1VYXA

Solution structure of the kshv k3 n-terminal domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
MEDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Kaposi'S Sarcoma-Associated Herpesvirus K3 N-Terminal Domain Reveals a Novel E2-Binding C4Hc3-Type Ring Domain
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Zinc-binding protein
molecule keywords ORF K3
total genus 5
structure length 60
sequence length 60
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12906 RINGv RING-variant domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vyxA00
3O7AA 1WILA 2EGPA 3ZVZB 2KR4A 2K4DA 4YBTA 5B75A 1ZBDB 3SOWA 2LGGA 3VK6A 2CSZA 4L58A 3L11A 5D1MB 4XI1A 2MUMA 3NG2A 4ZDTA 1MM3A 3RPGB 5TABA 5D1LB 3O34A 2F42A 2VP7A 2PUYA 2LGVA 1WENA 4P5OB 2VPGA 2ECJA 3PURA 1JOCA 3QZVA 5AIUA 2D8SA 4FJCA 5G0FA 4B86C 4AVXA 2MD7B 1WESA 2BAYA 1DVPA 2KIZA 3MHHA 3L1XA 3O33A 1V87A 4YADA 2QICA 1VD4A 5B76A 4FK5A 2CKLA 4N3WA 5TDWA 2KWKA 2C2VS 4YABA 3C6WA 1Z2QA 2XB1A 1WEEA 3T6RA 3U5NA 1JM7A 3MHSA 5LKTA 3HTKC 3GV4A 3LQJA 2ECTA 2M85A 2UZGA 3L1ZB 4GB0A 2YSJA 4LADB 1RMDA 3O35A 5LKZA 4W4UA 2MNYA 4A49A 4YC9A 5TRBA 3N9NA 4MSXA 4AYCA 2JMJA 4IC2A 2H0DB 5H1VA 4UI9B 2YYRA 2ECIA 1CHCA 2MA6A 4I7DA 4L7XA 5KH9A 5FB1A 1Z60A 2YQLA 3LQHA 4A4BA 2OXQC 4WZ2A 4S3OB 4R8PK 2CT2A 2KFTA 2VJEB 2LDRA 1X4IA 4X3GA 2JMIA 4S3OC 5B79A 4A4CA 5TBNA 5KH3A 3C5KA 2QIZA 5LKXA 2VJFA 2LXPC 3M62A 2H0DA 3V43A 4B7YC 3N9OA 1XWHA 4FIPA 2CKLB 5H1UA 2LV9A 4WZ3B 3ZNIA 2M3HA 2G6QA 4TKPB 3LQIA 2VNFA 4LKAA 1WEVA 4ZUXU 2EODA 1WEPA 2L43A 1FBVA 1X4JA 4V3LC 2VJFB 4MVTA 4BHWA 5C11A 5C13A 5FERA 4WA6A 5TDRA 3HCSA 3SHBA 2HDPA 4IC3A 3HCUA 4N4FA 1T1HA 3DQVR 2CSYA 1VYXA 2L80A 4R7EA 3DPLR 3N9QA 2JRJA 2LGLA 3N9LA 2K17A 1WFKA 3U5MA 3O36A 3RPGC 4UP5A 2KWNA 2L0BA 2NAAA 2FUUA 2KE1A 2K1JA 5J3XA 2YU4A 2L5UA 4V3KC 3M63A 4F52B 2K16A 3O70A 3EB6A 1JM7B 3ZVYA 5G05B 2PNXA 4LLBA 2ZETC 4C9ZA 2F6JA 2KWOA 3LRQA 1VFYA 5H1TA 1WEQA 1WEUA 2MT5A 3KV6A 2KWJA 2FUIA 1WEWA 2YURA 4FO9A 1N87A 4YBMA 4LJNA 1WEMA 3ZTGA 2YREA 4R2YA 5DINA 3GL6A 1IYMA 5DKAA 2YHOA 4LK9A 3KNVA 1MM2A 3ZYQA 5FEYA 5KH7A 4QF3A 2YT5A 2DX8A 2FSAA 2M6MA 1LDKC 2KYUA 2VJEA 4WZ0A 3M99A 2G43A 2MNZA 2VPEA 2HYED 4O64A 4YAXA 1G25A 2MA5A 5FB0A 2VPBA 4CA1A 1K2FA 1F62A 2ECNA 3SOXA 3T7LA 4CCGX 3PUQA 1E4UA 1WE9A 3I2DA 4QF2A 2YQMA 5D1KB 2QJ0A 3O37A 4GNDA 1WGMA 2F6NA 4AYCB 1BORA 2ECWA 2Y1NA 1Z6UA 4ZQLA 4UP0A 4YATA 2Y43A 5B77A 3KQIA 5B78A 