3L1XA

Crystal structure of u-box domain of human e4b ubiquitin ligase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
SDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin conjugation factor E4 B
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1xA01
3ZYQA 2VPGA 2HYED 3NG2A 2KR4A 1VFYA 4YBSA 5B79A 3V43A 4ZDTA 2YSJA 2ECVA 4YADA 5H1TA 4O64A 4FJCA 2C2VS 2YT5A 3L11A 2MD8C 1U6GB 2PUYA 2L80A 3FL2A 4W4UA 2G45A 2H0DB 2DX8A 4YBTA 1T1HA 1WESA 2LRIC 4FK5A 2KREA 4YC9A 5D1LB 5B77A 2KU3A 2HDPA 2VJEB 4LKAA 2M3HA 5LKTA 3T7LA 2YSMA 2YUCA 5H9MA 4Q6FA 2L43A 2LXPC 2IDAA 2ECGA 4BBQA 2KIZA 3M62A 3I2DA 4GNEA 3MHHA 3ZVYA 2E6SA 2AN6A 4P5OB 2VPBA 5G04B 3O36A 2LQ6A 2BAYA 5LKXA 2Y1MA 2CSYA 4BHWA 2PNXA 2Y1NA 3SOWA 4TKPB 2LXHC 2LGGA 2VP7A 1LDJB 4QF2A 5FEYA 4CCGX 4B86C 3T6RA 5KH9A 4YBMA 1Z6UA 5TABA 3PURA 3M63A 2Y43A 5TBNA 4A0CD 4LLBA 4XI1A 2QJ0A 3L1XA 5B75A 1K2FA 4I7BA 3C5KA 2L5UA 2EA6A 4AVXA 2G6QA 1ZBDB 4WZ3B 2ECIA 2YW8A 2C2LA 2M6MA 5C13A 2YHOA 3N9MA 2MA6A 3C6WA 4ZUXU 2FSAA 4GB0A 2KGGA 4N3WA 2L75A 4YABA 2K1JA 3VK6A 2MD7B 2KFTA 3KV6A 1JM7A 3ZNIA 3KNVA 1MM2A 2H0DA 4V3KC 3LQIA 5G05B 3N9QA 2ECWA 3LQHA 3M99A 4YAXA 1Z60A 4QF3A 5TDRA 3O70A 3O35A 2YREA 1RMDA 4R7EA 2ECTA 2QICA 2VPEA 1X4JA 3O7AA 1G25A 1WILA 4R8PK 2YYRA 5AIUA 2OXQC 4WZ0A 5KH3A 3LRQA 1FP0A 3O34A 3U5MA 1BORA 4YATA 3HCUA 2YU4A 5FB0A 3U5PA 3SHBA 3LQJA 5TDWA 1F62A 2KE1A 4CA1A 2YHNA 4IC3A 1VYXA 5TRBA 2JMDA 4LK9A 3N9LA 4AP4A 4WZ2A 2VNFA 3U5NA 1LDKC 4FO9A 1WIMA 2F42A 4AUQB 1WEQA 5DKAA 3DPLR 2CKLA 2UZGA 5KH7A 2YQLA 3ASLA 5J3XA 4AYCB 2LGKA 4GNDA 4MVTA 2M1RA 3N9NA 4A49A 5FB1A 4I7CA 4MSXA 4X3GA 3U5OA 3RTRB 2M85A 2EODA 4N4FA 1WEPA 2VJFB 4NN2A 2FUUA 3ZVZB 2K4DA 4PTBA 5D1KB 1XWHA 2YURA 2KWOA 1WEMA 5FERA 1WGMA 2MUMA 5C11A 1WEUA 4GNGA 2K16A 2MNYA 4V3LC 4S3OB 4F52B 2LGLA 2F6JA 3GV4A 1WENA 5B8DA 5G0FA 5H1VA 1X4IA 2QIZA 2YQMA 1IYMA 2KWJA 3HCTA 4FIPA 2JRJA 1WEVA 1WEWA 1DVPA 3O33A 1WFKA 5LKZA 2F6NA 3GL6A 2CT2A 5I3LA 3EB6A 1HYJA 4UI9B 1WE9A 3L1ZB 4UP0A 4WA6A 4ZQLA 3N9PA 3KV5A 3ZPV1 2RI7A 4A4BA 5LKUA 4L7XA 3MHSA 1JM7B 3RPGB 2LV9A 1MM3A 2KWKA 2I50A 2KGIA 2LDRA 2KWNA 3ZPVE 2L0BA 4L58A 1V87A 2LN0A 4S3OC 1X4UA 2FUIA 2MNZA 2VPDA 2VJFA 2CSZA 1Z2QA 4B7YC 5DINA 4C9ZA 2VJEA 2MIQA 2D8SA 2E6RA 3SOXA 3HCSA 4A4CA 2MT5A 2JMIA 2G43A 2ECNA 4R2YA 2K17A 4AYCA 4GNFA 3EB5A 1N87A 2CKLB 4UP5A 1WEEA 2EGPA 2XB1A 5B76A 3O37A 2RSDA 1JOCA 2NAAA 3PHDA 2MA5A 3SOUA 3IHPA 4PPEA 5EYAF 5JG6A 2JMJA 1FBVA 1E4UA 4I7DA 3ZTGA 2XEUA 2ZETC 5LCWB 3N9OA 3RPGC 5AITA 5B78A 5D1MB 1VD4A 4LJNA 3PUQA 3QZVA 3DQVR 4LADB 1CHCA 3KQIA 4IC2A 5H1UA 2KYUA 1HYIA 2LGVA 1WEOA 2ECJA 3HTKC
