1VYXA

Solution structure of the kshv k3 n-terminal domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
MEDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Zinc-binding protein
molecule keywords ORF K3
publication title Solution Structure of the Kaposi'S Sarcoma-Associated Herpesvirus K3 N-Terminal Domain Reveals a Novel E2-Binding C4Hc3-Type Ring Domain
pubmed doi rcsb
source organism Human herpesvirus 8
total genus 5
structure length 60
sequence length 60
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12906 RINGv RING-variant domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vyxA00
1E4UA 1T1HA 2KFTA 2K1JA 3HCSA 1JM7B 3T6RA 2VJEA 2YQMA 2MT5A 4A49A 2KWNA 4MSXA 5G0FA 2F42A 3GV4A 4FIPA 4AUQB 1FP0A 3N9PA 3N9MA 2JRJA 2LXPC 4PTBA 4S3OC 2JMDA 4WA6A 3SHBA 5EYAF 1RMDA 4NN2A 4TKPB 1U6GB 3O34A 5LKTA 3RPGB 1K2FA 3MHSA 3V43A 3ZYQA 1F62A 1DVPA 4N4FA 5C13A 4V3KC 3IHPA 4YADA 4WZ0A 4C9ZA 5I3LA 4B86C 4YAXA 2CKLB 3KNVA 2ECNA 2YHOA 2QICA 3ZNIA 5TBNA 4L58A 2FUIA 2MUMA 4R7EA 4GNDA 4MVTA 2MD8C 1BORA 2VPEA 2KE1A 5JG6A 4AVXA 1Z2QA 4F52B 2ECVA 1X4UA 1WFKA 3SOXA 2ECWA 3ZPV1 2YSJA 2OXQC 3GL6A 2E6RA 2EA6A 1JOCA 1WEQA 2LXHC 5B75A 3M62A 2YU4A 2MA6A 2VP7A 1HYIA 4IC3A 5D1MB 4QF3A 5LKXA 3NG2A 2Y43A 2ECTA 2IDAA 1X4JA 2YQLA 2L80A 2YYRA 3DPLR 1WEOA 2C2VS 1G25A 2LGVA 4UP5A 3KQIA 3C6WA 2LGKA 2E6SA 3C5KA 2L43A 3MHHA 3U5NA 1VFYA 2CSYA 2JMJA 2YREA 5B8DA 5LKZA 2K4DA 3N9LA 3T7LA 3U5PA 4UP0A 3DQVR 2LDRA 2FUUA 3N9OA 4GB0A 1FBVA 2G43A 5KH7A 3O35A 2EGPA 4LK9A 2YHNA 5B79A 3PUQA 2Y1NA 5FB0A 3EB6A 4R2YA 2NAAA 2I50A 2K16A 1WGMA 2RI7A 5B78A 1WEWA 2CKLA 4LLBA 3PHDA 3M99A 3O37A 2KR4A 2QJ0A 2ECJA 5B76A 3HCUA 5KH3A 4I7DA 2CSZA 4S3OB 3HTKC 3N9NA 4CA1A 2KWOA 1LDJB 5J3XA 5FB1A 4FJCA 3ASLA 3L1XA 4A4BA 3ZPVE 5TRBA 2YUCA 3SOWA 3O70A 4I7BA 2L75A 5TABA 1WE9A 2HDPA 5LCWB 1WEEA 3LQIA 1WIMA 4BBQA 2VJFA 4P5OB 1MM3A 1X4IA 2VJFB 4YC9A 2KGGA 2G6QA 4L7XA 4XI1A 3VK6A 2YSMA 2D8SA 1VD4A 2XEUA 4LADB 2LN0A 4Q6FA 4W4UA 3ZVZB 1V87A 3O33A 5AITA 3PURA 1WILA 5LKUA 3HCTA 2QIZA 4FO9A 1WEUA 2DX8A 2H0DA 1Z6UA 2ECGA 4CCGX 2VPBA 1N87A 1CHCA 4ZUXU 3L11A 5H9MA 3L1ZB 5AIUA 2H0DB 4LKAA 3SOUA 2JMIA 4V3LC 1VYXA 4FK5A 4PPEA 2L5UA 3LQJA 2MNZA 5G04B 2VJEB 2RSDA 2L0BA 3N9QA 4YATA 1MM2A 3U5MA 4GNEA 1ZBDB 3U5OA 4GNFA 2M85A 4LJNA 3O7AA 3KV6A 2M1RA 2VPDA 2ECIA 4WZ2A 4B7YC 5D1KB 5FEYA 1IYMA 2XB1A 5TDRA 1Z60A 5D1LB 2MA5A 3I2DA 4A0CD 5DKAA 3FL2A 4N3WA 2KYUA 2LV9A 4YBSA 