1VYXA

Solution structure of the kshv k3 n-terminal domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
MEDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF K3
publication title Solution Structure of the Kaposi'S Sarcoma-Associated Herpesvirus K3 N-Terminal Domain Reveals a Novel E2-Binding C4Hc3-Type Ring Domain
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Zinc-binding protein
total genus 5
structure length 60
sequence length 60
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12906 RINGv RING-variant domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vyxA00
4I7CA 2ECWA 5TDRA 3O7AA 3ASLA 2UZGA 1HYJA 2VJFB 1K2FA 3O34A 2FUUA 4TKPB 5TRBA 2JMJA 4LJNA 5LKXA 2ECIA 2YHOA 1DVPA 1Z6UA 2QIZA 3L11A 4MVTA 4A4CA 4GNGA 5B8DA 4YAXA 4YATA 2VJEB 3O36A 2XEUA 3T7LA 2MD7B 2PNXA 3O33A 2YW8A 5TABA 3T6RA 4B7YC 3PURA 4IC2A 2LXPC 1WEQA 2VJFA 4R8PK 2KFTA 3ZTGA 2KGIA 2BAYA 4N4FA 2JMDA 2LGGA 1X4UA 4XI1A 4V3LC 5FB1A 4C9ZA 3PHDA 1WEVA 3GV4A 4R7EA 2KE1A 3HTKC 3C6WA 2G45A 2RI7A 1CHCA 2MNYA 2EA6A 2QICA 1F62A 1WEPA 4UP0A 3DPLR 5FEYA 1Z60A 5I3LA 1JM7A 2VPGA 3SOWA 3N9NA 2C2LA 2YT5A 3C5KA 3QZVA 2L75A 3U5OA 2LGLA 5D1MB 1WEWA 2NAAA 4YBSA 2K17A 3N9OA 4LLBA 3KV5A 3HCSA 5TBNA 4A4BA 2YYRA 3HCUA 4YBMA 5C11A 3NG2A 4AVXA 3ZPVE 2VPBA 2M6MA 2G43A 2MT5A 2YQMA 3MHHA 1VFYA 4YABA 2L5UA 2RSDA 2YQLA 2YU4A 3IHPA 4F52B 5B79A 1WGMA 2KGGA 3L1ZB 4YBTA 5H1TA 2KWJA 3SOUA 2KREA 4BBQA 5B77A 2MA6A 2LGKA 5G0FA 1T1HA 4L58A 3L1XA 5DKAA 2ECJA 3U5MA 3DQVR 4FK5A 4X3GA 5KH9A 1WFKA 3KQIA 3I2DA 1WE9A 2JMIA 2MA5A 2K4DA 2E6RA 1RMDA 4WZ3B 1WENA 3U5PA 3LQJA 2XB1A 3N9MA 2H0DA 4I7DA 4GNFA 5AITA 2EODA 2LDRA 3SHBA 4BHWA 3N9PA 1JM7B 2LQ6A 3MHSA 1FP0A 4LADB 4YADA 4ZQLA 1E4UA 2CSYA 2D8SA 3O70A 4ZUXU 2AN6A 4CA1A 5B78A 2KWKA 1FBVA 3FL2A 4PTBA 1ZBDB 3O35A 4MSXA 4GNDA 5D1KB 5KH3A 5LCWB 2EGPA 2QJ0A 1VD4A 5C13A 2K1JA 1WILA 4I7BA 2YSJA 2DX8A 1XWHA 2ECGA 1U6GB 2ECVA 4A49A 2F6NA 5EYAF 3M63A 3N9LA 