chains in the Genus database with same CATH superfamily
3ZYQA 2VPGA 2HYED 3NG2A 2KR4A 1VFYA 4YBSA 3SUBA 5B79A 3FAOA 3V43A 4ZDTA 2YSJA 2ECVA 4YADA 5H1TA 4O64A 4FJCA 3T9KA 2C2VS 2YT5A 3L11A 4OGEA 2MD8C 1U6GB 2PUYA 2L80A 3DDTA 3FL2A 4W4UA 3FM8C 2FFWA 2G45A 2H0DB 2DX8A 2XOYA 4YBTA 1T1HA 1WESA 2LRIC 4FK5A 2KREA 4YC9A 5D1LB 5B77A 2DSMA 2KU3A 2HDPA 2VJEB 4LKAA 2M3HA 5LKTA 3T7LA 5K3QA 2YSMA 2YUCA 4F1PA 5H9MA 4Q6FA 2L43A 5SVYA 2LXPC 2IDAA 2ECGA 3MDBC 4BBQA 2KIZA 3M62A 3I2DA 2IQJA 4GNEA 3MHHA 3ZVYA 2E6SA 2AN6A 4P5OB 2VPBA 5G04B 3O36A 2LQ6A 2BAYA 5LKXA 2Y1MA 2CSYA 2LAUA 4BHWA 1DCQA 2PNXA 2Y1NA 3SOWA 4TKPB 2LXHC 3PLWA 3H7HA 2LGGA 4QQ4A 2VP7A 1LDJB 4QF2A 5FEYA 4CCGX 4B86C 3T6RA 5KH9A 4YBMA 1Z6UA 5TABA 3PURA 3M63A 2Y43A 5TBNA 3DWDA 4A0CD 4LLBA 4XI1A 2QJ0A 3L1XA 5B75A 1K2FA 4I7BA 3C5KA 2L5UA 2EA6A 4AVXA 2G6QA 3LVQE 1ZBDB 2JM3A 4WZ3B 2ECIA 2YW8A 2C2LA 2M6MA 5C13A 2YHOA 3M7KA 3N9MA 2XOCA 2YVRA 2RR4A 2MA6A 3C6WA 4ZUXU 2FSAA 4GB0A 2KGGA 4N3WA 2L75A 4YABA 2K1JA 3VK6A 2MD7B 2KFTA 3KV6A 1JM7A 3ZNIA 3KNVA 5SVIB 1MM2A 2H0DA 4V3KC 3LQIA 2P57A 5G05B 3N9QA 2ECWA 3LQHA 3M99A 4YAXA 5SVXA 1Z60A 3E2DA 4QF3A 5TDRA 3O70A 3O47A 2EXUA 3O35A 2YREA 2FD4A 1RMDA 4R7EA 2ECTA 2QICA 2B0OE 2VPEA 1X4JA 3O7AA 1G25A 1WILA 4R8PK 2YYRA 5AIUA 2OXQC 4WZ0A 2CRWA 2CONA 5KH3A 3FEHA 3LRQA 1FP0A 3O34A 3U5MA 1BORA 4YATA 3HCUA 2YU4A 5FB0A 3U5PA 3SHBA 3LQJA 5TDWA 1F62A 1MBMA 2KE1A 4CA1A 2YHNA 4IC3A 1VYXA 4H9DA 5TRBA 2JMDA 4LK9A 3N9LA 4AP4A 4WZ2A 2VNFA 3U5NA 1LDKC 3JUEA 4FO9A 1WIMA 4O62A 2XP0A 2F42A 4AUQB 1WEQA 5DKAA 3DPLR 2CKLA 2UZGA 5KH7A 2YQLA 3ASLA 5J3XA 4AYCB 2LGKA 4GNDA 4MVTA 2M1RA 3N9NA 3FANA 4A49A 5FB1A 2EGMA 4I7CA 2D8UA 4X3GA 2CSVA 4MSXA 2KKYA 3U5OA 3RTRB 2XOZA 5SVIA 2M85A 2EODA 4N4FA 2CRRA 1WEPA 2VJFB 3LDYA 4NN2A 2FUUA 3ZVZB 2K4DA 4PTBA 5D1KB 1XWHA 2YURA 2KWOA 1WEMA 5FERA 1WGMA 2MUMA 5C11A 1WEUA 4GNGA 2K16A 2MNYA 4V3LC 4S3OB 4F52B 2LGLA 2F6JA 3GV4A 1WENA 5B8DA 5G0FA 5H1VA 1X4IA 2DJAA 2QIZA 2YQMA 1IYMA 2KWJA 3HCTA 4FIPA 2JRJA 1WEVA 2JUNA 1WEWA 1DVPA 3O33A 1WFKA 5LKZA 2F6NA 3GL6A 2CT2A 2L7PA 5I3LA 3EB6A 1HYJA 4UI9B 1WE9A 3L1ZB 4UP0A 4WA6A 4ZQLA 3N9PA 3KV5A 3ZPV1 2RI7A 4OGCA 4Z0RA 4A4BA 5LKUA 