2YW8A 4WZ3B 5KH9A 2YURA 3ZTGA 2LGLA 4UI9B 2BAYA 2KWKA 2F6JA 4YBTA 4O64A 4R8PK 2M3HA 3KV5A 2C2LA 4AYCA 3O36A 2VPGA 5C11A 2UZGA 4AYCB 4YBMA 4QF2A 2MIQA 2AN6A 2HYED 3LQHA 3RTRB 2MD7B 2M6MA 2KU3A 3QZVA 2KREA 2PNXA 1HYJA 5B77A 1XWHA 4IC2A 5H1VA 1LDKC 3LRQA 5FERA 2FSAA 5DINA 2LQ6A 4ZQLA 4BHWA 1WENA 2KWJA 3EB5A 4GNGA 2CT2A 4ZDTA 2K17A 4A4CA 1WEMA 2ZETC 2G45A 4X3GA 2MNYA 4YABA 2PUYA 5G05B 2KGIA 5TDWA 2Y1MA 4I7CA 1WEVA 3RPGC 2YT5A 2LRIC 3M63A 1WEPA 4AP4A 2F6NA 1WESA 5H1UA 2KIZA 3ZVYA 1JM7A 5H1TA 2EODA 2VNFA 2LGGA
chains in the Genus database with same CATH superfamily
1E4UA 5SVXA 1T1HA 2KFTA 2K1JA 3HCSA 1JM7B 3T6RA 2VJEA 2YQMA 3O47A 2MT5A 4A49A 2XOZA 2KWNA 4MSXA 5G0FA 2F42A 3GV4A 4FIPA 4AUQB 1FP0A 3N9PA 3N9MA 2JRJA 2LXPC 4PTBA 4S3OC 2JMDA 4WA6A 3T9KA 3SHBA 5EYAF 1RMDA 4NN2A 4TKPB 1U6GB 3O34A 5LKTA 3RPGB 1K2FA 3MHSA 3V43A 3MDBC 3DDTA 4H9DA 3ZYQA 1F62A 1DVPA 4N4FA 5C13A 3SUBA 4V3KC 3IHPA 2P57A 4YADA 2YVRA 4WZ0A 4C9ZA 5I3LA 4B86C 4YAXA 3FJUB 2IQJA 2CKLB 3KNVA 2ECNA 2YHOA 2QICA 3ZNIA 5TBNA 4L58A 2FUIA 2MUMA 4R7EA 4GNDA 4OGCA 4MVTA 2MD8C 1BORA 2VPEA 2KE1A 5JG6A 4AVXA 1Z2QA 4F52B 2ECVA 1X4UA 1WFKA 3SOXA 2DJAA 2ECWA 3ZPV1 2YSJA 2OXQC 3GL6A 2E6RA 2EA6A 1JOCA 1WEQA 2LXHC 3KDEC 2RR4A 5B75A 3FANA 2E61A 3M62A 2YU4A 2MA6A 3LDYA 2FFWA 2VP7A 3M7KA 1HYIA 4IC3A 5D1MB 4QF3A 5LKXA 3NG2A 2Y43A 2ECTA 2IDAA 1X4JA 2YQLA 2L80A 2YYRA 3DPLR 1WEOA 2C2VS 1G25A 2LGVA 4UP5A 3KQIA 3C6WA 2M13A 2LGKA 2E6SA 3C5KA 2L43A 2B0OE 3MHHA 3U5NA 1VFYA 2CSYA 2JMJA 2YREA 5B8DA 5LKZA 2CONA 2K4DA 3N9LA 3T7LA 3U5PA 4UP0A 3DQVR 2LDRA 4O62A 2FUUA 3N9OA 4GB0A 1FBVA 2G43A 5KH7A 3O35A 2EGPA 4LK9A 2YHNA 5B79A 3PUQA 2Y1NA 3E2DA 3FEHA 2L7PA 5FB0A 3EB6A 4R2YA 2NAAA 2I50A 2K16A 1WGMA 2RI7A 5B78A 1WEWA 2CKLA 4LLBA 3PHDA 2D8UA 3M99A 3O37A 2KR4A 4Z0RA 2QJ0A 3LVRE 2ECJA 5B76A 3HCUA 5KH3A 4I7DA 2CSZA 4S3OB 3HTKC 3N9NA 2CRWA 2LAUA 4CA1A 2KWOA 1LDJB 5J3XA 5FB1A 2MKEA 4FJCA 3ASLA 3L1XA 4A4BA 3ZPVE 5TRBA 2YUCA 3SOWA 3O70A 4I7BA 2L75A 5TABA 1WE9A 2HDPA 5LCWB 1WEEA 3LQIA 1WIMA 5SVIB 4BBQA 2VJFA 4P5OB 1MM3A 3Q1DA 1X4IA 2VJFB 4YC9A 2CSVA 2KGGA 3H7HA 2G6QA 4L7XA 4XI1A 3VK6A 2YSMA 2D8SA 3LJUX 1VD4A 2XOYA 2XEUA 4LADB 2FD4A 2LN0A 3FM8C 4Q6FA 4W4UA 3ZVZB 1V87A 3O33A 5AITA 3PURA 1WILA 5LKUA 3HCTA 2QIZA 2XP0A 4FO9A 1WEUA 2DX8A 2H0DA 1Z6UA 2ECGA 1MBMA 4CCGX 2VPBA 1N87A 1CHCA 4ZUXU 3L11A 5H9MA 2KKYA 3L1ZB 5AIUA 2H0DB 4LKAA 3SOUA 2JMIA 4V3LC 1VYXA 2JM3A 4FK5A 3JUEA 4PPEA 2L5UA 