3RPGC 4UI9B 3RTRB 1V87A 2KWNA 2L0BA 2ZETC 4FO9A 1LDKC 4N3WA 4P5OB 3GL6A 1BORA 1WEUA 2K16A 5AIUA 3LQHA 2KU3A 1X4IA 2CSZA 1WESA 4O64A 3U5NA 2MD8C 4FIPA 2HDPA 3HCTA 3O37A 2G6QA 5H9MA 2E6SA 1N87A 3N9QA 1VYXA 2LRIC 2ECTA 3ZVZB 2VPDA 3ZPV1 4WZ2A 2H0DB 1Z2QA 3V43A 4B86C 4UP5A 4YC9A 4Q6FA 4WA6A 2KIZA 2F6JA 4AYCA 2IDAA 4WZ0A 2YUCA 5G05B 4ZDTA 4AUQB 3LQIA 2ECNA 4S3OC 3ZVYA 2MUMA 2Y1NA 5JG6A 2Y1MA 2HYED 3SOXA 2KR4A 2LV9A 5DINA 2Y43A 1LDJB 2VP7A 3EB6A 4NN2A 5H1UA 5J3XA 2M1RA 5G04B 5FERA 3KNVA 2JRJA 3RPGB 2LXHC 2YURA 4V3KC 2CT2A 5H1VA 3ZNIA 2M85A 3EB5A 3VK6A 4LKAA 3ZYQA 2YREA 2MIQA 2VJEA 2CKLB 5LKUA 4L7XA 2MNZA 2YSMA 4PPEA 5D1LB 4GNEA 5B76A 4LK9A 3PUQA 4QF2A 2FUIA 2KYUA 1X4JA 5LKTA 5KH7A 4W4UA 1WEEA 1G25A 4FJCA 1WEOA 3KV6A 2CKLA 4AYCB 2YHNA 2L80A 1WIMA 5B75A 2L43A 2FSAA 2F42A 2VNFA 1IYMA 2KWOA 2M3HA 1JOCA 3M99A 5LKZA 3LRQA 4IC3A 2I50A 1MM3A 4CCGX 2C2VS 4S3OB 4GB0A 2LGVA 4AP4A 1WEMA 5FB0A 2PUYA 2LN0A 5TDWA 3M62A 4QF3A 1HYIA 2VPEA 1MM2A 4R2YA 4A0CD 2OXQC
chains in the Genus database with same CATH superfamily
4I7CA 2ECWA 5TDRA 3O7AA 4OGEA 3ASLA 3DWDA 2UZGA 1HYJA 2VJFB 1K2FA 3O34A 2FUUA 4TKPB 5TRBA 2CONA 2JMJA 4LJNA 5LKXA 2ECIA 2YHOA 1DVPA 1Z6UA 2QIZA 3L11A 4MVTA 4A4CA 4GNGA 5B8DA 4YAXA 4YATA 2VJEB 3O36A 3H7HA 2KKYA 2XEUA 3T7LA 2MD7B 3PLWA 2PNXA 3O33A 2YW8A 5TABA 3T6RA 2KKXA 2JUNA 4B7YC 3PURA 4IC2A 2LXPC 1WEQA 2RR4A 2VJFA 4R8PK 2KFTA 3ZTGA 2KGIA 2BAYA 4N4FA 2JMDA 2LGGA 1X4UA 4XI1A 4V3LC 5FB1A 4C9ZA 3PHDA 1WEVA 2XOZA 3GV4A 4R7EA 2KE1A 3HTKC 4O62A 3C6WA 2G45A 2RI7A 1CHCA 2MNYA 2EA6A 2QICA 1F62A 1WEPA 4UP0A 3DPLR 3LVQE 5FEYA 2XOYA 1Z60A 5I3LA 1JM7A 2VPGA 2D8UA 3SOWA 2YVRA 3N9NA 2C2LA 2YT5A 3C5KA 3QZVA 2L75A 3U5OA 2LGLA 5D1MB 2EGMA 1WEWA 2NAAA 4YBSA 5SVYA 2K17A 2CRRA 3N9OA 4LLBA 3KV5A 3HCSA 5TBNA 4A4BA 3MDBC 2YYRA 3HCUA 4F1PA 2LAUA 2B0OE 4YBMA 5C11A 3NG2A 4AVXA 3ZPVE 2VPBA 2M6MA 2G43A 2MT5A 2YQMA 3MHHA 1VFYA 4YABA 2L5UA 2RSDA 2YQLA 2YU4A 3IHPA 4F52B 