4YBSA 2MD8C 5AITA 2KU3A 3ASLA 3EB5A 3N9PA 2KGGA 2Y1MA 4AUQB 2MIQA 4BBQA 1U6GB 2LRIC 1HYJA 2IDAA 5JG6A 2JMDA 1WIMA 2VPDA 5LKUA 4A0CD 1X4UA 2KREA 2LN0A 4PPEA 2YW8A 2I50A 2M1RA 2YHNA 4NN2A 2EA6A 3PHDA 4AP4A 3ZPV1 4GNFA 2E6SA 2AN6A 2L75A 3U5OA 3IHPA 4I7CA 2G45A 3ZPVE 3U5PA 2YUCA 1FP0A 4PTBA 2ECGA 3RTRB 2RSDA 2XEUA 3HCTA 1LDJB 1WEOA 4I7BA 3SOUA 5EYAF 3FL2A 2KGIA 2RI7A 5I3LA 2LGKA 3KV5A 4GNGA 2YSMA 2LQ6A 4Q6FA 5H9MA 4GNEA 3N9MA 2C2LA 2E6RA 5B8DA 2LXHC 5LCWB 1HYIA 5G04B 2ECVA
chains in the Genus database with same CATH superfamily
3O7AA 1WILA 2EGPA 3ZVZB 2KR4A 2K4DA 4YBTA 5B75A 1ZBDB 3SOWA 2LGGA 3VK6A 2CSZA 4L58A 3L11A 1DCQA 5D1MB 4XI1A 2MUMA 3E2DA 3NG2A 4ZDTA 1MM3A 3RPGB 5TABA 2EGMA 5D1LB 3O34A 2F42A 2VP7A 2PUYA 2LGVA 1WENA 4P5OB 2VPGA 2ECJA 3PURA 1JOCA 3QZVA 5AIUA 2XOZA 2D8SA 2KKYA 4FJCA 5G0FA 4B86C 4AVXA 2MD7B 1WESA 3FM8C 2BAYA 1DVPA 2KKXA 3LDYA 2KIZA 3MHHA 3L1XA 3O33A 1V87A 4YADA 2QICA 1VD4A 5B76A 4FK5A 2CKLA 4N3WA 5TDWA 2KWKA 2C2VS 3LVRE 4YABA 3C6WA 1Z2QA 2XB1A 1WEEA 3T6RA 3U5NA 4Z0OA 1JM7A 3MHSA 5LKTA 3HTKC 3GV4A 5SVXA 3LQJA 2ECTA 2M85A 2UZGA 3L1ZB 3MDBC 4GB0A 2YSJA 4LADB 1RMDA 3O35A 5LKZA 4W4UA 2MNYA 4A49A 4YC9A 5TRBA 3N9NA 4MSXA 4AYCA 2JMJA 4IC2A 2H0DB 5H1VA 4UI9B 2YYRA 2ECIA 1CHCA 4H9DA 2MA6A 4I7DA 4L7XA 5KH9A 5FB1A 1Z60A 2YQLA 3LQHA 4A4BA 2OXQC 4WZ2A 4S3OB 4R8PK 2CT2A 2KFTA 2VJEB 2LDRA 1X4IA 4X3GA 2JMIA 3JUEA 4S3OC 5B79A 2D8UA 4A4CA 3SUBA 5TBNA 5KH3A 2XP0A 3C5KA 2M13A 2QIZA 5LKXA 2VJFA 3Q1DA 2LXPC 3M62A 2H0DA 3V43A 4B7YC 3N9OA 1XWHA 4FIPA 2CKLB 5H1UA 2LV9A 4WZ3B 1MBMA 3ZNIA 2M3HA 4OGCA 2G6QA 4TKPB 3LQIA 2VNFA 4LKAA 1WEVA 4ZUXU 2EODA 1WEPA 3LJUX 2L43A 1FBVA 1X4JA 4V3LC 2VJFB 4MVTA 4BHWA 5C11A 2JUNA 5C13A 5FERA 4WA6A 2CRRA 5TDRA 3HCSA 3SHBA 4OGEA 2HDPA 4IC3A 3HCUA 4N4FA 1T1HA 3DQVR 2CSYA 2JM3A 1VYXA 2L80A 2L7PA 4R7EA 3DPLR 3N9QA 2JRJA 3DDTA 2LGLA 3N9LA 2K17A 2ECVA 1WFKA 3U5MA 3O36A 3RPGC 4UP5A 3DWDA 2KWNA 2L0BA 2NAAA 2FUUA 2IQJA 2KE1A 2K1JA 3KDEC 5J3XA 2YU4A 2L5UA 4V3KC 3M63A 4F52B 2K16A 3O70A 3EB6A 1JM7B 3ZVYA 5G05B 2PNXA 4LLBA 2ZETC 4QQ4A 2XOYA 4C9ZA 2F6JA 2KWOA 3LRQA 1VFYA 5H1TA 1WEQA 1WEUA 2MT5A 3KV6A 2KWJA 3M7KA 2MKEA 2FUIA 3FANA 1WEWA 2YURA 4FO9A 1N87A 2OWAA 3LVQE 4YBMA 4LJNA 1WEMA 2FD4A 2CSVA 3ZTGA 2YREA 4R2YA 5DINA 3GL6A 5SVYA 1IYMA 5DKAA 2YHOA 3O47A 4LK9A 3KNVA 1MM2A 3FAOA 3ZYQA 5FEYA 5KH7A 4QF3A 2YT5A 2DX8A 2XOCA 2FSAA 2M6MA 1LDKC 2KYUA 2VJEA 4WZ0A 3M99A 2G43A 2MNZA 2VPEA 