3LQJA 2MNZA 5G04B 2VJEB 2RSDA 4QQ4A 2L0BA 3N9QA 4YATA 1MM2A 3U5MA 4GNEA 1ZBDB 3U5OA 4GNFA 2M85A 4LJNA 3O7AA 3DWDA 3KV6A 2M1RA 4F1PA 2VPDA 2ECIA 4WZ2A 4B7YC 5D1KB 5FEYA 1IYMA 2XB1A 5TDRA 1Z60A 5D1LB 2MA5A 3I2DA 4A0CD 5DKAA 3FL2A 4N3WA 2KYUA 2LV9A 4YBSA 2YW8A 4WZ3B 2DSMA 5KH9A 2YURA 3ZTGA 2LGLA 4UI9B 2BAYA 2EGMA 2KWKA 2F6JA 4YBTA 4O64A 2JUNA 4R8PK 2M3HA 3KV5A 5SVIA 2C2LA 4AYCA 3O36A 2VPGA 5C11A 2UZGA 5K3QA 4AYCB 4YBMA 4QF2A 2MIQA 2AN6A 2HYED 3LQHA 3RTRB 2MD7B 1DCQA 2M6MA 2KU3A 3QZVA 2KREA 5SVYA 2PNXA 1HYJA 5B77A 1XWHA 4IC2A 5H1VA 1LDKC 3LRQA 5FERA 2KKXA 2FSAA 5DINA 2LQ6A 4ZQLA 2XOCA 4BHWA 1WENA 2KWJA 3EB5A 4GNGA 2CT2A 4ZDTA 2K17A 4A4CA 1WEMA 2ZETC 2G45A 4X3GA 2MNYA 4YABA 2PUYA 4Z0OA 5G05B 2KGIA 2OWAA 5TDWA 2Y1MA 4I7CA 1WEVA 3RPGC 2YT5A 2LRIC 2CRRA 3M63A 1WEPA 4AP4A 2F6NA 2EXUA 3LVQE 1WESA 5H1UA 2KIZA 3ZVYA 1JM7A 5H1TA 2EODA 4OGEA 3FAOA 2VNFA 3PLWA 2LGGA
chains in the Genus database with same CATH topology
1E4UA 1T1HA 2KFTA 2K1JA 3HCSA 1JM7B 3T6RA 2VJEA 2YQMA 2MT5A 4A49A 2KWNA 4MSXA 5G0FA 2F42A 3GV4A 4FIPA 4AUQB 1FP0A 3N9PA 3N9MA 2JRJA 2LXPC 4PTBA 4S3OC 2JMDA 4WA6A 3SHBA 5EYAF 1RMDA 4NN2A 4TKPB 1U6GB 3O34A 5LKTA 3RPGB 1K2FA 3MHSA 3V43A 3ZYQA 1F62A 1DVPA 4N4FA 5C13A 4V3KC 3IHPA 4YADA 4WZ0A 4C9ZA 5I3LA 4B86C 4YAXA 2CKLB 3KNVA 2ECNA 2YHOA 2QICA 3ZNIA 5TBNA 4L58A 2FUIA 2MUMA 4R7EA 4GNDA 4MVTA 2MD8C 1BORA 2VPEA 2KE1A 5JG6A 4AVXA 1Z2QA 4F52B 2ECVA 1X4UA 1WFKA 3SOXA 2ECWA 3ZPV1 2YSJA 2OXQC 3GL6A 2E6RA 2EA6A 1JOCA 1WEQA 2LXHC 5B75A 3M62A 2YU4A 2MA6A 2VP7A 1HYIA 4IC3A 5D1MB 4QF3A 5LKXA 3NG2A 2Y43A 2ECTA 2IDAA 1X4JA 2YQLA 2L80A 2YYRA 3DPLR 1WEOA 2C2VS 1G25A 2LGVA 4UP5A 3KQIA 3C6WA 2LGKA 2E6SA 3C5KA 2L43A 3MHHA 3U5NA 1VFYA 2CSYA 2JMJA 2YREA 5B8DA 5LKZA 2K4DA 3N9LA 3T7LA 3U5PA 4UP0A 3DQVR 2LDRA 2FUUA 3N9OA 4GB0A 1FBVA 2G43A 5KH7A 3O35A 2EGPA 4LK9A 2YHNA 5B79A 3PUQA 2Y1NA 5FB0A 3EB6A 4R2YA 2NAAA 2I50A 2K16A 1WGMA 2RI7A 5B78A 1WEWA 2CKLA 4LLBA 3PHDA 3M99A 3O37A 2KR4A 2QJ0A 2ECJA 5B76A 3HCUA 5KH3A 4I7DA 2CSZA 4S3OB 3HTKC 3N9NA 4CA1A 2KWOA 1LDJB 5J3XA 5FB1A 4FJCA 3ASLA 3L1XA 4A4BA 3ZPVE 5TRBA 2YUCA 3SOWA 3O70A 4I7BA 2L75A 5TABA 1WE9A 2HDPA 5LCWB 1WEEA 3LQIA 1WIMA 4BBQA 2VJFA 4P5OB 1MM3A 1X4IA 2VJFB 4YC9A 2KGGA 2G6QA 4L7XA 4XI1A 3VK6A 2YSMA 2D8SA 1VD4A 2XEUA 4LADB 2LN0A 4Q6FA 4W4UA 3ZVZB 1V87A 3O33A 5AITA 3PURA 1WILA 5LKUA 3HCTA 2QIZA 4FO9A 1WEUA 2DX8A 2H0DA 1Z6UA 2ECGA 4CCGX 2VPBA 1N87A 1CHCA 4ZUXU 3L11A 