4L7XA 3MHSA 1JM7B 2E61A 3RPGB 2LV9A 2KKXA 1MM3A 2KWKA 2I50A 2KGIA 2LDRA 2KWNA 3FJUB 3ZPVE 2L0BA 4L58A 1V87A 2LN0A 4S3OC 1X4UA 3LVRE 2FUIA 2MNZA 2VPDA 2VJFA 2CSZA 1Z2QA 4B7YC 5DINA 2MKEA 2VJEA 4C9ZA 2MIQA 2D8SA 2E6RA 4Z0OA 3SOXA 3HCSA 4A4CA 2MT5A 2M13A 2JMIA 2G43A 2ECNA 4R2YA 2K17A 4AYCA 4GNFA 3EB5A 3KDEC 1N87A 2CKLB 4UP5A 1WEEA 2EGPA 2XB1A 5B76A 3O37A 2RSDA 1JOCA 2NAAA 3PHDA 2MA5A 3SOUA 3IHPA 4PPEA 5EYAF 5JG6A 2JMJA 1FBVA 1E4UA 4I7DA 3ZTGA 2XEUA 2ZETC 5LCWB 3N9OA 3RPGC 5AITA 5B78A 5D1MB 1VD4A 3Q1DA 3LJUX 4LJNA 3PUQA 2OWAA 3DQVR 3QZVA 4LADB 1CHCA 3KQIA 4IC2A 5H1UA 2KYUA 1HYIA 2LGVA 1WEOA 2ECJA 3HTKC
chains in the Genus database with same CATH topology
3ZYQA 2VPGA 2HYED 3NG2A 2KR4A 1VFYA 4YBSA 5B79A 3V43A 4ZDTA 2YSJA 2ECVA 4YADA 5H1TA 4O64A 4FJCA 2C2VS 2YT5A 3L11A 2MD8C 1U6GB 2PUYA 2L80A 3FL2A 4W4UA 2G45A 2H0DB 2DX8A 4YBTA 1T1HA 1WESA 2LRIC 4FK5A 2KREA 4YC9A 5D1LB 5B77A 2KU3A 2HDPA 2VJEB 4LKAA 2M3HA 5LKTA 3T7LA 2YSMA 2YUCA 5H9MA 4Q6FA 2L43A 2LXPC 2IDAA 2ECGA 4BBQA 2KIZA 3M62A 3I2DA 4GNEA 3MHHA 3ZVYA 2E6SA 2AN6A 4P5OB 2VPBA 5G04B 3O36A 2LQ6A 2BAYA 5LKXA 2Y1MA 2CSYA 4BHWA 2PNXA 2Y1NA 3SOWA 4TKPB 2LXHC 2LGGA 2VP7A 1LDJB 4QF2A 5FEYA 4CCGX 4B86C 3T6RA 5KH9A 4YBMA 1Z6UA 5TABA 3PURA 3M63A 2Y43A 5TBNA 4A0CD 4LLBA 4XI1A 2QJ0A 3L1XA 5B75A 1K2FA 4I7BA 3C5KA 2L5UA 2EA6A 4AVXA 2G6QA 1ZBDB 4WZ3B 2ECIA 2YW8A 2C2LA 2M6MA 5C13A 2YHOA 3N9MA 2MA6A 3C6WA 4ZUXU 2FSAA 4GB0A 2KGGA 4N3WA 2L75A 4YABA 2K1JA 3VK6A 2MD7B 2KFTA 3KV6A 1JM7A 3ZNIA 3KNVA 1MM2A 2H0DA 4V3KC 3LQIA 5G05B 3N9QA 2ECWA 3LQHA 3M99A 4YAXA 1Z60A 4QF3A 5TDRA 3O70A 3O35A 2YREA 1RMDA 4R7EA 2ECTA 2QICA 2VPEA 1X4JA 3O7AA 1G25A 1WILA 4R8PK 2YYRA 5AIUA 2OXQC 4WZ0A 5KH3A 3LRQA 1FP0A 3O34A 3U5MA 1BORA 4YATA 3HCUA 2YU4A 5FB0A 3U5PA 3SHBA 3LQJA 5TDWA 1F62A 2KE1A 4CA1A 2YHNA 4IC3A 1VYXA 5TRBA 2JMDA 4LK9A 3N9LA 4AP4A 4WZ2A 2VNFA 3U5NA 1LDKC 4FO9A 1WIMA 2F42A 4AUQB 1WEQA 5DKAA 3DPLR 2CKLA 2UZGA 5KH7A 2YQLA 3ASLA 5J3XA 4AYCB 2LGKA 4GNDA 4MVTA 2M1RA 3N9NA 4A49A 5FB1A 4I7CA 4MSXA 4X3GA 3U5OA 3RTRB 2M85A 2EODA 4N4FA 1WEPA 2VJFB 4NN2A 2FUUA 3ZVZB 2K4DA 4PTBA 5D1KB 1XWHA 2YURA 2KWOA 1WEMA 5FERA 1WGMA 2MUMA 5C11A 1WEUA 4GNGA 2K16A 2MNYA 4V3LC 4S3OB 4F52B 2LGLA 2F6JA 3GV4A 1WENA 5B8DA 5G0FA 5H1VA 1X4IA 2QIZA 2YQMA 1IYMA 2KWJA 3HCTA 4FIPA 2JRJA 1WEVA 1WEWA 1DVPA 3O33A 1WFKA 5LKZA 2F6NA 3GL6A 2CT2A 5I3LA 3EB6A 1HYJA 4UI9B 1WE9A 