2HYED 4O64A 4YAXA 1G25A 2MA5A 5FB0A 2VPBA 4CA1A 1K2FA 1F62A 2ECNA 4O62A 3SOXA 3T7LA 4CCGX 3PUQA 1E4UA 1WE9A 3I2DA 4QF2A 2YQMA 5D1KB 4Z0RA 2QJ0A 3O37A 4GNDA 1WGMA 2F6NA 4AYCB 1BORA 2ECWA 2Y1NA 1Z6UA 5K3QA 2B0OE 4ZQLA 5SVIB 4UP0A 4YATA 2Y43A 5B77A 3KQIA 5B78A 4YBSA 2MD8C 5AITA 2KU3A 3ASLA 3EB5A 3N9PA 2KGGA 2Y1MA 4AUQB 2MIQA 4BBQA 1U6GB 2LRIC 3PLWA 1HYJA 2IDAA 5JG6A 2DJAA 2JMDA 1WIMA 2VPDA 2FFWA 5LKUA 2YVRA 4A0CD 1X4UA 2KREA 2E61A 3T9KA 2LN0A 2P57A 4PPEA 2YW8A 2I50A 2M1RA 2YHNA 4NN2A 2EA6A 3PHDA 4AP4A 3ZPV1 4GNFA 2E6SA 2AN6A 2L75A 5SVIA 3U5OA 2EXUA 3IHPA 4I7CA 2CRWA 2G45A 3ZPVE 3U5PA 2YUCA 2RR4A 1FP0A 4PTBA 2ECGA 3RTRB 2RSDA 2XEUA 2DSMA 3HCTA 1LDJB 1WEOA 4I7BA 3SOUA 5EYAF 4F1PA 3FL2A 2KGIA 2RI7A 5I3LA 3FEHA 2LGKA 3KV5A 4GNGA 2YSMA 2LQ6A 4Q6FA 5H9MA 4GNEA 2LAUA 2CONA 3N9MA 2C2LA 2E6RA 5B8DA 3FJUB 2LXHC 5LCWB 1HYIA 5G04B 3H7HA
chains in the Genus database with same CATH topology
3O7AA 1WILA 2EGPA 3ZVZB 2KR4A 2K4DA 4YBTA 5B75A 1ZBDB 3SOWA 2LGGA 3VK6A 2CSZA 4L58A 3L11A 5D1MB 4XI1A 2MUMA 3NG2A 4ZDTA 1MM3A 3RPGB 5TABA 5D1LB 3O34A 2F42A 2VP7A 2PUYA 2LGVA 1WENA 4P5OB 2VPGA 2ECJA 3PURA 1JOCA 3QZVA 5AIUA 2D8SA 4FJCA 5G0FA 4B86C 4AVXA 2MD7B 1WESA 2BAYA 1DVPA 2KIZA 3MHHA 3L1XA 3O33A 1V87A 4YADA 2QICA 1VD4A 5B76A 4FK5A 2CKLA 4N3WA 5TDWA 2KWKA 2C2VS 4YABA 3C6WA 1Z2QA 2XB1A 1WEEA 3T6RA 3U5NA 1JM7A 3MHSA 5LKTA 3HTKC 3GV4A 3LQJA 2ECTA 2M85A 2UZGA 3L1ZB 4GB0A 2YSJA 4LADB 1RMDA 3O35A 5LKZA 4W4UA 2MNYA 4A49A 4YC9A 5TRBA 3N9NA 4MSXA 4AYCA 2JMJA 4IC2A 2H0DB 5H1VA 4UI9B 2YYRA 2ECIA 1CHCA 2MA6A 4I7DA 4L7XA 5KH9A 5FB1A 1Z60A 2YQLA 3LQHA 4A4BA 2OXQC 4WZ2A 4S3OB 4R8PK 2CT2A 2KFTA 2VJEB 2LDRA 1X4IA 4X3GA 2JMIA 4S3OC 5B79A 4A4CA 5TBNA 5KH3A 3C5KA 2QIZA 5LKXA 2VJFA 2LXPC 3M62A 2H0DA 3V43A 4B7YC 3N9OA 1XWHA 4FIPA 2CKLB 5H1UA 2LV9A 4WZ3B 3ZNIA 2M3HA 2G6QA 4TKPB 3LQIA 2VNFA 4LKAA 1WEVA 4ZUXU 2EODA 1WEPA 2L43A 1FBVA 1X4JA 4V3LC 2VJFB 4MVTA 4BHWA 5C11A 5C13A 5FERA 4WA6A 5TDRA 3HCSA 3SHBA 2HDPA 4IC3A 3HCUA 4N4FA 1T1HA 3DQVR 2CSYA 1VYXA 2L80A 4R7EA 3DPLR 3N9QA 2JRJA 2LGLA 3N9LA 2K17A 1WFKA 3U5MA 3O36A 3RPGC 4UP5A 2KWNA 2L0BA 2NAAA 2FUUA 2KE1A 2K1JA 5J3XA 2YU4A 2L5UA 4V3KC 3M63A 4F52B 2K16A 3O70A 3EB6A 1JM7B 3ZVYA 5G05B 2PNXA 4LLBA 2ZETC 4C9ZA 2F6JA 2KWOA 3LRQA 1VFYA 5H1TA 1WEQA 1WEUA 2MT5A 3KV6A 2KWJA 2FUIA 1WEWA 2YURA 4FO9A 1N87A 4YBMA 4LJNA 1WEMA 3ZTGA 2YREA 4R2YA 5DINA 3GL6A 1IYMA 5DKAA 2YHOA 4LK9A 3KNVA 1MM2A 3ZYQA 5FEYA 