3L1XA

Crystal structure of u-box domain of human e4b ubiquitin ligase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
SDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin conjugation factor E4 B
publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1xA01
5KH7A 5H1VA 4X3GA 5AIUA 5D1KB 2L75A 2FSAA 4S3OB 2K1JA 4AYCA 3PURA 2LDRA 1WEMA 2KREA 1RMDA 3I2DA 5B77A 2LV9A 4GNDA 3O34A 5J3XA 3L1ZB 1DVPA 4UI9B 5DINA 3HCSA 4FK5A 1HYIA 1X4UA 4YBTA 2KGIA 3N9OA 1BORA 4ZUXU 4AP4A 3HTKC 4GNEA 3N9PA 5G04B 2YQMA 3ZTGA 4AYCB 4LK9A 3DQVR 1Z2QA 2YUCA 3N9NA 2I50A 3U5OA 3O36A 1VFYA 2LGKA 2KIZA 1WEUA 1WFKA 4LJNA 3RPGB 2JMDA 2CSYA 4P5OB 5B78A 3PHDA 1WEEA 4IC2A 3M62A 4L7XA 3C5KA 4L58A 5B75A 5G0FA 3DPLR 4AUQB 5JG6A 4N3WA 1U6GB 2ECTA 2FUUA 4N4FA 4A4BA 3L11A 2M1RA 2M6MA 1WILA 2HYED 4FIPA 2JMJA 1N87A 2MIQA 5FB0A 1X4IA 2Y1MA 4O64A 2L43A 3FL2A 4YADA 3EB5A 3N9LA 2MNYA 4BBQA 4TKPB 2VJFA 4Q6FA 2QICA 2F6JA 4A4CA 1WGMA 1VYXA 3ZPVE 3C6WA 5TBNA 4YABA 2FUIA 1MM2A 2YSJA 4FO9A 2LQ6A 5FERA 2KWOA 2G43A 5H1UA 2YSMA 4V3KC 2E6SA 3U5PA 1Z60A 5LKZA 2YYRA 4R8PK 4YBSA 1V87A 2VJFB 2L80A 2MT5A 2LXHC 3O33A 4PTBA 2M85A 2VPBA 1K2FA 2ZETC 2VPGA 2LGLA 2HDPA 5LCWB 5LKXA 1JM7B 2E6RA 2EGPA 1WEPA 5AITA 1CHCA 4LADB 5D1LB 2AN6A 3KNVA 4AVXA 2KWJA 3KQIA 4FJCA 5B76A 3ZPV1 5KH3A 4R2YA 2CKLB 1WEWA 5FB1A 2EA6A 3KV5A 2BAYA 2YREA 3O37A 5G05B 2LRIC 1IYMA 2LGGA 4IC3A 4YATA 3LRQA 2KYUA 2PUYA 1ZBDB 3V43A 4WA6A 2YHOA 1WESA 3O7AA 2RSDA 5I3LA 3ZNIA 3PUQA 2MD7B 2KWNA 2XB1A 2NAAA 3MHHA 2K16A 1XWHA 2YQLA 4WZ3B 3LQHA 2MA6A 3HCTA 1WENA 4GNGA 3M99A 3T6RA 1LDKC 1FBVA 5EYAF 4B7YC 4F52B 4YC9A 2IDAA 4S3OC 5C11A 3GV4A 4R7EA 3U5MA 1JOCA 1JM7A 2VPEA 1WIMA 2D8SA 4ZQLA 2CT2A 2VJEB 3VK6A 2MUMA 1HYJA 5DKAA 1WEOA 2KE1A 3ZYQA 2QJ0A 3SHBA 4ZDTA 4WZ2A 2JMIA 2ECVA 4QF3A 1WEQA 3U5NA 4W4UA 1FP0A 2G45A 5B79A 2G6QA 1MM3A 2K4DA 2OXQC 3SOWA 1WE9A 3HCUA 2KWKA 2CKLA 4WZ0A 2K17A 3RTRB 2L0BA 3T7LA 2ECIA 4CA1A 1F62A 5TRBA 4YBMA 4I7BA 2H0DB 2RI7A 4YAXA 2CSZA 3NG2A 2VNFA 2F42A 5KH9A 4LLBA 2VP7A 3RPGC 2L5UA 3N9QA 3O35A 5H1TA 2YU4A 2LGVA 2LN0A 3L1XA 4MSXA 3LQJA 1X4JA 2KFTA 4C9ZA 2MD8C 4UP0A 1E4UA 2ECJA 3SOXA 4GNFA 1LDJB 5FEYA 3SOUA 4B86C 2M3HA 3MHSA 2YW8A 3M63A 4I7DA 2PNXA 5H9MA 1G25A 1Z6UA 2F6NA 4GB0A 2KR4A 5TDRA 2YHNA 4NN2A 5D1MB 4I7CA 2LXPC 2YT5A 2Y43A 1T1HA 2VJEA 3GL6A 4XI1A 2ECNA 2MA5A 4PPEA 5TABA 5C13A 5TDWA 3N9MA 5B8DA 3O70A 5LKUA 2UZGA 1WEVA 2MNZA 4LKAA 2KGGA 4A0CD 4A49A 4V3LC 3IHPA 2DX8A 4UP5A 3ZVZB 2YURA 4MVTA 3ZVYA 3QZVA 5LKTA 3LQIA 4BHWA 2JRJA 3KV6A 2QIZA 2KU3A 3ASLA 2EODA 2C2VS 2H0DA 2C2LA 2ECGA 4QF2A 1VD4A 2VPDA 4CCGX 2ECWA 2Y1NA 2XEUA 3EB6A