3L1ZB 4UP0A 4WA6A 4ZQLA 3N9PA 3KV5A 3ZPV1 2RI7A 4A4BA 5LKUA 4L7XA 3MHSA 1JM7B 3RPGB 2LV9A 1MM3A 2KWKA 2I50A 2KGIA 2LDRA 2KWNA 3ZPVE 2L0BA 4L58A 1V87A 2LN0A 4S3OC 1X4UA 2FUIA 2MNZA 2VPDA 2VJFA 2CSZA 1Z2QA 4B7YC 5DINA 4C9ZA 2VJEA 2MIQA 2D8SA 2E6RA 3SOXA 3HCSA 4A4CA 2MT5A 2JMIA 2G43A 2ECNA 4R2YA 2K17A 4AYCA 4GNFA 3EB5A 1N87A 2CKLB 4UP5A 1WEEA 2EGPA 2XB1A 5B76A 3O37A 2RSDA 1JOCA 2NAAA 3PHDA 2MA5A 3SOUA 3IHPA 4PPEA 5EYAF 5JG6A 2JMJA 1FBVA 1E4UA 4I7DA 3ZTGA 2XEUA 2ZETC 5LCWB 3N9OA 3RPGC 5AITA 5B78A 5D1MB 1VD4A 4LJNA 3PUQA 3QZVA 3DQVR 4LADB 1CHCA 3KQIA 4IC2A 5H1UA 2KYUA 1HYIA 2LGVA 1WEOA 2ECJA 3HTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYQ A;  2VPG A;  2HYE D;  3NG2 A;  2KR4 A;  1VFY A;  4YBS A;  5B79 A;  3V43 A;  4ZDT A;  2YSJ A;  2ECV A;  4YAD A;  5H1T A;  4O64 A;  4FJC A;  2C2V S;  2YT5 A;  3L11 A;  2MD8 C;  1U6G B;  2PUY A;  2L80 A;  3FL2 A;  4W4U A;  2G45 A;  2H0D B;  2DX8 A;  4YBT A;  1T1H A;  1WES A;  2LRI C;  4FK5 A;  2KRE A;  4YC9 A;  5D1L B;  5B77 A;  2KU3 A;  2HDP A;  2VJE B;  4LKA A;  2M3H A;  5LKT A;  3T7L A;  2YSM A;  2YUC A;  5H9M A;  4Q6F A;  2L43 A;  2LXP C;  2IDA A;  2ECG A;  4BBQ A;  2KIZ A;  3M62 A;  3I2D A;  4GNE A;  3MHH A;  3ZVY A;  2E6S A;  2AN6 A;  4P5O B;  2VPB A;  5G04 B;  3O36 A;  2LQ6 A;  2BAY A;  5LKX A;  2Y1M A;  2CSY A;  4BHW A;  2PNX A;  2Y1N A;  3SOW A;  4TKP B;  2LXH C;  2LGG A;  2VP7 A;  1LDJ B;  4QF2 A;  5FEY A;  4CCG X;  4B86 C;  3T6R A;  5KH9 A;  4YBM A;  1Z6U A;  5TAB A;  3PUR A;  3M63 A;  2Y43 A;  5TBN A;  4A0C D;  4LLB A;  4XI1 A;  2QJ0 A;  3L1X A;  5B75 A;  1K2F A;  4I7B A;  3C5K A;  2L5U A;  2EA6 A;  4AVX A;  2G6Q A;  1ZBD B;  4WZ3 B;  2ECI A;  2YW8 A;  2C2L A;  2M6M A;  5C13 A;  2YHO A;  3N9M A;  2MA6 A;  3C6W A;  4ZUX U;  2FSA A;  4GB0 A;  2KGG A;  4N3W A;  2L75 A;  4YAB A;  2K1J A;  3VK6 A;  2MD7 B;  2KFT A;  3KV6 A;  1JM7 A;  3ZNI A;  3KNV A;  1MM2 A;  2H0D A;  4V3K C;  3LQI A;  5G05 B;  3N9Q A;  2ECW A;  3LQH A;  3M99 A;  4YAX A;  1Z60 A;  4QF3 A;  5TDR A;  3O70 A;  3O35 A;  2YRE A;  1RMD A;  4R7E A;  2ECT A;  2QIC A;  2VPE A;  1X4J A;  3O7A A;  1G25 A;  1WIL A;  4R8P K;  2YYR A;  5AIU A;  2OXQ C;  4WZ0 A;  5KH3 A;  3LRQ A;  1FP0 A;  3O34 A;  3U5M A;  1BOR A;  4YAT A;  3HCU A;  2YU4 A;  5FB0 A;  3U5P A;  3SHB A;  3LQJ A;  5TDW A;  1F62 A;  2KE1 A;  4CA1 A;  2YHN A;  4IC3 A;  1VYX A;  5TRB A;  