5H9MA 3L1ZB 5AIUA 2H0DB 4LKAA 3SOUA 2JMIA 4V3LC 1VYXA 4FK5A 4PPEA 2L5UA 3LQJA 2MNZA 5G04B 2VJEB 2RSDA 2L0BA 3N9QA 4YATA 1MM2A 3U5MA 4GNEA 1ZBDB 3U5OA 4GNFA 2M85A 4LJNA 3O7AA 3KV6A 2M1RA 2VPDA 2ECIA 4WZ2A 4B7YC 5D1KB 5FEYA 1IYMA 2XB1A 5TDRA 1Z60A 5D1LB 2MA5A 3I2DA 4A0CD 5DKAA 3FL2A 4N3WA 2KYUA 2LV9A 4YBSA 2YW8A 4WZ3B 5KH9A 2YURA 3ZTGA 2LGLA 4UI9B 2BAYA 2KWKA 2F6JA 4YBTA 4O64A 4R8PK 2M3HA 3KV5A 2C2LA 4AYCA 3O36A 2VPGA 5C11A 2UZGA 4AYCB 4YBMA 4QF2A 2MIQA 2AN6A 2HYED 3LQHA 3RTRB 2MD7B 2M6MA 2KU3A 3QZVA 2KREA 2PNXA 1HYJA 5B77A 1XWHA 4IC2A 5H1VA 1LDKC 3LRQA 5FERA 2FSAA 5DINA 2LQ6A 4ZQLA 4BHWA 1WENA 2KWJA 3EB5A 4GNGA 2CT2A 4ZDTA 2K17A 4A4CA 1WEMA 2ZETC 2G45A 4X3GA 2MNYA 4YABA 2PUYA 5G05B 2KGIA 5TDWA 2Y1MA 4I7CA 1WEVA 3RPGC 2YT5A 2LRIC 3M63A 1WEPA 4AP4A 2F6NA 1WESA 5H1UA 2KIZA 3ZVYA 1JM7A 5H1TA 2EODA 2VNFA 2LGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E4U A;  1T1H A;  2KFT A;  2K1J A;  3HCS A;  1JM7 B;  3T6R A;  2VJE A;  2YQM A;  2MT5 A;  4A49 A;  2KWN A;  4MSX A;  5G0F A;  2F42 A;  3GV4 A;  4FIP A;  4AUQ B;  1FP0 A;  3N9P A;  3N9M A;  2JRJ A;  2LXP C;  4PTB A;  4S3O C;  2JMD A;  4WA6 A;  3SHB A;  5EYA F;  1RMD A;  4NN2 A;  4TKP B;  1U6G B;  3O34 A;  5LKT A;  3RPG B;  1K2F A;  3MHS A;  3V43 A;  3ZYQ A;  1F62 A;  1DVP A;  4N4F A;  5C13 A;  4V3K C;  3IHP A;  4YAD A;  4WZ0 A;  4C9Z A;  5I3L A;  4B86 C;  4YAX A;  2CKL B;  3KNV A;  2ECN A;  2YHO A;  2QIC A;  3ZNI A;  5TBN A;  4L58 A;  2FUI A;  2MUM A;  4R7E A;  4GND A;  4MVT A;  2MD8 C;  1BOR A;  2VPE A;  2KE1 A;  5JG6 A;  4AVX A;  1Z2Q A;  4F52 B;  2ECV A;  1X4U A;  1WFK A;  3SOX A;  2ECW A;  3ZPV 1;  2YSJ A;  2OXQ C;  3GL6 A;  2E6R A;  2EA6 A;  1JOC A;  1WEQ A;  2LXH C;  5B75 A;  3M62 A;  2YU4 A;  2MA6 A;  2VP7 A;  1HYI A;  4IC3 A;  5D1M B;  4QF3 A;  5LKX A;  3NG2 A;  2Y43 A;  2ECT A;  2IDA A;  1X4J A;  2YQL A;  2L80 A;  2YYR A;  3DPL R;  1WEO A;  2C2V S;  1G25 A;  2LGV A;  4UP5 A;  3KQI A;  3C6W A;  2LGK A;  2E6S A;  3C5K A;  2L43 A;  3MHH A;  3U5N A;  1VFY A;  2CSY A;  2JMJ A;  2YRE A;  5B8D A;  5LKZ A;  2K4D A;  3N9L A;  3T7L A;  3U5P A;  4UP0 A;  3DQV R;  2LDR A;  2FUU A;  3N9O A;  4GB0 A;  1FBV A;  2G43 A;  5KH7 A;  3O35 A;  2EGP A;  4LK9 A;  2YHN A;  5B79 A;  3PUQ A;  2Y1N A;  5FB0 A;  3EB6 A;  4R2Y A;  2NAA A;  2I50 A;  2K16 A;  1WGM A;  2RI7 A;  5B78 A;  1WEW A;  2CKL A;  4LLB A;  3PHD A;  3M99 A;  3O37 A;  2KR4 A;  2QJ0 A;  2ECJ A;  5B76 A;  3HCU A;  5KH3 A;  4I7D A;  2CSZ A;  4S3O B;  3HTK C;  3N9N A;  4CA1 A;  2KWO A;  1LDJ B;  5J3X A;  5FB1 A;  4FJC A;  3ASL A;  3L1X A;  4A4B A;  3ZPV E;  5TRB A;  2YUC A;  3SOW A;  3O70 A;  4I7B A;  2L75 A;  5TAB A;  1WE9 A;  2HDP A;  5LCW B;  1WEE A;  3LQI A;  1WIM A;  4BBQ A;  2VJF A;  4P5O B;  1MM3 A;  1X4I A;  2VJF B;  4YC9 A;  2KGG A;  2G6Q A;  4L7X A;  4XI1 A;  3VK6 A;  2YSM A;  2D8S A;  1VD4 A;  2XEU A;  4LAD B;  2LN0 A;  4Q6F A;  4W4U A;  3ZVZ B;  1V87 A;  3O33 A;  5AIT A;  3PUR A;  1WIL A;  5LKU A;  3HCT A;  2QIZ A;  4FO9 A;  1WEU A;  2DX8 A;  2H0D A;  1Z6U A;  2ECG A;  4CCG X;  2VPB A;  1N87 A;  1CHC A;  4ZUX U;  3L11 A;  5H9M A;  3L1Z B;  5AIU A;  2H0D B;  4LKA A;  3SOU A;  2JMI A;  4V3L C;  1VYX A;  4FK5 A;  4PPE A;  2L5U A;  3LQJ A;  2MNZ A;  5G04 B;  2VJE B;  2RSD A;  2L0B A;  3N9Q A;  4YAT A;  1MM2 A;  3U5M A;  4GNE A;  1ZBD B;  3U5O A;  4GNF A;  2M85 A;  4LJN A;  3O7A A;  3KV6 A;  2M1R A;  2VPD A;  2ECI A;  4WZ2 A;  4B7Y C;  5D1K B;  5FEY A;  1IYM A;  2XB1 A;  5TDR A;  1Z60 A;  5D1L B;  2MA5 A;  3I2D A;  4A0C D;  5DKA A;  3FL2 A;  4N3W A;  2KYU A;  2LV9 A;  4YBS A;  2YW8 A;  4WZ3 B;  5KH9 A;  2YUR A;  3ZTG A;  2LGL A;  4UI9 B;  2BAY A;  2KWK A;  2F6J A;  4YBT A;  4O64 A;  4R8P K;  2M3H A;  3KV5 A;  2C2L A;  4AYC A;  3O36 A;  2VPG A;  5C11 A;  2UZG A;  4AYC B;  4YBM A;  4QF2 A;  2MIQ A;  2AN6 A;  2HYE D;  3LQH A;  3RTR B;  2MD7 B;  2M6M A;  2KU3 A;  3QZV A;  2KRE A;  2PNX A;  1HYJ A;  5B77 A;  1XWH A;  4IC2 A;  5H1V A;  1LDK C;  3LRQ A;  5FER A;  2FSA A;  5DIN A;  2LQ6 A;  4ZQL A;  4BHW A;  1WEN A;  2KWJ A;  3EB5 A;  4GNG A;  2CT2 A;  4ZDT A;  2K17 A;  4A4C A;  1WEM A;  2ZET C;  2G45 A;  4X3G A;  2MNY A;  4YAB A;  2PUY A;  5G05 B;  2KGI A;  5TDW A;  2Y1M A;  4I7C A;  1WEV A;  3RPG C;  2YT5 A;  2LRI C;  3M63 A;  1WEP A;  4AP4 A;  2F6N A;  1WES A;  5H1U A;  2KIZ A;  3ZVY A;  1JM7 A;  5H1T A;  2EOD A;  2VNF A;  2LGG A; 
#chains in the Genus database with same CATH topology
 1E4U A;  5SVX A;  1T1H A;  2KFT A;  2K1J A;  3HCS A;  1JM7 B;  3T6R A;  2VJE A;  2YQM A;  3O47 A;  2MT5 A;  4A49 A;  2XOZ A;  2KWN A;  4MSX A;  5G0F A;  2F42 A;  3GV4 A;  4FIP A;  4AUQ B;  1FP0 A;  3N9P A;  3N9M A;  2JRJ A;  2LXP C;  4PTB A;  4S3O C;  2JMD A;  4WA6 A;  3T9K A;  3SHB A;  5EYA F;  1RMD A;  4NN2 A;  4TKP B;  1U6G B;  3O34 A;  5LKT A;  3RPG B;  1K2F A;  3MHS A;  3V43 A;  3MDB C;  3DDT