVX A;  4O62 A;  2Y1M A;  4GND A;  3E2D A;  5DIN A;  3M62 A;  2FSA A;  2VPE A;  5C11 A;  3N9N A;  4WZ3 B;  2XOY A;  2CRW A;  4AP4 A;  1VD4 A;  5FB1 A;  2MD7 B;  5DKA A;  2E6S A;  1WEE A;  3LQI A;  4W4U A;  2C2V S;  5TRB A;  2YUR A;  2P57 A;  2RI7 A;  3N9L A;  5D1L B;  2OXQ C;  1VYX A;  5H1T A;  1LDJ B;  5J3X A;  2ECW A;  1Z6U A;  5B75 A;  4MSX A;  3ZNI A; 
#chains in the Genus database with same CATH homology
 4A4C A;  2XEU A;  4ZUX U;  1WEU A;  3U5M A;  2E6R A;  2JMD A;  2K17 A;  3ZPV 1;  2KGG A;  1JM7 B;  1HYI A;  4C9Z A;  2F6J A;  4I7C A;  2PNX A;  3C5K A;  4BHW A;  5D1M B;  2LRI C;  3IHP A;  3GV4 A;  2KWK A;  2FUI A;  4N4F A;  2NAA A;  3PUR A;  1CHC A;  2JMJ A;  4YC9 A;  5KH9 A;  3EB5 A;  4F52 B;  1RMD A;  2ECG A;  2K16 A;  4FO9 A;  3EB6 A;  2M3H A;  2HYE D;  2LN0 A;  4AUQ B;  5KH7 A;  4O64 A;  4FK5 A;  2H0D B;  2VPG A;  2QJ0 A;  3PHD A;  2PUY A;  2L80 A;  2YHO A;  4YAB A;  2FUU A;  2LDR A;  4YBT A;  4YAX A;  3ZTG A;  1X4U A;  4A49 A;  2MUM A;  3RPG C;  4I7B A;  5LKZ A;  2QIC A;  4UI9 B;  4B86 C;  1JM7 A;  4Q6F A;  3MHS A;  4FIP A;  2LV9 A;  2M85 A;  2YT5 A;  4LJN A;  2KWJ A;  4LK9 A;  1G25 A;  2JMI A;  4GNE A;  4QF2 A;  5LKX A;  3T6R A;  1WEM A;  2JRJ A;  3FL2 A;  4GNG A;  3QZV A;  3HCU A;  5H1U A;  4NN2 A;  3O7A A;  2VP7 A;  2LGV A;  2EOD A;  2LGG A;  3O33 A;  4S3O C;  5AIU A;  1HYJ A;  3O37 A;  3U5N A;  1DVP A;  3ZPV E;  5H1V A;  2MD8 C;  2LXH C;  4ZDT A;  1ZBD B;  4P5O B;  1WGM A;  4LAD B;  1N87 A;  3C6W A;  3N9P A;  1WEO A;  5G05 B;  4GB0 A;  2MA6 A;  2H0D A;  3N9Q A;  2CSZ A;  2DX8 A;  2KFT A;  3LQH A;  5FEY A;  3ZVY A;  3I2D A;  2G6Q A;  2MNY A;  1BOR A;  2YHN A;  2ECJ A;  5EYA F;  5B79 A;  5FER A;  1X4I A;  1K2F A;  3DQV R;  2YSJ A;  2F42 A;  3LQJ A;  5TDW A;  2ECV A;  4L58 A;  3DPL R;  2LGK A;  1WE9 A;  3O70 A;  5G0F A;  2YSM A;  2F6N A;  1FP0 A;  2KIZ A;  1V87 A;  2MT5 A;  4XI1 A;  1WEV A;  5TAB A;  4CA1 A;  2VJE B;  3HCS A;  1Z2Q A;  1WEN A;  4TKP B;  2K1J A;  4N3W A;  2G43 A;  2L43 A;  4V3L C;  3O36 A;  1MM3 A;  4GNF A;  3KNV A;  3U5O A;  4A4B A;  3SHB A;  3MHH A;  5JG6 A;  2G45 A;  3HTK C;  4UP5 A;  2CT2 A;  1WIL A;  5LCW B;  2KE1 A;  2KWO A;  1E4U A;  4V3K C;  2MNZ A;  3L1X A;  5AIT A;  2ZET C;  3U5P A;  1Z60 A;  2BAY A;  1WFK A;  5FB0 A;  4FJC A;  1LDK C;  2L0B A;  3L11 A;  1VFY A;  4I7D A;  3NG2 A;  2YU4 A;  5B78 A;  3HCT A;  2VJF B;  4MVT A;  4PPE A;  2MIQ A;  2M6M A;  3PUQ A;  2YQM A;  2CKL B;  3N9M A;  4A0C D;  4LKA A;  2KR4 A;  2VPD A;  3RPG B;  2MA5 A;  2QIZ A;  2I50 A;  1JOC A;  4BBQ A;  1U6G B;  2M1R A;  3SOU A;  4YBS A;  4WA6 A;  3VK6 A;  2ECN A;  3LRQ A;  4UP0 A;  4AYC A;  1FBV A;  3SOW A;  2VJE A;  1WEQ A;  2L75 A;  3ZVZ B;  5C13 A;  3RTR B;  5B8D A;  4YBM A;  5TBN A;  4R7E A;  2K4D A;  2LXP C;  3T7L A;  4YAD A;  2EA6 A;  2LQ6 A;  2VNF A;  2YW8 A;  2CSY A;  2LGL A;  4LLB A;  2C2L A;  4X3G A;  2KGI A;  2YRE A;  2XB1 A;  2L5U A;  1MM2 A;  4WZ0 A;  1F62 A;  2KRE A;  5G04 B;  2ECT A;  2EGP A;  3ZYQ A;  2UZG A;  4QF3 A;  1WIM A;  5I3L A;  2Y1N A;  4S3O B;  3O35 A;  4B7Y C;  3L1Z B;  2RSD A;  4WZ2 A;  5H9M A;  3ASL A;  3N9O A;  1WES A;  4R2Y A;  1WEW A;  3GL6 A;  3M99 A;  4AYC B;  2KU3 A;  2VPB A;  4YAT A;  3O34 A;  1T1H A;  2VJF A;  4IC2 A;  2YYR A;  5LKU A;  4R8P K;  4CCG X;  4IC3 A;  2CKL A;  5B76 A;  2D8S A;  5D1K B;  3V43 A;  3KV5 A;  1X4J A;  2YUC A;  3KQI A;  1IYM A;  5B77 A;  5KH3 A;  4L7X A;  2YQL A;  4ZQL A;  2AN6 A;  3M63 A;  1XWH A;  2ECI A;  2Y43 A;  5LKT A;  4PTB A;  3KV6 A;  2KWN A;  2KYU A;  5TDR A;  3SOX A;  1WEP A;  2IDA A;  2HDP A;  4AVX A;  2Y1M A;  4GND A;  5DIN A;  3M62 A;  2FSA A;  2VPE A;  5C11 A;  3N9N A;  4WZ3 B;  4AP4 A;  1VD4 A;  5FB1 A;  2MD7 B;  5DKA A;  2E6S A;  1WEE A;  3LQI A;  4W4U A;  2C2V S;  5TRB A;  2YUR A;  2RI7 A;  5D1L B;  3N9L A;  2OXQ C;  1VYX A;  5H1T A;  1LDJ B;  5J3X A;  2ECW A;  1Z6U A;  5B75 A;  4MSX A;  3ZNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...