2JMD A;  4LK9 A;  3N9L A;  4AP4 A;  4WZ2 A;  2VNF A;  3U5N A;  1LDK C;  4FO9 A;  1WIM A;  2F42 A;  4AUQ B;  1WEQ A;  5DKA A;  3DPL R;  2CKL A;  2UZG A;  5KH7 A;  2YQL A;  3ASL A;  5J3X A;  4AYC B;  2LGK A;  4GND A;  4MVT A;  2M1R A;  3N9N A;  4A49 A;  5FB1 A;  4I7C A;  4MSX A;  4X3G A;  3U5O A;  3RTR B;  2M85 A;  2EOD A;  4N4F A;  1WEP A;  2VJF B;  4NN2 A;  2FUU A;  3ZVZ B;  2K4D A;  4PTB A;  5D1K B;  1XWH A;  2YUR A;  2KWO A;  1WEM A;  5FER A;  1WGM A;  2MUM A;  5C11 A;  1WEU A;  4GNG A;  2K16 A;  2MNY A;  4V3L C;  4S3O B;  4F52 B;  2LGL A;  2F6J A;  3GV4 A;  1WEN A;  5B8D A;  5G0F A;  5H1V A;  1X4I A;  2QIZ A;  2YQM A;  1IYM A;  2KWJ A;  3HCT A;  4FIP A;  2JRJ A;  1WEV A;  1WEW A;  1DVP A;  3O33 A;  1WFK A;  5LKZ A;  2F6N A;  3GL6 A;  2CT2 A;  5I3L A;  3EB6 A;  1HYJ A;  4UI9 B;  1WE9 A;  3L1Z B;  4UP0 A;  4WA6 A;  4ZQL A;  3N9P A;  3KV5 A;  3ZPV 1;  2RI7 A;  4A4B A;  5LKU A;  4L7X A;  3MHS A;  1JM7 B;  3RPG B;  2LV9 A;  1MM3 A;  2KWK A;  2I50 A;  2KGI A;  2LDR A;  2KWN A;  3ZPV E;  2L0B A;  4L58 A;  1V87 A;  2LN0 A;  4S3O C;  1X4U A;  2FUI A;  2MNZ A;  2VPD A;  2VJF A;  2CSZ A;  1Z2Q A;  4B7Y C;  5DIN A;  4C9Z A;  2VJE A;  2MIQ A;  2D8S A;  2E6R A;  3SOX A;  3HCS A;  4A4C A;  2MT5 A;  2JMI A;  2G43 A;  2ECN A;  4R2Y A;  2K17 A;  4AYC A;  4GNF A;  3EB5 A;  1N87 A;  2CKL B;  4UP5 A;  1WEE A;  2EGP A;  2XB1 A;  5B76 A;  3O37 A;  2RSD A;  1JOC A;  2NAA A;  3PHD A;  2MA5 A;  3SOU A;  3IHP A;  4PPE A;  5EYA F;  5JG6 A;  2JMJ A;  1FBV A;  1E4U A;  4I7D A;  3ZTG A;  2XEU A;  2ZET C;  5LCW B;  3N9O A;  3RPG C;  5AIT A;  5B78 A;  5D1M B;  1VD4 A;  4LJN A;  3PUQ A;  3QZV A;  3DQV R;  4LAD B;  1CHC A;  3KQI A;  4IC2 A;  5H1U A;  2KYU A;  1HYI A;  2LGV A;  1WEO A;  2ECJ A;  3HTK C; 
#chains in the Genus database with same CATH topology
 3ZYQ A;  2VPG A;  2HYE D;  3NG2 A;  2KR4 A;  1VFY A;  4YBS A;  3SUB A;  5B79 A;  3FAO A;  3V43 A;  4ZDT A;  2YSJ A;  2ECV A;  4YAD A;  5H1T A;  4O64 A;  4FJC A;  3T9K A;  2C2V S;  2YT5 A;  3L11 A;  4OGE A;  2MD8 C;  1U6G B;  2PUY A;  2L80 A;  3DDT A;  3FL2 A;  4W4U A;  3FM8 C;  2FFW A;  2G45 A;  2H0D B;  2DX8 A;  2XOY A;  4YBT A;  1T1H A;  1WES A;  2LRI C;  4FK5 A;  2KRE A;  4YC9 A;  5D1L B;  5B77 A;  2DSM A;  2KU3 A;  2HDP A;  2VJE B;  4LKA A;  2M3H A;  5LKT A;  3T7L A;  5K3Q A;  2YSM A;  2YUC A;  4F1P A;  5H9M A;  4Q6F A;  