A;  4H9D A;  3ZYQ A;  1F62 A;  1DVP A;  4N4F A;  5C13 A;  3SUB A;  4V3K C;  3IHP A;  2P57 A;  4YAD A;  2YVR A;  4WZ0 A;  4C9Z A;  5I3L A;  4B86 C;  4YAX A;  3FJU B;  2IQJ A;  2CKL B;  3KNV A;  2ECN A;  2YHO A;  2QIC A;  3ZNI A;  5TBN A;  4L58 A;  2FUI A;  2MUM A;  4R7E A;  4GND A;  4OGC A;  4MVT A;  2MD8 C;  1BOR A;  2VPE A;  2KE1 A;  5JG6 A;  4AVX A;  1Z2Q A;  4F52 B;  2ECV A;  1X4U A;  1WFK A;  3SOX A;  2DJA A;  2ECW A;  3ZPV 1;  2YSJ A;  2OXQ C;  3GL6 A;  2E6R A;  2EA6 A;  1JOC A;  1WEQ A;  2LXH C;  3KDE C;  2RR4 A;  5B75 A;  3FAN A;  2E61 A;  3M62 A;  2YU4 A;  2MA6 A;  3LDY A;  2FFW A;  2VP7 A;  3M7K A;  1HYI A;  4IC3 A;  5D1M B;  4QF3 A;  5LKX A;  3NG2 A;  2Y43 A;  2ECT A;  2IDA A;  1X4J A;  2YQL A;  2L80 A;  2YYR A;  3DPL R;  1WEO A;  2C2V S;  1G25 A;  2LGV A;  4UP5 A;  3KQI A;  3C6W A;  2M13 A;  2LGK A;  2E6S A;  3C5K A;  2L43 A;  2B0O E;  3MHH A;  3U5N A;  1VFY A;  2CSY A;  2JMJ A;  2YRE A;  5B8D A;  5LKZ A;  2CON A;  2K4D A;  3N9L A;  3T7L A;  3U5P A;  4UP0 A;  3DQV R;  2LDR A;  4O62 A;  2FUU A;  3N9O A;  4GB0 A;  1FBV A;  2G43 A;  5KH7 A;  3O35 A;  2EGP A;  4LK9 A;  2YHN A;  5B79 A;  3PUQ A;  2Y1N A;  3E2D A;  3FEH A;  2L7P A;  5FB0 A;  3EB6 A;  4R2Y A;  2NAA A;  2I50 A;  2K16 A;  1WGM A;  2RI7 A;  5B78 A;  1WEW A;  2CKL A;  4LLB A;  3PHD A;  2D8U A;  3M99 A;  3O37 A;  2KR4 A;  4Z0R A;  2QJ0 A;  3LVR E;  2ECJ A;  5B76 A;  3HCU A;  5KH3 A;  4I7D A;  2CSZ A;  4S3O B;  3HTK C;  3N9N A;  2CRW A;  2LAU A;  4CA1 A;  2KWO A;  1LDJ B;  5J3X A;  5FB1 A;  2MKE A;  4FJC A;  3ASL A;  3L1X A;  4A4B A;  3ZPV E;  5TRB A;  2YUC A;  3SOW A;  3O70 A;  4I7B A;  2L75 A;  5TAB A;  1WE9 A;  2HDP A;  5LCW B;  1WEE A;  3LQI A;  1WIM A;  5SVI B;  4BBQ A;  2VJF A;  4P5O B;  1MM3 A;  3Q1D A;  1X4I A;  2VJF B;  4YC9 A;  2CSV A;  2KGG A;  3H7H A;  2G6Q A;  4L7X A;  4XI1 A;  3VK6 A;  2YSM A;  2D8S A;  3LJU X;  1VD4 A;  2XOY A;  2XEU A;  4LAD B;  2FD4 A;  2LN0 A;  3FM8 C;  4Q6F A;  4W4U A;  3ZVZ B;  1V87 A;  3O33 A;  5AIT A;  3PUR A;  1WIL A;  5LKU A;  3HCT A;  2QIZ A;  2XP0 A;  4FO9 A;  1WEU A;  2DX8 A;  2H0D A;  1Z6U A;  2ECG A;  1MBM A;  4CCG X;  2VPB A;  1N87 A;  1CHC A;  4ZUX U;  3L11 A;  5H9M A;  2KKY A;  3L1Z B;  5AIU A;  2H0D B;  4LKA A;  3SOU A;  2JMI A;  4V3L C;  1VYX A;  2JM3 A;  4FK5 A;  3JUE A;  4PPE A;  2L5U A;  3LQJ A;  2MNZ A;  5G04 B;  2VJE B;  2RSD A;  4QQ4 A;  2L0B A;  3N9Q A;  4YAT A;  