5KH7A 4QF3A 2YT5A 2DX8A 2FSAA 2M6MA 1LDKC 2KYUA 2VJEA 4WZ0A 3M99A 2G43A 2MNZA 2VPEA 2HYED 4O64A 4YAXA 1G25A 2MA5A 5FB0A 2VPBA 4CA1A 1K2FA 1F62A 2ECNA 3SOXA 3T7LA 4CCGX 3PUQA 1E4UA 1WE9A 3I2DA 4QF2A 2YQMA 5D1KB 2QJ0A 3O37A 4GNDA 1WGMA 2F6NA 4AYCB 1BORA 2ECWA 2Y1NA 1Z6UA 4ZQLA 4UP0A 4YATA 2Y43A 5B77A 3KQIA 5B78A 4YBSA 2MD8C 5AITA 2KU3A 3ASLA 3EB5A 3N9PA 2KGGA 2Y1MA 4AUQB 2MIQA 4BBQA 1U6GB 2LRIC 1HYJA 2IDAA 5JG6A 2JMDA 1WIMA 2VPDA 5LKUA 4A0CD 1X4UA 2KREA 2LN0A 4PPEA 2YW8A 2I50A 2M1RA 2YHNA 4NN2A 2EA6A 3PHDA 4AP4A 3ZPV1 4GNFA 2E6SA 2AN6A 2L75A 3U5OA 3IHPA 4I7CA 2G45A 3ZPVE 3U5PA 2YUCA 1FP0A 4PTBA 2ECGA 3RTRB 2RSDA 2XEUA 3HCTA 1LDJB 1WEOA 4I7BA 3SOUA 5EYAF 3FL2A 2KGIA 2RI7A 5I3LA 2LGKA 3KV5A 4GNGA 2YSMA 2LQ6A 4Q6FA 5H9MA 4GNEA 3N9MA 2C2LA 2E6RA 5B8DA 2LXHC 5LCWB 1HYIA 5G04B 2ECVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O7A A;  1WIL A;  2EGP A;  3ZVZ B;  2KR4 A;  2K4D A;  4YBT A;  5B75 A;  1ZBD B;  3SOW A;  2LGG A;  3VK6 A;  2CSZ A;  4L58 A;  3L11 A;  5D1M B;  4XI1 A;  2MUM A;  3NG2 A;  4ZDT A;  1MM3 A;  3RPG B;  5TAB A;  5D1L B;  3O34 A;  2F42 A;  2VP7 A;  2PUY A;  2LGV A;  1WEN A;  4P5O B;  2VPG A;  2ECJ A;  3PUR A;  1JOC A;  3QZV A;  5AIU A;  2D8S A;  4FJC A;  5G0F A;  4B86 C;  4AVX A;  2MD7 B;  1WES A;  2BAY A;  1DVP A;  2KIZ A;  3MHH A;  3L1X A;  3O33 A;  1V87 A;  4YAD A;  2QIC A;  1VD4 A;  5B76 A;  4FK5 A;  2CKL A;  4N3W A;  5TDW A;  2KWK A;  2C2V S;  4YAB A;  3C6W A;  1Z2Q A;  2XB1 A;  1WEE A;  3T6R A;  3U5N A;  1JM7 A;  3MHS A;  5LKT A;  3HTK C;  3GV4 A;  3LQJ A;  2ECT A;  2M85 A;  2UZG A;  3L1Z B;  4GB0 A;  2YSJ A;  4LAD B;  1RMD A;  3O35 A;  5LKZ A;  4W4U A;  2MNY A;  4A49 A;  4YC9 A;  5TRB A;  3N9N A;  4MSX A;  4AYC A;  2JMJ A;  4IC2 A;  2H0D B;  5H1V A;  4UI9 B;  2YYR A;  2ECI A;  1CHC A;  2MA6 A;  4I7D A;  4L7X A;  5KH9 A;  5FB1 A;  1Z60 A;  2YQL A;  3LQH A;  4A4B A;  2OXQ C;  4WZ2 A;  4S3O B;  4R8P K;  2CT2 A;  2KFT A;  2VJE B;  2LDR A;  1X4I A;  4X3G A;  2JMI A;  4S3O C;  5B79 A;  4A4C A;  5TBN A;  5KH3 A;  3C5K A;  2QIZ A;  5LKX A;  2VJF A;  2LXP C;  3M62 A;  2H0D A;  3V43 A;  4B7Y C;  3N9O A;  1XWH A;  4FIP A;  2CKL B;  5H1U A;  2LV9 A;  4WZ3 B;  3ZNI A;  2M3H A;  2G6Q A;  4TKP B;  3LQI A;  2VNF A;  4LKA A;  1WEV A;  4ZUX U;  2EOD A;  1WEP A;  2L43 A;  1FBV A;  1X4J A;  4V3L C;  2VJF B;  4MVT A;  4BHW A;  5C11 A;  5C13 A;  5FER A;  4WA6 A;  5TDR A;  3HCS A;  3SHB A;  2HDP A;  4IC3 A;  3HCU A;  4N4F A;  1T1H A;  3DQV R;  2CSY A;  1VYX A;  2L80 A;  4R7E A;  3DPL R;  3N9Q A;  2JRJ A;  2LGL A;  3N9L A;  2K17 A;  1WFK A;  3U5M A;  3O36 A;  3RPG C;  4UP5 A;  2KWN A;  2L0B A;  2NAA A;  2FUU A;  2KE1 A;  2K1J A;  5J3X A;  2YU4 A;  2L5U A;  4V3K C;  3M63 A;  4F52 B;  2K16 A;  3O70 A;  3EB6 A;  1JM7 B;  3ZVY A;  5G05 B;  2PNX A;  4LLB A;  2ZET C;  4C9Z A;  2F6J A;  2KWO A;  3LRQ A;  1VFY A;  5H1T A;  1WEQ A;  1WEU A;  2MT5 A;  3KV6 A;  2KWJ A;  2FUI A;  1WEW A;  2YUR A;  4FO9 A;  1N87 A;  4YBM A;  4LJN A;  1WEM A;  3ZTG A;  2YRE A;  4R2Y A;  5DIN A;  3GL6 A;  1IYM A;  5DKA A;  2YHO A;  4LK9 A;  3KNV A;  1MM2 A;  3ZYQ A;  5FEY A;  5KH7 A;  4QF3 A;  2YT5 A;  2DX8 A;  2FSA A;  2M6M A;  1LDK C;  2KYU A;  2VJE A;  4WZ0 A;  3M99 A;  2G43 A;  2MNZ A;  2VPE A;  2HYE D;  4O64 A;  4YAX A;  1G25 A;  2MA5 A;  5FB0 A;  2VPB A;  4CA1 A;  1K2F A;  1F62 A;  2ECN A;  3SOX A;  3T7L A;  4CCG X;  3PUQ A;  1E4U A;  1WE9 A;  3I2D A;  4QF2 A;  2YQM A;  5D1K B;  2QJ0 A;  3O37 A;  4GND A;  1WGM A;  2F6N A;  4AYC B;  1BOR A;  2ECW A;  2Y1N A;  1Z6U A;  4ZQL A;  4UP0 A;  4YAT A;  2Y43 A;  5B77 A;  3KQI A;  5B78 A;  4YBS A;  2MD8 C;  5AIT A;  2KU3 A;  3ASL A;  3EB5 A;  3N9P A;  2KGG A;  2Y1M A;  4AUQ B;  2MIQ A;  4BBQ A;  1U6G B;  2LRI C;  1HYJ A;  2IDA A;  5JG6 A;  2JMD A;  1WIM A;  2VPD A;  5LKU A;  4A0C D;  1X4U A;  2KRE A;  2LN0 A;  4PPE A;  2YW8 A;  2I50 A;  2M1R A;  2YHN A;  4NN2 A;  2EA6 A;  3PHD A;  4AP4 A;  3ZPV 1;  4GNF A;  2E6S A;  2AN6 A;  2L75 A;  3U5O A;  3IHP A;  4I7C A;  2G45 A;  3ZPV E;  3U5P A;  2YUC A;  1FP0 A;  4PTB A;  2ECG A;  3RTR B;  2RSD A;  2XEU A;  3HCT A;  1LDJ B;  1WEO A;  4I7B A;  3SOU A;  5EYA F;  3FL2 A;  2KGI A;  2RI7 A;  5I3L A;  2LGK A;  3KV5 A;  4GNG A;  2YSM A;  2LQ6 A;  4Q6F A;  5H9M A;  4GNE A;  3N9M A;  2C2L A;  2E6R A;  5B8D A;  2LXH C;  5LCW B;  1HYI A;  5G04 B;  2ECV A; 
#chains in the Genus database with same CATH topology
 3O7A A;  1WIL A;  2EGP A;  3ZVZ B;  2KR4 A;  2K4D A;  4YBT A;  5B75 A;  1ZBD B;  3SOW A;  2LGG A;  3VK6 A;  2CSZ A;  4L58 A;  3L11 A;  1DCQ A;  5D1M B;  4XI1 A;  2MUM A;  3E2D A;  3NG2 A;  4ZDT A;  1MM3 A;  3RPG B;  5TAB A;  2EGM A;  5D1L B;  3O34 A;  2F42 A;  2VP7 A;  2PUY A;  2LGV A;  1WEN A;  4P5O B;  2VPG A;  2ECJ A;  3PUR A;  1JOC A;  3QZV A;  5AIU A;  2XOZ A;  2D8S A;  2KKY A;  4FJC A;  5G0F A;  4B86 C;  