2L43 A;  5SVY A;  2LXP C;  2IDA A;  2ECG A;  3MDB C;  4BBQ A;  2KIZ A;  3M62 A;  3I2D A;  2IQJ A;  4GNE A;  3MHH A;  3ZVY A;  2E6S A;  2AN6 A;  4P5O B;  2VPB A;  5G04 B;  3O36 A;  2LQ6 A;  2BAY A;  5LKX A;  2Y1M A;  2CSY A;  2LAU A;  4BHW A;  1DCQ A;  2PNX A;  2Y1N A;  3SOW A;  4TKP B;  2LXH C;  3PLW A;  3H7H A;  2LGG A;  4QQ4 A;  2VP7 A;  1LDJ B;  4QF2 A;  5FEY A;  4CCG X;  4B86 C;  3T6R A;  5KH9 A;  4YBM A;  1Z6U A;  5TAB A;  3PUR A;  3M63 A;  2Y43 A;  5TBN A;  3DWD A;  4A0C D;  4LLB A;  4XI1 A;  2QJ0 A;  3L1X A;  5B75 A;  1K2F A;  4I7B A;  3C5K A;  2L5U A;  2EA6 A;  4AVX A;  2G6Q A;  3LVQ E;  1ZBD B;  2JM3 A;  4WZ3 B;  2ECI A;  2YW8 A;  2C2L A;  2M6M A;  5C13 A;  2YHO A;  3M7K A;  3N9M A;  2XOC A;  2YVR A;  2RR4 A;  2MA6 A;  3C6W A;  4ZUX U;  2FSA A;  4GB0 A;  2KGG A;  4N3W A;  2L75 A;  4YAB A;  2K1J A;  3VK6 A;  2MD7 B;  2KFT A;  3KV6 A;  1JM7 A;  3ZNI A;  3KNV A;  5SVI B;  1MM2 A;  2H0D A;  4V3K C;  3LQI A;  2P57 A;  5G05 B;  3N9Q A;  2ECW A;  3LQH A;  3M99 A;  4YAX A;  5SVX A;  1Z60 A;  3E2D A;  4QF3 A;  5TDR A;  3O70 A;  3O47 A;  2EXU A;  3O35 A;  2YRE A;  2FD4 A;  1RMD A;  4R7E A;  2ECT A;  2QIC A;  2B0O E;  2VPE A;  1X4J A;  3O7A A;  1G25 A;  1WIL A;  4R8P K;  2YYR A;  5AIU A;  2OXQ C;  4WZ0 A;  2CRW A;  2CON A;  5KH3 A;  3FEH A;  3LRQ A;  1FP0 A;  3O34 A;  3U5M A;  1BOR A;  4YAT A;  3HCU A;  2YU4 A;  5FB0 A;  3U5P A;  3SHB A;  3LQJ A;  5TDW A;  1F62 A;  1MBM A;  2KE1 A;  4CA1 A;  2YHN A;  4IC3 A;  1VYX A;  4H9D A;  5TRB A;  2JMD A;  4LK9 A;  3N9L A;  4AP4 A;  4WZ2 A;  2VNF A;  3U5N A;  1LDK C;  3JUE A;  4FO9 A;  1WIM A;  4O62 A;  2XP0 A;  2F42 A;  4AUQ B;  1WEQ A;  5DKA A;  3DPL R;  2CKL A;  2UZG A;  5KH7 A;  2YQL A;  3ASL A;  5J3X A;  4AYC B;  2LGK A;  4GND A;  4MVT A;  2M1R A;  3N9N A;  3FAN A;  4A49 A;  5FB1 A;  2EGM A;  4I7C A;  2D8U A;  4X3G A;  2CSV A;  4MSX A;  2KKY A;  3U5O A;  3RTR B;  2XOZ A;  5SVI A;  2M85 A;  2EOD A;  4N4F A;  2CRR A;  1WEP A;  2VJF B;  3LDY A;  4NN2 A;  2FUU A;  3ZVZ B;  2K4D A;  4PTB A;  5D1K B;  1XWH A;  2YUR A;  2KWO A;  1WEM A;  5FER A;  1WGM A;  2MUM A;  5C11 A;  1WEU A;  4GNG A;  2K16 A;  2MNY A;  4V3L C;  4S3O B;  4F52 B;  2LGL A;  2F6J A;  3GV4 A;  1WEN A;  5B8D A;  5G0F A;  5H1V A;  1X4I A;  2DJA A;  2QIZ A;  2YQM A;  1IYM A;  2KWJ A;  3HCT A;  4FIP A;  2JRJ A;  1WEV A;  2JUN A;  1WEW A;  1DVP A;  