1MM2 A;  3U5M A;  4GNE A;  1ZBD B;  3U5O A;  4GNF A;  2M85 A;  4LJN A;  3O7A A;  3DWD A;  3KV6 A;  2M1R A;  4F1P A;  2VPD A;  2ECI A;  4WZ2 A;  4B7Y C;  5D1K B;  5FEY A;  1IYM A;  2XB1 A;  5TDR A;  1Z60 A;  5D1L B;  2MA5 A;  3I2D A;  4A0C D;  5DKA A;  3FL2 A;  4N3W A;  2KYU A;  2LV9 A;  4YBS A;  2YW8 A;  4WZ3 B;  2DSM A;  5KH9 A;  2YUR A;  3ZTG A;  2LGL A;  4UI9 B;  2BAY A;  2EGM A;  2KWK A;  2F6J A;  4YBT A;  4O64 A;  2JUN A;  4R8P K;  2M3H A;  3KV5 A;  5SVI A;  2C2L A;  4AYC A;  3O36 A;  2VPG A;  5C11 A;  2UZG A;  5K3Q A;  4AYC B;  4YBM A;  4QF2 A;  2MIQ A;  2AN6 A;  2HYE D;  3LQH A;  3RTR B;  2MD7 B;  1DCQ A;  2M6M A;  2KU3 A;  3QZV A;  2KRE A;  5SVY A;  2PNX A;  1HYJ A;  5B77 A;  1XWH A;  4IC2 A;  5H1V A;  1LDK C;  3LRQ A;  5FER A;  2KKX A;  2FSA A;  5DIN A;  2LQ6 A;  4ZQL A;  2XOC A;  4BHW A;  1WEN A;  2KWJ A;  3EB5 A;  4GNG A;  2CT2 A;  4ZDT A;  2K17 A;  4A4C A;  1WEM A;  2ZET C;  2G45 A;  4X3G A;  2MNY A;  4YAB A;  2PUY A;  4Z0O A;  5G05 B;  2KGI A;  2OWA A;  5TDW A;  2Y1M A;  4I7C A;  1WEV A;  3RPG C;  2YT5 A;  2LRI C;  2CRR A;  3M63 A;  1WEP A;  4AP4 A;  2F6N A;  2EXU A;  3LVQ E;  1WES A;  5H1U A;  2KIZ A;  3ZVY A;  1JM7 A;  5H1T A;  2EOD A;  4OGE A;  3FAO A;  2VNF A;  3PLW A;  2LGG A; 
#chains in the Genus database with same CATH homology
 1E4U A;  1T1H A;  2KFT A;  2K1J A;  3HCS A;  1JM7 B;  3T6R A;  2VJE A;  2YQM A;  2MT5 A;  4A49 A;  2KWN A;  4MSX A;  5G0F A;  2F42 A;  3GV4 A;  4FIP A;  4AUQ B;  1FP0 A;  3N9P A;  3N9M A;  2JRJ A;  2LXP C;  4PTB A;  4S3O C;  2JMD A;  4WA6 A;  3SHB A;  5EYA F;  1RMD A;  4NN2 A;  4TKP B;  1U6G B;  3O34 A;  5LKT A;  3RPG B;  1K2F A;  3MHS A;  3V43 A;  3ZYQ A;  1F62 A;  1DVP A;  4N4F A;  5C13 A;  4V3K C;  3IHP A;  4YAD A;  4WZ0 A;  4C9Z A;  5I3L A;  4B86 C;  4YAX A;  2CKL B;  3KNV A;  2ECN A;  2YHO A;  2QIC A;  3ZNI A;  5TBN A;  4L58 A;  2FUI A;  2MUM A;  4R7E A;  4GND A;  4MVT A;  2MD8 C;  1BOR A;  2VPE A;  2KE1 A;  5JG6 A;  4AVX A;  1Z2Q A;  4F52 B;  2ECV A;  1X4U A;  1WFK A;  3SOX A;  2ECW A;  3ZPV 1;  2YSJ A;  2OXQ C;  3GL6 A;  2E6R A;  2EA6 A;  1JOC A;  1WEQ A;  2LXH C;  5B75 A;  3M62 A;  2YU4 A;  2MA6 A;  2VP7 A;  1HYI A;  4IC3 A;  5D1M B;  4QF3 A;  5LKX A;  3NG2 A;  2Y43 A;  2ECT A;  2IDA A;  1X4J A;  2YQL A;  2L80 A;  2YYR A;  3DPL R;  1WEO A;  2C2V S;  1G25 A;  2LGV A;  4UP5 A;  3KQI A;  3C6W A;  2LGK A;  2E6S A;  3C5K A;  2L43 A;  3MHH A;  