5B79A 3KDEC 1WGMA 2KGGA 3L1ZB 4YBTA 5H1TA 2KWJA 3SOUA 2KREA 4BBQA 5SVXA 2JM3A 5B77A 2MA6A 2LGKA 5G0FA 1T1HA 4L58A 3L1XA 5DKAA 2DJAA 2OWAA 2ECJA 3U5MA 3DQVR 4FK5A 4X3GA 5KH9A 1WFKA 3KQIA 3I2DA 1WE9A 2JMIA 2MA5A 2K4DA 2E6RA 1RMDA 4WZ3B 1WENA 3U5PA 3LQJA 2XB1A 3N9MA 2H0DA 4I7DA 4GNFA 5AITA 2EODA 2LDRA 3SHBA 3SUBA 4BHWA 3N9PA 1JM7B 2LQ6A 3MHSA 1FP0A 4LADB 4YADA 4ZQLA 1E4UA 2E61A 2CSYA 2IQJA 2D8SA 3O70A 4ZUXU 3FM8C 2AN6A 4CA1A 5B78A 2KWKA 1FBVA 3FL2A 4PTBA 3FAOA 3M7KA 1ZBDB 3O35A 4OGCA 4MSXA 4QQ4A 4GNDA 5D1KB 5KH3A 5LCWB 2EGPA 2FFWA 2QJ0A 1VD4A 5C13A 2K1JA 1WILA 4I7BA 2YSJA 2DX8A 1XWHA 2ECGA 1U6GB 2ECVA 3T9KA 4A49A 2F6NA 3LVRE 5EYAF 3M63A 3N9LA 3RPGC 4UI9B 3RTRB 1V87A 2EXUA 2KWNA 2L0BA 2ZETC 4FO9A 1LDKC 4N3WA 1DCQA 4P5OB 3GL6A 1BORA 1WEUA 2K16A 5AIUA 3LQHA 2KU3A 1X4IA 2CSZA 1WESA 3LDYA 4O64A 3U5NA 2MD8C 4FIPA 4H9DA 2HDPA 3HCTA 3O37A 2G6QA 5H9MA 2E6SA 1N87A 3N9QA 1VYXA 2LRIC 2ECTA 3ZVZB 2VPDA 3ZPV1 4WZ2A 2H0DB 1Z2QA 3V43A 2FD4A 4B86C 4UP5A 4Z0RA 4YC9A 4Q6FA 4WA6A 2KIZA 2F6JA 4AYCA 2IDAA 2DSMA 4WZ0A 2YUCA 5G05B 4ZDTA 4AUQB 2CRWA 3LQIA 2ECNA 4S3OC 3ZVYA 2MUMA 2Y1NA 5JG6A 2Y1MA 2HYED 2MKEA 3JUEA 3SOXA 2KR4A 2LV9A 5DINA 2Y43A 1LDJB 2VP7A 3Q1DA 2L7PA 5SVIA 5K3QA 2XOCA 3EB6A 4NN2A 5H1UA 5J3XA 2M1RA 5G04B 5FERA 3KNVA 2JRJA 3RPGB 2LXHC 2YURA 4V3KC 2CT2A 5H1VA 3ZNIA 2M85A 3EB5A 3VK6A 4LKAA 3ZYQA 2YREA 2MIQA 2M13A 3O47A 2VJEA 2CKLB 5LKUA 4L7XA 2MNZA 2YSMA 4PPEA 5D1LB 4GNEA 3FEHA 5B76A 3FJUB 4LK9A 3DDTA 3PUQA 4QF2A 2FUIA 2KYUA 1X4JA 5LKTA 5KH7A 4W4UA 2P57A 1WEEA 1G25A 4FJCA 1WEOA 3KV6A 2CKLA 4AYCB 2YHNA 2L80A 1WIMA 5B75A 2L43A 2FSAA 2F42A 2VNFA 1IYMA 2KWOA 2M3HA 1JOCA 3FANA 3M99A 5LKZA 2XP0A 3LRQA 4IC3A 2I50A 1MM3A 4CCGX 2C2VS 4S3OB 4Z0OA 4GB0A 3E2DA 2LGVA 5SVIB 2CSVA 4AP4A 1WEMA 5FB0A 2PUYA 2LN0A 5TDWA 3LJUX 3M62A 4QF3A 1MBMA 1HYIA 2VPEA 1MM2A 4R2YA 4A0CD 2OXQC
chains in the Genus database with same CATH topology