chains in the Genus database with same CATH superfamily
5KH7A 5H1VA 4X3GA 5AIUA 5D1KB 2L75A 2FSAA 4S3OB 3SUBA 2FFWA 2K1JA 4AYCA 3PURA 2LDRA 1WEMA 2KREA 3FEHA 1RMDA 3I2DA 5B77A 5SVIA 2LV9A 2MKEA 4GNDA 3O34A 5J3XA 3L1ZB 1DVPA 4UI9B 5DINA 3HCSA 4FK5A 1HYIA 1X4UA 3H7HA 4YBTA 2KGIA 3N9OA 1BORA 4ZUXU 2OWAA 4AP4A 3HTKC 4GNEA 3N9PA 5G04B 2YQMA 2P57A 3ZTGA 2YVRA 4AYCB 4LK9A 3FAOA 3DQVR 1Z2QA 2YUCA 3N9NA 4OGEA 2I50A 3U5OA 3O36A 1VFYA 2LGKA 2KIZA 1WEUA 1WFKA 4H9DA 4LJNA 3RPGB 2JMDA 2CSYA 4P5OB 2B0OE 2L7PA 5B78A 3PHDA 1WEEA 4IC2A 2CRRA 3M62A 4L7XA 3C5KA 4L58A 5B75A 5G0FA 3DPLR 4AUQB 2FD4A 5JG6A 4N3WA 1U6GB 2ECTA 2FUUA 4N4FA 4A4BA 3L11A 2M1RA 2M6MA 1WILA 2HYED 4FIPA 2RR4A 4Z0RA 2JMJA 1N87A 2DSMA 2JUNA 2MIQA 5FB0A 1X4IA 2Y1MA 4O64A 2L43A 3FL2A 4YADA 3EB5A 3N9LA 2MNYA 4BBQA 4TKPB 5SVYA 2VJFA 4Q6FA 2QICA 2F6JA 4OGCA 2KKYA 4A4CA 1WGMA 1VYXA 3ZPVE 3C6WA 5TBNA 4YABA 1MM2A 2FUIA 2YSJA 4FO9A 2LQ6A 5FERA 1MBMA 2KWOA 2G43A 4QQ4A 5H1UA 2YSMA 4V3KC 2E6SA 3U5PA 2CONA 2EGMA 1Z60A 3O47A 5LKZA 2YYRA 4R8PK 4YBSA 1V87A 2VJFB 2L80A 2MT5A 2LXHC 3O33A 4PTBA 2M85A 2VPBA 2IQJA 1K2FA 2ZETC 2VPGA 2LAUA 2LGLA 2HDPA 5LCWB 5LKXA 1JM7B 1DCQA 2E6RA 2CRWA 4O62A 2EGPA 2XOCA 1WEPA 5AITA 1CHCA 4LADB 3LJUX 5K3QA 5D1LB 2AN6A 3KNVA 2XOYA 4AVXA 2KWJA 3KQIA 4FJCA 5B76A 3ZPV1 5KH3A 4R2YA 2CKLB 1WEWA 5FB1A 2EA6A 3KV5A 2BAYA 2YREA 2D8UA 3O37A 5G05B 2LRIC 1IYMA 2LGGA 4IC3A 4YATA 3LRQA 2KYUA 2PUYA 1ZBDB 3V43A 4WA6A 2YHOA 1WESA 3O7AA 2RSDA 5I3LA 3PLWA 3ZNIA 3PUQA 2MD7B 2KWNA 2XB1A 2NAAA 2EXUA 3MHHA 2K16A 1XWHA 2YQLA 4WZ3B 3LQHA 2CSVA 2MA6A 3HCTA 1WENA 4GNGA 3M99A 3T6RA 1LDKC 1FBVA 3FJUB 5EYAF 4B7YC 4F52B 4YC9A 2IDAA 4S3OC 5C11A 3GV4A 4R7EA 3U5MA 1JOCA 3E2DA 1JM7A 2VPEA 1WIMA 2D8SA 4ZQLA 3DWDA 2CT2A 2VJEB 2E61A 3VK6A 2MUMA 1HYJA 5DKAA 1WEOA 2KE1A 3ZYQA 2QJ0A 3SHBA 4ZDTA 4WZ2A 2JMIA 2ECVA 3FANA 4QF3A 1WEQA 3U5NA 4W4UA 1FP0A 2G45A 5B79A 2G6QA 1MM3A 3FM8C 2K4DA 2OXQC 3SOWA 1WE9A 3HCUA 2KWKA 2CKLA 4WZ0A 3M7KA 2K17A 3RTRB 2L0BA 3T7LA 2ECIA 4CA1A 1F62A 5TRBA 4YBMA 4I7BA 2H0DB 2RI7A 4YAXA 2CSZA 3NG2A 2M13A 2VNFA 2F42A 5KH9A 4LLBA 2VP7A 2L5UA 3RPGC 3N9QA 3O35A 5H1TA 2YU4A 2LGVA 2LN0A 3DDTA 3L1XA 5SVXA 4MSXA 