4AVX A;  2MD7 B;  1WES A;  3FM8 C;  2BAY A;  1DVP A;  2KKX A;  3LDY A;  2KIZ A;  3MHH A;  3L1X A;  3O33 A;  1V87 A;  4YAD A;  2QIC A;  1VD4 A;  5B76 A;  4FK5 A;  2CKL A;  4N3W A;  5TDW A;  2KWK A;  2C2V S;  3LVR E;  4YAB A;  3C6W A;  1Z2Q A;  2XB1 A;  1WEE A;  3T6R A;  3U5N A;  4Z0O A;  1JM7 A;  3MHS A;  5LKT A;  3HTK C;  3GV4 A;  5SVX A;  3LQJ A;  2ECT A;  2M85 A;  2UZG A;  3L1Z B;  3MDB C;  4GB0 A;  2YSJ A;  4LAD B;  1RMD A;  3O35 A;  5LKZ A;  4W4U A;  2MNY A;  4A49 A;  4YC9 A;  5TRB A;  3N9N A;  4MSX A;  4AYC A;  2JMJ A;  4IC2 A;  2H0D B;  5H1V A;  4UI9 B;  2YYR A;  2ECI A;  1CHC A;  4H9D A;  2MA6 A;  4I7D A;  4L7X A;  5KH9 A;  5FB1 A;  1Z60 A;  2YQL A;  3LQH A;  4A4B A;  2OXQ C;  4WZ2 A;  4S3O B;  4R8P K;  2CT2 A;  2KFT A;  2VJE B;  2LDR A;  1X4I A;  4X3G A;  2JMI A;  3JUE A;  4S3O C;  5B79 A;  2D8U A;  4A4C A;  3SUB A;  5TBN A;  5KH3 A;  2XP0 A;  3C5K A;  2M13 A;  2QIZ A;  5LKX A;  2VJF A;  3Q1D A;  2LXP C;  3M62 A;  2H0D A;  3V43 A;  4B7Y C;  3N9O A;  1XWH A;  4FIP A;  2CKL B;  5H1U A;  2LV9 A;  4WZ3 B;  1MBM A;  3ZNI A;  2M3H A;  4OGC A;  2G6Q A;  4TKP B;  3LQI A;  2VNF A;  4LKA A;  1WEV A;  4ZUX U;  2EOD A;  1WEP A;  3LJU X;  2L43 A;  1FBV A;  1X4J A;  4V3L C;  2VJF B;  4MVT A;  4BHW A;  5C11 A;  2JUN A;  5C13 A;  5FER A;  4WA6 A;  2CRR A;  5TDR A;  3HCS A;  3SHB A;  4OGE A;  2HDP A;  4IC3 A;  3HCU A;  4N4F A;  1T1H A;  3DQV R;  2CSY A;  2JM3 A;  1VYX A;  2L80 A;  2L7P A;  4R7E A;  3DPL R;  3N9Q A;  2JRJ A;  3DDT A;  2LGL A;  3N9L A;  2K17 A;  2ECV A;  1WFK A;  3U5M A;  3O36 A;  3RPG C;  4UP5 A;  3DWD A;  2KWN A;  2L0B A;  2NAA A;  2FUU A;  2IQJ A;  2KE1 A;  2K1J A;  3KDE C;  5J3X A;  2YU4 A;  2L5U A;  4V3K C;  3M63 A;  4F52 B;  2K16 A;  3O70 A;  3EB6 A;  1JM7 B;  3ZVY A;  5G05 B;  2PNX A;  4LLB A;  2ZET C;  4QQ4 A;  2XOY A;  4C9Z A;  2F6J A;  2KWO A;  3LRQ A;  1VFY A;  5H1T A;  1WEQ A;  1WEU A;  2MT5 A;  3KV6 A;  2KWJ A;  3M7K A;  2MKE A;  2FUI A;  3FAN A;  1WEW A;  2YUR A;  4FO9 A;  1N87 A;  2OWA A;  3LVQ E;  4YBM A;  4LJN A;  1WEM A;  2FD4 A;  2CSV A;  3ZTG A;  2YRE A;  4R2Y A;  5DIN A;  3GL6 A;  5SVY A;  1IYM A;  5DKA A;  2YHO A;  3O47 A;  4LK9 A;  3KNV A;  1MM2 A;  3FAO A;  3ZYQ A;  5FEY A;  5KH7 A;  4QF3 A;  2YT5 A;  2DX8 A;  2XOC A;  2FSA A;  2M6M A;  1LDK C;  2KYU A;  2VJE A;  4WZ0 A;  3M99 A;  2G43 A;  2MNZ A;  2VPE A;  2HYE D;  4O64 A;  4YAX A;  1G25 A;  2MA5 A;  5FB0 