4I7CA 2ECWA 5TDRA 3O7AA 3ASLA 2UZGA 1HYJA 2VJFB 1K2FA 3O34A 2FUUA 4TKPB 5TRBA 2JMJA 4LJNA 5LKXA 2ECIA 2YHOA 1DVPA 1Z6UA 2QIZA 3L11A 4MVTA 4A4CA 4GNGA 5B8DA 4YAXA 4YATA 2VJEB 3O36A 2XEUA 3T7LA 2MD7B 2PNXA 3O33A 2YW8A 5TABA 3T6RA 4B7YC 3PURA 4IC2A 2LXPC 1WEQA 2VJFA 4R8PK 2KFTA 3ZTGA 2KGIA 2BAYA 4N4FA 2JMDA 2LGGA 1X4UA 4XI1A 4V3LC 5FB1A 4C9ZA 3PHDA 1WEVA 3GV4A 4R7EA 2KE1A 3HTKC 3C6WA 2G45A 2RI7A 1CHCA 2MNYA 2EA6A 2QICA 1F62A 1WEPA 4UP0A 3DPLR 5FEYA 1Z60A 5I3LA 1JM7A 2VPGA 3SOWA 3N9NA 2C2LA 2YT5A 3C5KA 3QZVA 2L75A 3U5OA 2LGLA 5D1MB 1WEWA 2NAAA 4YBSA 2K17A 3N9OA 4LLBA 3KV5A 3HCSA 5TBNA 4A4BA 2YYRA 3HCUA 4YBMA 5C11A 3NG2A 4AVXA 3ZPVE 2VPBA 2M6MA 2G43A 2MT5A 2YQMA 3MHHA 1VFYA 4YABA 2L5UA 2RSDA 2YQLA 2YU4A 3IHPA 4F52B 5B79A 1WGMA 2KGGA 3L1ZB 4YBTA 5H1TA 2KWJA 3SOUA 2KREA 4BBQA 5B77A 2MA6A 2LGKA 5G0FA 1T1HA 4L58A 3L1XA 5DKAA 2ECJA 3U5MA 3DQVR 4FK5A 4X3GA 5KH9A 1WFKA 3KQIA 3I2DA 1WE9A 2JMIA 2MA5A 2K4DA 2E6RA 1RMDA 4WZ3B 1WENA 3U5PA 3LQJA 2XB1A 3N9MA 2H0DA 4I7DA 4GNFA 5AITA 2EODA 2LDRA 3SHBA 4BHWA 3N9PA 1JM7B 2LQ6A 3MHSA 1FP0A 4LADB 4YADA 4ZQLA 1E4UA 2CSYA 2D8SA 3O70A 4ZUXU 2AN6A 4CA1A 5B78A 2KWKA 1FBVA 3FL2A 4PTBA 1ZBDB 3O35A 4MSXA 4GNDA 5D1KB 5KH3A 5LCWB 2EGPA 2QJ0A 1VD4A 5C13A 2K1JA 1WILA 4I7BA 2YSJA 2DX8A 1XWHA 2ECGA 1U6GB 2ECVA 4A49A 2F6NA 5EYAF 3M63A 3N9LA 3RPGC 4UI9B 3RTRB 1V87A 2KWNA 2L0BA 2ZETC 4FO9A 1LDKC 4N3WA 4P5OB 3GL6A 1BORA 1WEUA 2K16A 5AIUA 3LQHA 2KU3A 1X4IA 2CSZA 1WESA 4O64A 3U5NA 2MD8C 4FIPA 2HDPA 3HCTA 3O37A 2G6QA 5H9MA 2E6SA 1N87A 3N9QA 1VYXA 2LRIC 2ECTA 3ZVZB 2VPDA 3ZPV1 4WZ2A 2H0DB 1Z2QA 3V43A 4B86C 4UP5A 4YC9A 4Q6FA 4WA6A 2KIZA 2F6JA 4AYCA 2IDAA 4WZ0A 2YUCA 5G05B 4ZDTA 4AUQB 3LQIA 2ECNA 4S3OC 3ZVYA 2MUMA 2Y1NA 5JG6A 2Y1MA 2HYED 3SOXA 2KR4A 2LV9A 5DINA 2Y43A 1LDJB 2VP7A 3EB6A 4NN2A 5H1UA 5J3XA 2M1RA 5G04B 5FERA 3KNVA 2JRJA 3RPGB 2LXHC 2YURA 4V3KC 2CT2A 5H1VA 3ZNIA 2M85A 3EB5A 3VK6A 4LKAA 3ZYQA 2YREA 2MIQA 2VJEA 2CKLB 5LKUA 4L7XA 2MNZA 2YSMA 4PPEA 5D1LB 