3LQJA 1X4JA 2KFTA 4C9ZA 2MD8C 4UP0A 1E4UA 2ECJA 3SOXA 4GNFA 1LDJB 5FEYA 5SVIB 3SOUA 4B86C 2M3HA 3MHSA 2XOZA 2YW8A 3M63A 4I7DA 2PNXA 3LVRE 5H9MA 1G25A 4Z0OA 1Z6UA 2F6NA 4GB0A 2KR4A 5TDRA 2YHNA 2XP0A 4NN2A 3Q1DA 3KDEC 5D1MB 4I7CA 3LDYA 2LXPC 2YT5A 2Y43A 1T1HA 2VJEA 3GL6A 4XI1A 2ECNA 2MA5A 4PPEA 5TABA 5C13A 5TDWA 3N9MA 3T9KA 5B8DA 3O70A 5LKUA 2UZGA 1WEVA 2MNZA 4F1PA 4LKAA 2KGGA 4A0CD 4A49A 4V3LC 3IHPA 2DX8A 4UP5A 3ZVZB 2YURA 3MDBC 4MVTA 3ZVYA 3QZVA 5LKTA 3JUEA 3LQIA 2KKXA 2JRJA 3KV6A 4BHWA 2QIZA 2JM3A 2DJAA 2KU3A 3ASLA 3LVQE 2EODA 2C2VS 2H0DA 2C2LA 2ECGA 4QF2A 1VD4A 2VPDA 4CCGX 2ECWA 2Y1NA 2XEUA 3EB6A
chains in the Genus database with same CATH topology
5KH7A 5H1VA 4X3GA 5AIUA 5D1KB 2L75A 2FSAA 4S3OB 2K1JA 4AYCA 3PURA 2LDRA 1WEMA 2KREA 1RMDA 3I2DA 5B77A 2LV9A 4GNDA 3O34A 5J3XA 3L1ZB 1DVPA 4UI9B 5DINA 3HCSA 4FK5A 1HYIA 1X4UA 4YBTA 2KGIA 3N9OA 1BORA 4ZUXU 4AP4A 3HTKC 4GNEA 3N9PA 5G04B 2YQMA 3ZTGA 4AYCB 4LK9A 3DQVR 1Z2QA 2YUCA 3N9NA 2I50A 3U5OA 3O36A 1VFYA 2LGKA 2KIZA 1WEUA 1WFKA 4LJNA 3RPGB 2JMDA 2CSYA 4P5OB 5B78A 3PHDA 1WEEA 4IC2A 3M62A 4L7XA 3C5KA 4L58A 5B75A 5G0FA 3DPLR 4AUQB 5JG6A 4N3WA 1U6GB 2ECTA 2FUUA 4N4FA 4A4BA 3L11A 2M1RA 2M6MA 1WILA 2HYED 4FIPA 2JMJA 1N87A 2MIQA 5FB0A 1X4IA 2Y1MA 4O64A 2L43A 3FL2A 4YADA 3EB5A 3N9LA 2MNYA 4BBQA 4TKPB 2VJFA 4Q6FA 2QICA 2F6JA 4A4CA 1WGMA 1VYXA 3ZPVE 3C6WA 5TBNA 4YABA 2FUIA 1MM2A 2YSJA 4FO9A 2LQ6A 5FERA 2KWOA 2G43A 5H1UA 2YSMA 4V3KC 2E6SA 3U5PA 1Z60A 5LKZA 2YYRA 4R8PK 4YBSA 1V87A 2VJFB 2L80A 2MT5A 2LXHC 3O33A 4PTBA 2M85A 2VPBA 1K2FA 2ZETC 2VPGA 2LGLA 2HDPA 5LCWB 5LKXA 1JM7B 2E6RA 2EGPA 1WEPA 5AITA 1CHCA 4LADB 5D1LB 2AN6A 3KNVA 4AVXA 2KWJA 3KQIA 4FJCA 5B76A 3ZPV1 5KH3A 4R2YA 2CKLB 1WEWA 5FB1A 2EA6A 3KV5A 2BAYA 2YREA 3O37A 5G05B 2LRIC 1IYMA 2LGGA 4IC3A 4YATA 3LRQA 2KYUA 2PUYA 1ZBDB 3V43A 4WA6A 2YHOA 1WESA 3O7AA 2RSDA 5I3LA 3ZNIA 3PUQA 2MD7B 2KWNA 2XB1A 2NAAA 3MHHA 2K16A 1XWHA 2YQLA 4WZ3B 3LQHA 2MA6A 3HCTA 1WENA 4GNGA 3M99A 3T6RA 1LDKC 1FBVA 5EYAF 4B7YC 4F52B 4YC9A 2IDAA 4S3OC 5C11A 3GV4A 4R7EA 3U5MA 1JOCA 1JM7A 2VPEA 1WIMA 2D8SA 4ZQLA 2CT2A 2VJEB 3VK6A 2MUMA 1HYJA 5DKAA 1WEOA 2KE1A 3ZYQA 2QJ0A 3SHBA 4ZDTA 4WZ2A 2JMIA 2ECVA 4QF3A 1WEQA 3U5NA 4W4UA 1FP0A 2G45A 5B79A 2G6QA 1MM3A 2K4DA 2OXQC 3SOWA 1WE9A 3HCUA 2KWKA 2CKLA 4WZ0A 2K17A 3RTRB 2L0BA 3T7LA 2ECIA 4CA1A 1F62A 5TRBA 4YBMA 4I7BA 2H0DB 2RI7A 4YAXA 2CSZA 3NG2A 