3O33 A;  1WFK A;  5LKZ A;  2F6N A;  3GL6 A;  2CT2 A;  2L7P A;  5I3L A;  3EB6 A;  1HYJ A;  4UI9 B;  1WE9 A;  3L1Z B;  4UP0 A;  4WA6 A;  4ZQL A;  3N9P A;  3KV5 A;  3ZPV 1;  2RI7 A;  4OGC A;  4Z0R A;  4A4B A;  5LKU A;  4L7X A;  3MHS A;  1JM7 B;  2E61 A;  3RPG B;  2LV9 A;  2KKX A;  1MM3 A;  2KWK A;  2I50 A;  2KGI A;  2LDR A;  2KWN A;  3FJU B;  3ZPV E;  2L0B A;  4L58 A;  1V87 A;  2LN0 A;  4S3O C;  1X4U A;  3LVR E;  2FUI A;  2MNZ A;  2VPD A;  2VJF A;  2CSZ A;  1Z2Q A;  4B7Y C;  5DIN A;  2MKE A;  2VJE A;  4C9Z A;  2MIQ A;  2D8S A;  2E6R A;  4Z0O A;  3SOX A;  3HCS A;  4A4C A;  2MT5 A;  2M13 A;  2JMI A;  2G43 A;  2ECN A;  4R2Y A;  2K17 A;  4AYC A;  4GNF A;  3EB5 A;  3KDE C;  1N87 A;  2CKL B;  4UP5 A;  1WEE A;  2EGP A;  2XB1 A;  5B76 A;  3O37 A;  2RSD A;  1JOC A;  2NAA A;  3PHD A;  2MA5 A;  3SOU A;  3IHP A;  4PPE A;  5EYA F;  5JG6 A;  2JMJ A;  1FBV A;  1E4U A;  4I7D A;  3ZTG A;  2XEU A;  2ZET C;  5LCW B;  3N9O A;  3RPG C;  5AIT A;  5B78 A;  5D1M B;  1VD4 A;  3Q1D A;  3LJU X;  4LJN A;  3PUQ A;  2OWA A;  3DQV R;  3QZV A;  4LAD B;  1CHC A;  3KQI A;  4IC2 A;  5H1U A;  2KYU A;  1HYI A;  2LGV A;  1WEO A;  2ECJ A;  3HTK C; 
#chains in the Genus database with same CATH homology
 3ZYQ A;  2VPG A;  2HYE D;  3NG2 A;  2KR4 A;  1VFY A;  4YBS A;  5B79 A;  3V43 A;  4ZDT A;  2YSJ A;  2ECV A;  4YAD A;  5H1T A;  4O64 A;  4FJC A;  2C2V S;  2YT5 A;  3L11 A;  2MD8 C;  1U6G B;  2PUY A;  2L80 A;  3FL2 A;  4W4U A;  2G45 A;  2H0D B;  2DX8 A;  4YBT A;  1T1H A;  1WES A;  2LRI C;  4FK5 A;  2KRE A;  4YC9 A;  5D1L B;  5B77 A;  2KU3 A;  2HDP A;  2VJE B;  4LKA A;  2M3H A;  5LKT A;  3T7L A;  2YSM A;  2YUC A;  5H9M A;  4Q6F A;  2L43 A;  2LXP C;  2IDA A;  2ECG A;  4BBQ A;  2KIZ A;  3M62 A;  3I2D A;  4GNE A;  3MHH A;  3ZVY A;  2E6S A;  2AN6 A;  4P5O B;  2VPB A;  5G04 B;  3O36 A;  2LQ6 A;  2BAY A;  5LKX A;  2Y1M A;  2CSY A;  4BHW A;  2PNX A;  2Y1N A;  3SOW A;  4TKP B;  2LXH C;  2LGG A;  2VP7 A;  1LDJ B;  4QF2 A;  5FEY A;  4CCG X;  4B86 C;  3T6R A;  5KH9 A;  4YBM A;  1Z6U A;  5TAB A;  3PUR A;  3M63 A;  2Y43 A;  5TBN A;  4A0C D;  4LLB A;  4XI1 A;  2QJ0 A;  3L1X A;  5B75 A;  1K2F A;  4I7B A;  3C5K A;  2L5U A;  2EA6 A;  4AVX A;  2G6Q A;  1ZBD B;  4WZ3 B;  2ECI A;  2YW8 A;  2C2L A;  2M6M A;  5C13 A;  2YHO A;  3N9M A;  2MA6 A;  3C6W A;  4ZUX U;  2FSA A;  4GB0 A;  2KGG A;  4N3W A;  2L75 A;  4YAB