4GNEA 5B76A 4LK9A 3PUQA 4QF2A 2FUIA 2KYUA 1X4JA 5LKTA 5KH7A 4W4UA 1WEEA 1G25A 4FJCA 1WEOA 3KV6A 2CKLA 4AYCB 2YHNA 2L80A 1WIMA 5B75A 2L43A 2FSAA 2F42A 2VNFA 1IYMA 2KWOA 2M3HA 1JOCA 3M99A 5LKZA 3LRQA 4IC3A 2I50A 1MM3A 4CCGX 2C2VS 4S3OB 4GB0A 2LGVA 4AP4A 1WEMA 5FB0A 2PUYA 2LN0A 5TDWA 3M62A 4QF3A 1HYIA 2VPEA 1MM2A 4R2YA 4A0CD 2OXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7C A;  2ECW A;  5TDR A;  3O7A A;  3ASL A;  2UZG A;  1HYJ A;  2VJF B;  1K2F A;  3O34 A;  2FUU A;  4TKP B;  5TRB A;  2JMJ A;  4LJN A;  5LKX A;  2ECI A;  2YHO A;  1DVP A;  1Z6U A;  2QIZ A;  3L11 A;  4MVT A;  4A4C A;  4GNG A;  5B8D A;  4YAX A;  4YAT A;  2VJE B;  3O36 A;  2XEU A;  3T7L A;  2MD7 B;  2PNX A;  3O33 A;  2YW8 A;  5TAB A;  3T6R A;  4B7Y C;  3PUR A;  4IC2 A;  2LXP C;  1WEQ A;  2VJF A;  4R8P K;  2KFT A;  3ZTG A;  2KGI A;  2BAY A;  4N4F A;  2JMD A;  2LGG A;  1X4U A;  4XI1 A;  4V3L C;  5FB1 A;  4C9Z A;  3PHD A;  1WEV A;  3GV4 A;  4R7E A;  2KE1 A;  3HTK C;  3C6W A;  2G45 A;  2RI7 A;  1CHC A;  2MNY A;  2EA6 A;  2QIC A;  1F62 A;  1WEP A;  4UP0 A;  3DPL R;  5FEY A;  1Z60 A;  5I3L A;  1JM7 A;  2VPG A;  3SOW A;  3N9N A;  2C2L A;  2YT5 A;  3C5K A;  3QZV A;  2L75 A;  3U5O A;  2LGL A;  5D1M B;  1WEW A;  2NAA A;  4YBS A;  2K17 A;  3N9O A;  4LLB A;  3KV5 A;  3HCS A;  5TBN A;  4A4B A;  2YYR A;  3HCU A;  4YBM A;  5C11 A;  3NG2 A;  4AVX A;  3ZPV E;  2VPB A;  2M6M A;  2G43 A;  2MT5 A;  2YQM A;  3MHH A;  1VFY A;  4YAB A;  2L5U A;  2RSD A;  2YQL A;  2YU4 A;  3IHP A;  4F52 B;  5B79 A;  1WGM A;  2KGG A;  3L1Z B;  4YBT A;  5H1T A;  2KWJ A;  3SOU A;  2KRE A;  4BBQ A;  5B77 A;  2MA6 A;  2LGK A;  5G0F A;  1T1H A;  4L58 A;  3L1X A;  5DKA A;  2ECJ A;  3U5M A;  3DQV R;  4FK5 A;  4X3G A;  5KH9 A;  1WFK A;  3KQI A;  3I2D A;  1WE9 A;  2JMI A;  2MA5 A;  2K4D A;  2E6R A;  1RMD A;  4WZ3 B;  1WEN A;  3U5P A;  3LQJ A;  2XB1 A;  3N9M A;  2H0D A;  4I7D A;  4GNF A;  5AIT A;  2EOD A;  2LDR