2VNFA 2F42A 5KH9A 4LLBA 2VP7A 3RPGC 2L5UA 3N9QA 3O35A 5H1TA 2YU4A 2LGVA 2LN0A 3L1XA 4MSXA 3LQJA 1X4JA 2KFTA 4C9ZA 2MD8C 4UP0A 1E4UA 2ECJA 3SOXA 4GNFA 1LDJB 5FEYA 3SOUA 4B86C 2M3HA 3MHSA 2YW8A 3M63A 4I7DA 2PNXA 5H9MA 1G25A 1Z6UA 2F6NA 4GB0A 2KR4A 5TDRA 2YHNA 4NN2A 5D1MB 4I7CA 2LXPC 2YT5A 2Y43A 1T1HA 2VJEA 3GL6A 4XI1A 2ECNA 2MA5A 4PPEA 5TABA 5C13A 5TDWA 3N9MA 5B8DA 3O70A 5LKUA 2UZGA 1WEVA 2MNZA 4LKAA 2KGGA 4A0CD 4A49A 4V3LC 3IHPA 2DX8A 4UP5A 3ZVZB 2YURA 4MVTA 3ZVYA 3QZVA 5LKTA 3LQIA 4BHWA 2JRJA 3KV6A 2QIZA 2KU3A 3ASLA 2EODA 2C2VS 2H0DA 2C2LA 2ECGA 4QF2A 1VD4A 2VPDA 4CCGX 2ECWA 2Y1NA 2XEUA 3EB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KH7 A;  5H1V A;  4X3G A;  5AIU A;  5D1K B;  2L75 A;  2FSA A;  4S3O B;  2K1J A;  4AYC A;  3PUR A;  2LDR A;  1WEM A;  2KRE A;  1RMD A;  3I2D A;  5B77 A;  2LV9 A;  4GND A;  3O34 A;  5J3X A;  3L1Z B;  1DVP A;  4UI9 B;  5DIN A;  3HCS A;  4FK5 A;  1HYI A;  1X4U A;  4YBT A;  2KGI A;  3N9O A;  1BOR A;  4ZUX U;  4AP4 A;  3HTK C;  4GNE A;  3N9P A;  5G04 B;  2YQM A;  3ZTG A;  4AYC B;  4LK9 A;  3DQV R;  1Z2Q A;  2YUC A;  3N9N A;  2I50 A;  3U5O A;  3O36 A;  1VFY A;  2LGK A;  2KIZ A;  1WEU A;  1WFK A;  4LJN A;  3RPG B;  2JMD A;  2CSY A;  4P5O B;  5B78 A;  3PHD A;  1WEE A;  4IC2 A;  3M62 A;  4L7X A;  3C5K A;  4L58 A;  5B75 A;  5G0F A;  3DPL R;  4AUQ B;  5JG6 A;  4N3W A;  1U6G B;  2ECT A;  2FUU A;  4N4F A;  4A4B A;  3L11 A;  2M1R A;  2M6M A;  1WIL A;  2HYE D;  4FIP A;  2JMJ A;  1N87 A;  2MIQ A;  5FB0 A;  1X4I A;  2Y1M A;  4O64 A;  2L43 A;  3FL2 A;  4YAD A;  3EB5 A;  3N9L A;  2MNY A;  4BBQ A;  4TKP B;  2VJF A;  4Q6F A;  2QIC A;  2F6J A;  4A4C A;  1WGM A;  1VYX A;  3ZPV E;  3C6W A;  5TBN A;  4YAB A;  2FUI A;  1MM2 A;  2YSJ A;  4FO9 A;  2LQ6 A;  5FER A;  2KWO A;  2G43 A;  5H1U A;  2YSM A;  4V3K C;  2E6S A;  3U5P A;  1Z60 A;  5LKZ A;  2YYR A;  4R8P K;  4YBS A;  1V87 A;  2VJF B;  2L80 A;  2MT5 A;  2LXH C;  3O33 A;  4PTB A;  2M85 A;  2VPB A;  1K2F A;  2ZET C;  2VPG A;  2LGL A;  2HDP A;  5LCW B;  5LKX A;  1JM7 B;  2E6R A;  2EGP A;  1WEP A;  5AIT A;  1CHC A;  4LAD B;  5D1L B;  2AN6 A;  3KNV A;  4AVX A;  2KWJ A;  3KQI A;  4FJC A;  5B76 A;  3ZPV 1;  5KH3 A;  4R2Y A;  2CKL B;  1WEW A;  5FB1 A;  2EA6 A;  3KV5 A;  2BAY A;  2YRE A;  3O37 A;  5G05 B;  2LRI C;  1IYM A;  2LGG A;  4IC3 A;  4YAT A;  3LRQ A;  2KYU A;  2PUY A;  1ZBD B;  3V43 A;  