3U5N A;  1VFY A;  2CSY A;  2JMJ A;  2YRE A;  5B8D A;  5LKZ A;  2K4D A;  3N9L A;  3T7L A;  3U5P A;  4UP0 A;  3DQV R;  2LDR A;  2FUU A;  3N9O A;  4GB0 A;  1FBV A;  2G43 A;  5KH7 A;  3O35 A;  2EGP A;  4LK9 A;  2YHN A;  5B79 A;  3PUQ A;  2Y1N A;  5FB0 A;  3EB6 A;  4R2Y A;  2NAA A;  2I50 A;  2K16 A;  1WGM A;  2RI7 A;  5B78 A;  1WEW A;  2CKL A;  4LLB A;  3PHD A;  3M99 A;  3O37 A;  2KR4 A;  2QJ0 A;  2ECJ A;  5B76 A;  3HCU A;  5KH3 A;  4I7D A;  2CSZ A;  4S3O B;  3HTK C;  3N9N A;  4CA1 A;  2KWO A;  1LDJ B;  5J3X A;  5FB1 A;  4FJC A;  3ASL A;  3L1X A;  4A4B A;  3ZPV E;  5TRB A;  2YUC A;  3SOW A;  3O70 A;  4I7B A;  2L75 A;  5TAB A;  1WE9 A;  2HDP A;  5LCW B;  1WEE A;  3LQI A;  1WIM A;  4BBQ A;  2VJF A;  4P5O B;  1MM3 A;  1X4I A;  2VJF B;  4YC9 A;  2KGG A;  2G6Q A;  4L7X A;  4XI1 A;  3VK6 A;  2YSM A;  2D8S A;  1VD4 A;  2XEU A;  4LAD B;  2LN0 A;  4Q6F A;  4W4U A;  3ZVZ B;  1V87 A;  3O33 A;  5AIT A;  3PUR A;  1WIL A;  5LKU A;  3HCT A;  2QIZ A;  4FO9 A;  1WEU A;  2DX8 A;  2H0D A;  1Z6U A;  2ECG A;  4CCG X;  2VPB A;  1N87 A;  1CHC A;  4ZUX U;  3L11 A;  5H9M A;  3L1Z B;  5AIU A;  2H0D B;  4LKA A;  3SOU A;  2JMI A;  4V3L C;  1VYX A;  4FK5 A;  4PPE A;  2L5U A;  3LQJ A;  2MNZ A;  5G04 B;  2VJE B;  2RSD A;  2L0B A;  3N9Q A;  4YAT A;  1MM2 A;  3U5M A;  4GNE A;  1ZBD B;  3U5O A;  4GNF A;  2M85 A;  4LJN A;  3O7A A;  3KV6 A;  2M1R A;  2VPD A;  2ECI A;  4WZ2 A;  4B7Y C;  5D1K B;  5FEY A;  1IYM A;  2XB1 A;  5TDR A;  1Z60 A;  5D1L B;  2MA5 A;  3I2D A;  4A0C D;  5DKA A;  3FL2 A;  4N3W A;  2KYU A;  2LV9 A;  4YBS A;  2YW8 A;  4WZ3 B;  5KH9 A;  2YUR A;  3ZTG A;  2LGL A;  4UI9 B;  2BAY A;  2KWK A;  2F6J A;  4YBT A;  4O64 A;  4R8P K;  2M3H A;  3KV5 A;  2C2L A;  4AYC A;  3O36 A;  2VPG A;  5C11 A;  2UZG A;  4AYC B;  4YBM A;  4QF2 A;  2MIQ A;  2AN6 A;  2HYE D;  3LQH A;  3RTR B;  2MD7 B;  2M6M A;  2KU3 A;  3QZV A;  2KRE A;  2PNX A;  1HYJ A;  5B77 A;  1XWH A;  4IC2 A;  5H1V A;  1LDK C;  3LRQ A;  5FER A;  2FSA A;  5DIN A;  2LQ6 A;  4ZQL A;  4BHW A;  1WEN A;  2KWJ A;  3EB5 A;  4GNG A;  2CT2 A;  4ZDT A;  2K17 A;  4A4C A;  1WEM A;  2ZET C;  2G45 A;  4X3G A;  2MNY A;  4YAB A;  2PUY A;  5G05 B;  2KGI A;  5TDW A;  2Y1M A;  4I7C A;  1WEV A;  3RPG C;  2YT5 A;  2LRI C;  3M63 A;  1WEP A;  4AP4 A;  2F6N A;  1WES A;  5H1U A;  2KIZ A;  3ZVY A;  1JM7 A;  5H1T A;  2EOD A;  2VNF A;  2LGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...