A;  3SHB A;  4BHW A;  3N9P A;  1JM7 B;  2LQ6 A;  3MHS A;  1FP0 A;  4LAD B;  4YAD A;  4ZQL A;  1E4U A;  2CSY A;  2D8S A;  3O70 A;  4ZUX U;  2AN6 A;  4CA1 A;  5B78 A;  2KWK A;  1FBV A;  3FL2 A;  4PTB A;  1ZBD B;  3O35 A;  4MSX A;  4GND A;  5D1K B;  5KH3 A;  5LCW B;  2EGP A;  2QJ0 A;  1VD4 A;  5C13 A;  2K1J A;  1WIL A;  4I7B A;  2YSJ A;  2DX8 A;  1XWH A;  2ECG A;  1U6G B;  2ECV A;  4A49 A;  2F6N A;  5EYA F;  3M63 A;  3N9L A;  3RPG C;  4UI9 B;  3RTR B;  1V87 A;  2KWN A;  2L0B A;  2ZET C;  4FO9 A;  1LDK C;  4N3W A;  4P5O B;  3GL6 A;  1BOR A;  1WEU A;  2K16 A;  5AIU A;  3LQH A;  2KU3 A;  1X4I A;  2CSZ A;  1WES A;  4O64 A;  3U5N A;  2MD8 C;  4FIP A;  2HDP A;  3HCT A;  3O37 A;  2G6Q A;  5H9M A;  2E6S A;  1N87 A;  3N9Q A;  1VYX A;  2LRI C;  2ECT A;  3ZVZ B;  2VPD A;  3ZPV 1;  4WZ2 A;  2H0D B;  1Z2Q A;  3V43 A;  4B86 C;  4UP5 A;  4YC9 A;  4Q6F A;  4WA6 A;  2KIZ A;  2F6J A;  4AYC A;  2IDA A;  4WZ0 A;  2YUC A;  5G05 B;  4ZDT A;  4AUQ B;  3LQI A;  2ECN A;  4S3O C;  3ZVY A;  2MUM A;  2Y1N A;  5JG6 A;  2Y1M A;  2HYE D;  3SOX A;  2KR4 A;  2LV9 A;  5DIN A;  2Y43 A;  1LDJ B;  2VP7 A;  3EB6 A;  4NN2 A;  5H1U A;  5J3X A;  2M1R A;  5G04 B;  5FER A;  3KNV A;  2JRJ A;  3RPG B;  2LXH C;  2YUR A;  4V3K C;  2CT2 A;  5H1V A;  3ZNI A;  2M85 A;  3EB5 A;  3VK6 A;  4LKA A;  3ZYQ A;  2YRE A;  2MIQ A;  2VJE A;  2CKL B;  5LKU A;  4L7X A;  2MNZ A;  2YSM A;  4PPE A;  5D1L B;  4GNE A;  5B76 A;  4LK9 A;  3PUQ A;  4QF2 A;  2FUI A;  2KYU A;  1X4J A;  5LKT A;  5KH7 A;  4W4U A;  1WEE A;  1G25 A;  4FJC A;  1WEO A;  3KV6 A;  2CKL A;  4AYC B;  2YHN A;  2L80 A;  1WIM A;  5B75 A;  2L43 A;  2FSA A;  2F42 A;  2VNF A;  1IYM A;  2KWO A;  2M3H A;  1JOC A;  3M99 A;  5LKZ A;  3LRQ A;  4IC3 A;  2I50 A;  1MM3 A;  4CCG X;  2C2V S;  4S3O B;  4GB0 A;  2LGV A;  4AP4 A;  1WEM A;  5FB0 A;  2PUY A;  2LN0 A;  5TDW A;  3M62 A;  4QF3 A;  1HYI A;  2VPE A;  1MM2 A;  4R2Y A;  4A0C D;  2OXQ C; 