4WA6 A;  2YHO A;  1WES A;  3O7A A;  2RSD A;  5I3L A;  3ZNI A;  3PUQ A;  2MD7 B;  2KWN A;  2XB1 A;  2NAA A;  3MHH A;  2K16 A;  1XWH A;  2YQL A;  4WZ3 B;  3LQH A;  2MA6 A;  3HCT A;  1WEN A;  4GNG A;  3M99 A;  3T6R A;  1LDK C;  1FBV A;  5EYA F;  4B7Y C;  4F52 B;  4YC9 A;  2IDA A;  4S3O C;  5C11 A;  3GV4 A;  4R7E A;  3U5M A;  1JOC A;  1JM7 A;  2VPE A;  1WIM A;  2D8S A;  4ZQL A;  2CT2 A;  2VJE B;  3VK6 A;  2MUM A;  1HYJ A;  5DKA A;  1WEO A;  2KE1 A;  3ZYQ A;  2QJ0 A;  3SHB A;  4ZDT A;  4WZ2 A;  2JMI A;  2ECV A;  4QF3 A;  1WEQ A;  3U5N A;  4W4U A;  1FP0 A;  2G45 A;  5B79 A;  2G6Q A;  1MM3 A;  2K4D A;  2OXQ C;  3SOW A;  1WE9 A;  3HCU A;  2KWK A;  2CKL A;  4WZ0 A;  2K17 A;  3RTR B;  2L0B A;  3T7L A;  2ECI A;  4CA1 A;  1F62 A;  5TRB A;  4YBM A;  4I7B A;  2H0D B;  2RI7 A;  4YAX A;  2CSZ A;  3NG2 A;  2VNF A;  2F42 A;  5KH9 A;  4LLB A;  2VP7 A;  3RPG C;  2L5U A;  3N9Q A;  3O35 A;  5H1T A;  2YU4 A;  2LGV A;  2LN0 A;  3L1X A;  4MSX A;  3LQJ A;  1X4J A;  2KFT A;  4C9Z A;  2MD8 C;  4UP0 A;  1E4U A;  2ECJ A;  3SOX A;  4GNF A;  1LDJ B;  5FEY A;  3SOU A;  4B86 C;  2M3H A;  3MHS A;  2YW8 A;  3M63 A;  4I7D A;  2PNX A;  5H9M A;  1G25 A;  1Z6U A;  2F6N A;  4GB0 A;  2KR4 A;  5TDR A;  2YHN A;  4NN2 A;  5D1M B;  4I7C A;  2LXP C;  2YT5 A;  2Y43 A;  1T1H A;  2VJE A;  3GL6 A;  4XI1 A;  2ECN A;  2MA5 A;  4PPE A;  5TAB A;  5C13 A;  5TDW A;  3N9M A;  5B8D A;  3O70 A;  5LKU A;  2UZG A;  1WEV A;  2MNZ A;  4LKA A;  2KGG A;  4A0C D;  4A49 A;  4V3L C;  3IHP A;  2DX8 A;  4UP5 A;  3ZVZ B;  2YUR A;  4MVT A;  3ZVY A;  3QZV A;  5LKT A;  3LQI A;  4BHW A;  2JRJ A;  3KV6 A;  2QIZ A;  2KU3 A;  3ASL A;  2EOD A;  2C2V S;  2H0D A;  2C2L A;  2ECG A;  4QF2 A;  1VD4 A;  2VPD A;  4CCG X;  2ECW A;  2Y1N A;  2XEU A;  3EB6 A; 
#chains in the Genus database with same CATH topology
 5KH7 A;  5H1V A;  4X3G A;  5AIU A;  5D1K B;  2L75 A;  2FSA A;  4S3O B;  3SUB A;  2FFW A;  2K1J A;  4AYC A;  3PUR A;  2LDR A;  1WEM A;  2KRE A;  3FEH A;  1RMD A;  3I2D A;  5B77 A;  5SVI A;  2LV9 A;  2MKE A;  4GND A;  3O34 A;  5J3X A;  3L1Z B;  1DVP A;  4UI9 B;  5DIN A;  3HCS A;  4FK5 A;  1HYI A;  1X4U A;  3H7H A;  4YBT A;  2KGI A;  3N9O A;  1BOR A;  4ZUX U;  2OWA A;  4AP4 A;  3HTK C;  4GNE A;  3N9P A;  5G04 B;  2YQM A;  2P57 A;  3ZTG A;  2YVR A;  4AYC B;  4LK9 A;  3FAO A;  3DQV R;  1Z2Q A;  2YUC A;  3N9N A;  4OGE A;  2I50 