A;  2K1J A;  3VK6 A;  2MD7 B;  2KFT A;  3KV6 A;  1JM7 A;  3ZNI A;  3KNV A;  1MM2 A;  2H0D A;  4V3K C;  3LQI A;  5G05 B;  3N9Q A;  2ECW A;  3LQH A;  3M99 A;  4YAX A;  1Z60 A;  4QF3 A;  5TDR A;  3O70 A;  3O35 A;  2YRE A;  1RMD A;  4R7E A;  2ECT A;  2QIC A;  2VPE A;  1X4J A;  3O7A A;  1G25 A;  1WIL A;  4R8P K;  2YYR A;  5AIU A;  2OXQ C;  4WZ0 A;  5KH3 A;  3LRQ A;  1FP0 A;  3O34 A;  3U5M A;  1BOR A;  4YAT A;  3HCU A;  2YU4 A;  5FB0 A;  3U5P A;  3SHB A;  3LQJ A;  5TDW A;  1F62 A;  2KE1 A;  4CA1 A;  2YHN A;  4IC3 A;  1VYX A;  5TRB A;  2JMD A;  4LK9 A;  3N9L A;  4AP4 A;  4WZ2 A;  2VNF A;  3U5N A;  1LDK C;  4FO9 A;  1WIM A;  2F42 A;  4AUQ B;  1WEQ A;  5DKA A;  3DPL R;  2CKL A;  2UZG A;  5KH7 A;  2YQL A;  3ASL A;  5J3X A;  4AYC B;  2LGK A;  4GND A;  4MVT A;  2M1R A;  3N9N A;  4A49 A;  5FB1 A;  4I7C A;  4MSX A;  4X3G A;  3U5O A;  3RTR B;  2M85 A;  2EOD A;  4N4F A;  1WEP A;  2VJF B;  4NN2 A;  2FUU A;  3ZVZ B;  2K4D A;  4PTB A;  5D1K B;  1XWH A;  2YUR A;  2KWO A;  1WEM A;  5FER A;  1WGM A;  2MUM A;  5C11 A;  1WEU A;  4GNG A;  2K16 A;  2MNY A;  4V3L C;  4S3O B;  4F52 B;  2LGL A;  2F6J A;  3GV4 A;  1WEN A;  5B8D A;  5G0F A;  5H1V A;  1X4I A;  2QIZ A;  2YQM A;  1IYM A;  2KWJ A;  3HCT A;  4FIP A;  2JRJ A;  1WEV A;  1WEW A;  1DVP A;  3O33 A;  1WFK A;  5LKZ A;  2F6N A;  3GL6 A;  2CT2 A;  5I3L A;  3EB6 A;  1HYJ A;  4UI9 B;  1WE9 A;  3L1Z B;  4UP0 A;  4WA6 A;  4ZQL A;  3N9P A;  3KV5 A;  3ZPV 1;  2RI7 A;  4A4B A;  5LKU A;  4L7X A;  3MHS A;  1JM7 B;  3RPG B;  2LV9 A;  1MM3 A;  2KWK A;  2I50 A;  2KGI A;  2LDR A;  2KWN A;  3ZPV E;  2L0B A;  4L58 A;  1V87 A;  2LN0 A;  4S3O C;  1X4U A;  2FUI A;  2MNZ A;  2VPD A;  2VJF A;  2CSZ A;  1Z2Q A;  4B7Y C;  5DIN A;  4C9Z A;  2VJE A;  2MIQ A;  2D8S A;  2E6R A;  3SOX A;  3HCS A;  4A4C A;  2MT5 A;  2JMI A;  2G43 A;  2ECN A;  4R2Y A;  2K17 A;  4AYC A;  4GNF A;  3EB5 A;  1N87 A;  2CKL B;  4UP5 A;  1WEE A;  2EGP A;  2XB1 A;  5B76 A;  3O37 A;  2RSD A;  1JOC A;  2NAA A;  3PHD A;  2MA5 A;  3SOU A;  3IHP A;  4PPE A;  5EYA F;  5JG6 A;  2JMJ A;  1FBV A;  1E4U A;  4I7D A;  3ZTG A;  2XEU A;  2ZET C;  5LCW B;  3N9O A;  3RPG C;  5AIT A;  5B78 A;  5D1M B;  1VD4 A;  4LJN A;  3PUQ A;  3QZV A;  3DQV R;  4LAD B;  1CHC A;  3KQI A;  4IC2 A;  5H1U A;  2KYU A;  1HYI A;  2LGV A;  1WEO A;  2ECJ A;  3HTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...