#chains in the Genus database with same CATH topology
 4I7C A;  2ECW A;  5TDR A;  3O7A A;  4OGE A;  3ASL A;  3DWD A;  2UZG A;  1HYJ A;  2VJF B;  1K2F A;  3O34 A;  2FUU A;  4TKP B;  5TRB A;  2CON A;  2JMJ A;  4LJN A;  5LKX A;  2ECI A;  2YHO A;  1DVP A;  1Z6U A;  2QIZ A;  3L11 A;  4MVT A;  4A4C A;  4GNG A;  5B8D A;  4YAX A;  4YAT A;  2VJE B;  3O36 A;  3H7H A;  2KKY A;  2XEU A;  3T7L A;  2MD7 B;  3PLW A;  2PNX A;  3O33 A;  2YW8 A;  5TAB A;  3T6R A;  2KKX A;  2JUN A;  4B7Y C;  3PUR A;  4IC2 A;  2LXP C;  1WEQ A;  2RR4 A;  2VJF A;  4R8P K;  2KFT A;  3ZTG A;  2KGI A;  2BAY A;  4N4F A;  2JMD A;  2LGG A;  1X4U A;  4XI1 A;  4V3L C;  5FB1 A;  4C9Z A;  3PHD A;  1WEV A;  2XOZ A;  3GV4 A;  4R7E A;  2KE1 A;  3HTK C;  4O62 A;  3C6W A;  2G45 A;  2RI7 A;  1CHC A;  2MNY A;  2EA6 A;  2QIC A;  1F62 A;  1WEP A;  4UP0 A;  3DPL R;  3LVQ E;  5FEY A;  2XOY A;  1Z60 A;  5I3L A;  1JM7 A;  2VPG A;  2D8U A;  3SOW A;  2YVR A;  3N9N A;  2C2L A;  2YT5 A;  3C5K A;  3QZV A;  2L75 A;  3U5O A;  2LGL A;  5D1M B;  2EGM A;  1WEW A;  2NAA A;  4YBS A;  5SVY A;  2K17 A;  2CRR A;  3N9O A;  4LLB A;  3KV5 A;  3HCS A;  5TBN A;  4A4B A;  3MDB C;  2YYR A;  3HCU A;  4F1P A;  2LAU A;  2B0O E;  4YBM A;  5C11 A;  3NG2 A;  4AVX A;  3ZPV E;  2VPB A;  2M6M A;  2G43 A;  2MT5 A;  2YQM A;  3MHH A;  1VFY A;  4YAB A;  2L5U A;  2RSD A;  2YQL A;  2YU4 A;  3IHP A;  4F52 B;  5B79 A;  3KDE C;  1WGM A;  2KGG A;  3L1Z B;  4YBT A;  5H1T A;  2KWJ A;  3SOU A;  2KRE A;  4BBQ A;  5SVX A;  2JM3 A;  5B77 A;  2MA6 A;  2LGK A;  5G0F A;  1T1H A;  4L58 A;  3L1X A;  5DKA A;  2DJA A;  2OWA A;  2ECJ A;  3U5M A;  3DQV R;  4FK5 A;  4X3G A;  5KH9 A;  1WFK A;  3KQI A;  3I2D A;  1WE9 A;  2JMI A;  2MA5 A;  2K4D A;  2E6R A;  1RMD A;  4WZ3 B;  1WEN A;  3U5P A;  3LQJ A;  2XB1 A;  3N9M A;  2H0D A;  4I7D A;  4GNF A;  5AIT A;  2EOD A;  2LDR A;  3SHB A;  3SUB A;  4BHW A;  3N9P A;  1JM7 B;  2LQ6 A;  3MHS A;  1FP0 A;  4LAD B;  4YAD