A;  3U5O A;  3O36 A;  1VFY A;  2LGK A;  2KIZ A;  1WEU A;  1WFK A;  4H9D A;  4LJN A;  3RPG B;  2JMD A;  2CSY A;  4P5O B;  2B0O E;  2L7P A;  5B78 A;  3PHD A;  1WEE A;  4IC2 A;  2CRR A;  3M62 A;  4L7X A;  3C5K A;  4L58 A;  5B75 A;  5G0F A;  3DPL R;  4AUQ B;  2FD4 A;  5JG6 A;  4N3W A;  1U6G B;  2ECT A;  2FUU A;  4N4F A;  4A4B A;  3L11 A;  2M1R A;  2M6M A;  1WIL A;  2HYE D;  4FIP A;  2RR4 A;  4Z0R A;  2JMJ A;  1N87 A;  2DSM A;  2JUN A;  2MIQ A;  5FB0 A;  1X4I A;  2Y1M A;  4O64 A;  2L43 A;  3FL2 A;  4YAD A;  3EB5 A;  3N9L A;  2MNY A;  4BBQ A;  4TKP B;  5SVY A;  2VJF A;  4Q6F A;  2QIC A;  2F6J A;  4OGC A;  2KKY A;  4A4C A;  1WGM A;  1VYX A;  3ZPV E;  3C6W A;  5TBN A;  4YAB A;  1MM2 A;  2FUI A;  2YSJ A;  4FO9 A;  2LQ6 A;  5FER A;  1MBM A;  2KWO A;  2G43 A;  4QQ4 A;  5H1U A;  2YSM A;  4V3K C;  2E6S A;  3U5P A;  2CON A;  2EGM A;  1Z60 A;  3O47 A;  5LKZ A;  2YYR A;  4R8P K;  4YBS A;  1V87 A;  2VJF B;  2L80 A;  2MT5 A;  2LXH C;  3O33 A;  4PTB A;  2M85 A;  2VPB A;  2IQJ A;  1K2F A;  2ZET C;  2VPG A;  2LAU A;  2LGL A;  2HDP A;  5LCW B;  5LKX A;  1JM7 B;  1DCQ A;  2E6R A;  2CRW A;  4O62 A;  2EGP A;  2XOC A;  1WEP A;  5AIT A;  1CHC A;  4LAD B;  3LJU X;  5K3Q A;  5D1L B;  2AN6 A;  3KNV A;  2XOY A;  4AVX A;  2KWJ A;  3KQI A;  4FJC A;  5B76 A;  3ZPV 1;  5KH3 A;  4R2Y A;  2CKL B;  1WEW A;  5FB1 A;  2EA6 A;  3KV5 A;  2BAY A;  2YRE A;  2D8U A;  3O37 A;  5G05 B;  2LRI C;  1IYM A;  2LGG A;  4IC3 A;  4YAT A;  3LRQ A;  2KYU A;  2PUY A;  1ZBD B;  3V43 A;  4WA6 A;  2YHO A;  1WES A;  3O7A A;  2RSD A;  5I3L A;  3PLW A;  3ZNI A;  3PUQ A;  2MD7 B;  2KWN A;  2XB1 A;  2NAA A;  2EXU A;  3MHH A;  2K16 A;  1XWH A;  2YQL A;  4WZ3 B;  3LQH A;  2CSV A;  2MA6 A;  3HCT A;  1WEN A;  4GNG A;  3M99 A;  3T6R A;  1LDK C;  1FBV A;  3FJU B;  5EYA F;  4B7Y C;  4F52 B;  4YC9 A;  2IDA A;  4S3O C;  5C11 A;  3GV4 A;  4R7E A;  3U5M A;  1JOC A;  3E2D A;  1JM7 A;  2VPE A;  1WIM A;  2D8S A;  4ZQL A;  3DWD A;  2CT2 A;  2VJE B;  2E61 A;  3VK6 A;  2MUM A;  1HYJ A;  5DKA A;  1WEO A;  2KE1 A;  3ZYQ A;  2QJ0 A;  3SHB A;  4ZDT A;  4WZ2 A;  2JMI A;  2ECV A;  3FAN A;  4QF3 A;  1WEQ A;  3U5N A;  4W4U A;  1FP0 A;  2G45 A;  5B79 A;  2G6Q A;  1MM3 A;  3FM8 C;  2K4D A;  2OXQ C;  3SOW A;  1WE9 A;  3HCU A;  2KWK A;  2CKL A;  4WZ0 A;  3M7K A;  2K17 A;  3RTR B;  2L0B A;  3T7L A;  2ECI A;  4CA1 A;  1F62 A;  5TRB A;  4YBM