A;  2VPB A;  4CA1 A;  1K2F A;  1F62 A;  2ECN A;  4O62 A;  3SOX A;  3T7L A;  4CCG X;  3PUQ A;  1E4U A;  1WE9 A;  3I2D A;  4QF2 A;  2YQM A;  5D1K B;  4Z0R A;  2QJ0 A;  3O37 A;  4GND A;  1WGM A;  2F6N A;  4AYC B;  1BOR A;  2ECW A;  2Y1N A;  1Z6U A;  5K3Q A;  2B0O E;  4ZQL A;  5SVI B;  4UP0 A;  4YAT A;  2Y43 A;  5B77 A;  3KQI A;  5B78 A;  4YBS A;  2MD8 C;  5AIT A;  2KU3 A;  3ASL A;  3EB5 A;  3N9P A;  2KGG A;  2Y1M A;  4AUQ B;  2MIQ A;  4BBQ A;  1U6G B;  2LRI C;  3PLW A;  1HYJ A;  2IDA A;  5JG6 A;  2DJA A;  2JMD A;  1WIM A;  2VPD A;  2FFW A;  5LKU A;  2YVR A;  4A0C D;  1X4U A;  2KRE A;  2E61 A;  3T9K A;  2LN0 A;  2P57 A;  4PPE A;  2YW8 A;  2I50 A;  2M1R A;  2YHN A;  4NN2 A;  2EA6 A;  3PHD A;  4AP4 A;  3ZPV 1;  4GNF A;  2E6S A;  2AN6 A;  2L75 A;  5SVI A;  3U5O A;  2EXU A;  3IHP A;  4I7C A;  2CRW A;  2G45 A;  3ZPV E;  3U5P A;  2YUC A;  2RR4 A;  1FP0 A;  4PTB A;  2ECG A;  3RTR B;  2RSD A;  2XEU A;  2DSM A;  3HCT A;  1LDJ B;  1WEO A;  4I7B A;  3SOU A;  5EYA F;  4F1P A;  3FL2 A;  2KGI A;  2RI7 A;  5I3L A;  3FEH A;  2LGK A;  3KV5 A;  4GNG A;  2YSM A;  2LQ6 A;  4Q6F A;  5H9M A;  4GNE A;  2LAU A;  2CON A;  3N9M A;  2C2L A;  2E6R A;  5B8D A;  3FJU B;  2LXH C;  5LCW B;  1HYI A;  5G04 B;  3H7H A; 
#chains in the Genus database with same CATH homology
 3O7A A;  1WIL A;  2EGP A;  3ZVZ B;  2KR4 A;  2K4D A;  4YBT A;  5B75 A;  1ZBD B;  3SOW A;  2LGG A;  3VK6 A;  2CSZ A;  4L58 A;  3L11 A;  5D1M B;  4XI1 A;  2MUM A;  3NG2 A;  4ZDT A;  1MM3 A;  3RPG B;  5TAB A;  5D1L B;  3O34 A;  2F42 A;  2VP7 A;  2PUY A;  2LGV A;  1WEN A;  4P5O B;  2VPG A;  2ECJ A;  3PUR A;  1JOC A;  3QZV A;  5AIU A;  2D8S A;  4FJC A;  5G0F A;  4B86 C;  4AVX A;  2MD7 B;  1WES A;  2BAY A;  1DVP A;  2KIZ A;  3MHH A;  3L1X A;  3O33 A;  1V87 A;  4YAD A;  2QIC A;  1VD4 A;  5B76 A;  4FK5 A;  2CKL A;  4N3W A;  5TDW A;  2KWK A;  2C2V S;  4YAB A;  3C6W A;  1Z2Q A;  2XB1 A;  1WEE A;  3T6R A;  3U5N A;  1JM7 A;  3MHS A;  5LKT A;  3HTK C;  3GV4 A;  3LQJ A;  2ECT A;  2M85 A;  2UZG A;  3L1Z B;  4GB0 A;  2YSJ A;  4LAD B;  1RMD A;  3O35 A;  5LKZ A;  4W4U A;  2MNY A;  4A49 A;  4YC9 A;  5TRB A;  3N9N A;  4MSX A;  4AYC A;  2JMJ A;  4IC2 A;  2H0D B;  5H1V A;  4UI9 B;  2YYR A;  2ECI A;  1CHC A;  2MA6 A;  4I7D A;  4L7X A;  5KH9 A;  5FB1 A;  1Z60 A;  2YQL A;  3LQH A;  4A4B A;  2OXQ C;  4WZ2 A;  4S3O B;  4R8P K;  2CT2 A;  2KFT A;  2VJE B;  2LDR A;  1X4I A;  4X3G