A;  4I7B A;  2H0D B;  2RI7 A;  4YAX A;  2CSZ A;  3NG2 A;  2M13 A;  2VNF A;  2F42 A;  5KH9 A;  4LLB A;  2VP7 A;  2L5U A;  3RPG C;  3N9Q A;  3O35 A;  5H1T A;  2YU4 A;  2LGV A;  2LN0 A;  3DDT A;  3L1X A;  5SVX A;  4MSX A;  3LQJ A;  1X4J A;  2KFT A;  4C9Z A;  2MD8 C;  4UP0 A;  1E4U A;  2ECJ A;  3SOX A;  4GNF A;  1LDJ B;  5FEY A;  5SVI B;  3SOU A;  4B86 C;  2M3H A;  3MHS A;  2XOZ A;  2YW8 A;  3M63 A;  4I7D A;  2PNX A;  3LVR E;  5H9M A;  1G25 A;  4Z0O A;  1Z6U A;  2F6N A;  4GB0 A;  2KR4 A;  5TDR A;  2YHN A;  2XP0 A;  4NN2 A;  3Q1D A;  3KDE C;  5D1M B;  4I7C A;  3LDY A;  2LXP C;  2YT5 A;  2Y43 A;  1T1H A;  2VJE A;  3GL6 A;  4XI1 A;  2ECN A;  2MA5 A;  4PPE A;  5TAB A;  5C13 A;  5TDW A;  3N9M A;  3T9K A;  5B8D A;  3O70 A;  5LKU A;  2UZG A;  1WEV A;  2MNZ A;  4F1P A;  4LKA A;  2KGG A;  4A0C D;  4A49 A;  4V3L C;  3IHP A;  2DX8 A;  4UP5 A;  3ZVZ B;  2YUR A;  3MDB C;  4MVT A;  3ZVY A;  3QZV A;  5LKT A;  3JUE A;  3LQI A;  2KKX A;  2JRJ A;  3KV6 A;  4BHW A;  2QIZ A;  2JM3 A;  2DJA A;  2KU3 A;  3ASL A;  3LVQ E;  2EOD A;  2C2V S;  2H0D A;  2C2L A;  2ECG A;  4QF2 A;  1VD4 A;  2VPD A;  4CCG X;  2ECW A;  2Y1N A;  2XEU A;  3EB6 A; 
#chains in the Genus database with same CATH homology
 5KH7 A;  5H1V A;  4X3G A;  5AIU A;  5D1K B;  2L75 A;  2FSA A;  4S3O B;  2K1J A;  4AYC A;  3PUR A;  2LDR A;  1WEM A;  2KRE A;  1RMD A;  3I2D A;  5B77 A;  2LV9 A;  4GND A;  3O34 A;  5J3X A;  3L1Z B;  1DVP A;  4UI9 B;  5DIN A;  3HCS A;  4FK5 A;  1HYI A;  1X4U A;  4YBT A;  2KGI A;  3N9O A;  1BOR A;  4ZUX U;  4AP4 A;  3HTK C;  4GNE A;  3N9P A;  5G04 B;  2YQM A;  3ZTG A;  4AYC B;  4LK9 A;  3DQV R;  1Z2Q A;  2YUC A;  3N9N A;  2I50 A;  3U5O A;  3O36 A;  1VFY A;  2LGK A;  2KIZ A;  1WEU A;  1WFK A;  4LJN A;  3RPG B;  2JMD A;  2CSY A;  4P5O B;  5B78 A;  3PHD A;  1WEE A;  4IC2 A;  3M62 A;  4L7X A;  3C5K A;  4L58 A;  5B75 A;  5G0F A;  3DPL R;  4AUQ B;  5JG6 A;  4N3W A;  1U6G B;  2ECT A;  2FUU A;  4N4F A;  4A4B A;  3L11 A;  2M1R A;  2M6M A;  1WIL A;  2HYE D;  4FIP A;  2JMJ A;  1N87 A;  2MIQ A;  5FB0 A;  1X4I A;  2Y1M A;  4O64 A;  2L43 A;  3FL2 A;  4YAD A;  3EB5 A;  3N9L A;  2MNY A;  4BBQ A;  4TKP B;  2VJF A;  4Q6F A;  2QIC A;  2F6J A;  4A4C A;  1WGM A;  1VYX A;  3ZPV E;  3C6W A;  5TBN A;  4YAB A;  2FUI A;  1MM2 A;  2YSJ A;  4FO9 A;  2LQ6 A;  5FER A;  2KWO A;  2G43 A;  5H1U A;  2YSM A;  4V3K C;  2E6S A;  3U5P A;  1Z60 A;  5LKZ A;  2YYR A;  4R8P K;  4YBS A;  1V87 A;  2VJF B;  2L80 A;  2MT5 A;  2LXH C;  3O33 A;  4PTB A;  2M85 A;  2VPB A;  1K2F A;  2ZET C;  2VPG A;  2LGL A;  2HDP A;  5LCW B;  5LKX A;  1JM7 B;  2E6R A;  2EGP A;  1WEP A;  5AIT A;  1CHC A;  4LAD B;  5D1L B;  2AN6 A;  3KNV A;  4AVX A;  2KWJ A;  3KQI A;  4FJC A;  5B76 A;  3ZPV 1;  5KH3 A;  4R2Y A;  2CKL B;  1WEW A;  5FB1 A;  2EA6 A;  3KV5 A;  2BAY A;  2YRE A;  3O37 A;  5G05 B;  2LRI C;  1IYM A;  2LGG A;  4IC3 A;  4YAT A;  3LRQ A;  2KYU A;  2PUY A;  1ZBD B;  3V43 A;  4WA6 A;  2YHO A;  1WES A;  3O7A A;  2RSD A;  5I3L A;  3ZNI A;  3PUQ A;  2MD7 B;  2KWN A;  2XB1 A;  2NAA A;  3MHH A;  2K16 A;  1XWH A;  2YQL A;  4WZ3 B;  3LQH A;  2MA6 A;  3HCT A;  1WEN A;  4GNG A;  3M99 A;  3T6R A;  1LDK C;  1FBV A;  5EYA F;  4B7Y C;  4F52 B;  4YC9 A;  2IDA A;  4S3O C;  5C11 A;  3GV4 A;  4R7E A;  3U5M A;  1JOC A;  1JM7 A;  2VPE A;  1WIM A;  2D8S A;  4ZQL A;  2CT2 A;  2VJE B;  3VK6 A;  2MUM A;  1HYJ A;  5DKA A;  1WEO A;  2KE1 A;  3ZYQ A;  2QJ0 A;  3SHB A;  4ZDT A;  4WZ2 A;  2JMI A;  2ECV A;  4QF3 A;  1WEQ A;  3U5N A;  4W4U A;  1FP0 A;  2G45 A;  5B79 A;  2G6Q A;  1MM3 A;  2K4D A;  2OXQ C;  3SOW A;  1WE9 A;  3HCU A;  2KWK A;  2CKL A;  4WZ0 A;  2K17 A;  3RTR B;  2L0B A;  3T7L A;  2ECI A;  4CA1 A;  1F62 A;  5TRB A;  4YBM A;  4I7B A;  2H0D B;  2RI7 A;  4YAX A;  2CSZ A;  3NG2 A;  2VNF A;  2F42 A;  5KH9 A;  4LLB A;  2VP7 A;  3RPG C;  2L5U A;  3N9Q A;  3O35 A;  5H1T A;  2YU4 A;  2LGV A;  2LN0 A;  3L1X A;  4MSX A;  3LQJ A;  1X4J A;  2KFT A;  4C9Z A;  2MD8 C;  4UP0 A;  1E4U A;  2ECJ A;  3SOX A;  4GNF A;  1LDJ B;  5FEY A;  3SOU A;  4B86 C;  2M3H A;  3MHS A;  2YW8 A;  3M63 A;  4I7D A;  2PNX A;  5H9M A;  1G25 A;  1Z6U A;  2F6N A;  4GB0 A;  2KR4 A;  5TDR A;  2YHN A;  4NN2 A;  5D1M B;  4I7C A;  2LXP C;  2YT5 A;  2Y43 A;  1T1H A;  2VJE A;  3GL6 A;  4XI1 A;  2ECN A;  2MA5 A;  4PPE A;  5TAB A;  5C13 A;  5TDW A;  3N9M A;  5B8D A;  3O70 A;  5LKU A;  2UZG A;  1WEV A;  2MNZ A;  4LKA A;  2KGG A;  4A0C D;  4A49 A;  4V3L C;  3IHP A;  2DX8 A;  4UP5 A;  3ZVZ B;  2YUR A;  4MVT A;  3ZVY A;  3QZV A;  5LKT A;  3LQI A;  4BHW A;  2JRJ A;  3KV6 A;  2QIZ A;  2KU3 A;  3ASL A;  2EOD A;  2C2V S;  2H0D A;  2C2L A;  2ECG A;  4QF2 A;  1VD4 A;  2VPD A;  4CCG X;  2ECW A;  2Y1N A;  2XEU A;  3EB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...