A;  2JMI A;  4S3O C;  5B79 A;  4A4C A;  5TBN A;  5KH3 A;  3C5K A;  2QIZ A;  5LKX A;  2VJF A;  2LXP C;  3M62 A;  2H0D A;  3V43 A;  4B7Y C;  3N9O A;  1XWH A;  4FIP A;  2CKL B;  5H1U A;  2LV9 A;  4WZ3 B;  3ZNI A;  2M3H A;  2G6Q A;  4TKP B;  3LQI A;  2VNF A;  4LKA A;  1WEV A;  4ZUX U;  2EOD A;  1WEP A;  2L43 A;  1FBV A;  1X4J A;  4V3L C;  2VJF B;  4MVT A;  4BHW A;  5C11 A;  5C13 A;  5FER A;  4WA6 A;  5TDR A;  3HCS A;  3SHB A;  2HDP A;  4IC3 A;  3HCU A;  4N4F A;  1T1H A;  3DQV R;  2CSY A;  1VYX A;  2L80 A;  4R7E A;  3DPL R;  3N9Q A;  2JRJ A;  2LGL A;  3N9L A;  2K17 A;  1WFK A;  3U5M A;  3O36 A;  3RPG C;  4UP5 A;  2KWN A;  2L0B A;  2NAA A;  2FUU A;  2KE1 A;  2K1J A;  5J3X A;  2YU4 A;  2L5U A;  4V3K C;  3M63 A;  4F52 B;  2K16 A;  3O70 A;  3EB6 A;  1JM7 B;  3ZVY A;  5G05 B;  2PNX A;  4LLB A;  2ZET C;  4C9Z A;  2F6J A;  2KWO A;  3LRQ A;  1VFY A;  5H1T A;  1WEQ A;  1WEU A;  2MT5 A;  3KV6 A;  2KWJ A;  2FUI A;  1WEW A;  2YUR A;  4FO9 A;  1N87 A;  4YBM A;  4LJN A;  1WEM A;  3ZTG A;  2YRE A;  4R2Y A;  5DIN A;  3GL6 A;  1IYM A;  5DKA A;  2YHO A;  4LK9 A;  3KNV A;  1MM2 A;  3ZYQ A;  5FEY A;  5KH7 A;  4QF3 A;  2YT5 A;  2DX8 A;  2FSA A;  2M6M A;  1LDK C;  2KYU A;  2VJE A;  4WZ0 A;  3M99 A;  2G43 A;  2MNZ A;  2VPE A;  2HYE D;  4O64 A;  4YAX A;  1G25 A;  2MA5 A;  5FB0 A;  2VPB A;  4CA1 A;  1K2F A;  1F62 A;  2ECN A;  3SOX A;  3T7L A;  4CCG X;  3PUQ A;  1E4U A;  1WE9 A;  3I2D A;  4QF2 A;  2YQM A;  5D1K B;  2QJ0 A;  3O37 A;  4GND A;  1WGM A;  2F6N A;  4AYC B;  1BOR A;  2ECW A;  2Y1N A;  1Z6U A;  4ZQL A;  4UP0 A;  4YAT A;  2Y43 A;  5B77 A;  3KQI A;  5B78 A;  4YBS A;  2MD8 C;  5AIT A;  2KU3 A;  3ASL A;  3EB5 A;  3N9P A;  2KGG A;  2Y1M A;  4AUQ B;  2MIQ A;  4BBQ A;  1U6G B;  2LRI C;  1HYJ A;  2IDA A;  5JG6 A;  2JMD A;  1WIM A;  2VPD A;  5LKU A;  4A0C D;  1X4U A;  2KRE A;  2LN0 A;  4PPE A;  2YW8 A;  2I50 A;  2M1R A;  2YHN A;  4NN2 A;  2EA6 A;  3PHD A;  4AP4 A;  3ZPV 1;  4GNF A;  2E6S A;  2AN6 A;  2L75 A;  3U5O A;  3IHP A;  4I7C A;  2G45 A;  3ZPV E;  3U5P A;  2YUC A;  1FP0 A;  4PTB A;  2ECG A;  3RTR B;  2RSD A;  2XEU A;  3HCT A;  1LDJ B;  1WEO A;  4I7B A;  3SOU A;  5EYA F;  3FL2 A;  2KGI A;  2RI7 A;  5I3L A;  2LGK A;  3KV5 A;  4GNG A;  2YSM A;  2LQ6 A;  4Q6F A;  5H9M A;  4GNE A;  3N9M A;  2C2L A;  2E6R A;  5B8D A;  2LXH C;  5LCW B;  1HYI A;  5G04 B;  2ECV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...