A;  4ZQL A;  1E4U A;  2E61 A;  2CSY A;  2IQJ A;  2D8S A;  3O70 A;  4ZUX U;  3FM8 C;  2AN6 A;  4CA1 A;  5B78 A;  2KWK A;  1FBV A;  3FL2 A;  4PTB A;  3FAO A;  3M7K A;  1ZBD B;  3O35 A;  4OGC A;  4MSX A;  4QQ4 A;  4GND A;  5D1K B;  5KH3 A;  5LCW B;  2EGP A;  2FFW A;  2QJ0 A;  1VD4 A;  5C13 A;  2K1J A;  1WIL A;  4I7B A;  2YSJ A;  2DX8 A;  1XWH A;  2ECG A;  1U6G B;  2ECV A;  3T9K A;  4A49 A;  2F6N A;  3LVR E;  5EYA F;  3M63 A;  3N9L A;  3RPG C;  4UI9 B;  3RTR B;  1V87 A;  2EXU A;  2KWN A;  2L0B A;  2ZET C;  4FO9 A;  1LDK C;  4N3W A;  1DCQ A;  4P5O B;  3GL6 A;  1BOR A;  1WEU A;  2K16 A;  5AIU A;  3LQH A;  2KU3 A;  1X4I A;  2CSZ A;  1WES A;  3LDY A;  4O64 A;  3U5N A;  2MD8 C;  4FIP A;  4H9D A;  2HDP A;  3HCT A;  3O37 A;  2G6Q A;  5H9M A;  2E6S A;  1N87 A;  3N9Q A;  1VYX A;  2LRI C;  2ECT A;  3ZVZ B;  2VPD A;  3ZPV 1;  4WZ2 A;  2H0D B;  1Z2Q A;  3V43 A;  2FD4 A;  4B86 C;  4UP5 A;  4Z0R A;  4YC9 A;  4Q6F A;  4WA6 A;  2KIZ A;  2F6J A;  4AYC A;  2IDA A;  2DSM A;  4WZ0 A;  2YUC A;  5G05 B;  4ZDT A;  4AUQ B;  2CRW A;  3LQI A;  2ECN A;  4S3O C;  3ZVY A;  2MUM A;  2Y1N A;  5JG6 A;  2Y1M A;  2HYE D;  2MKE A;  3JUE A;  3SOX A;  2KR4 A;  2LV9 A;  5DIN A;  2Y43 A;  1LDJ B;  2VP7 A;  3Q1D A;  2L7P A;  5SVI A;  5K3Q A;  2XOC A;  3EB6 A;  4NN2 A;  5H1U A;  5J3X A;  2M1R A;  5G04 B;  5FER A;  3KNV A;  2JRJ A;  3RPG B;  2LXH C;  2YUR A;  4V3K C;  2CT2 A;  5H1V A;  3ZNI A;  2M85 A;  3EB5 A;  3VK6 A;  4LKA A;  3ZYQ A;  2YRE A;  2MIQ A;  2M13 A;  3O47 A;  2VJE A;  2CKL B;  5LKU A;  4L7X A;  2MNZ A;  2YSM A;  4PPE A;  5D1L B;  4GNE A;  3FEH A;  5B76 A;  3FJU B;  4LK9 A;  3DDT A;  3PUQ A;  4QF2 A;  2FUI A;  2KYU A;  1X4J A;  5LKT A;  5KH7 A;  4W4U A;  2P57 A;  1WEE A;  1G25 A;  4FJC A;  1WEO A;  3KV6 A;  2CKL A;  4AYC B;  2YHN A;  2L80 A;  1WIM A;  5B75 A;  2L43 A;  2FSA A;  2F42 A;  2VNF A;  1IYM A;  2KWO A;  2M3H A;  1JOC A;  3FAN A;  3M99 A;  5LKZ A;  2XP0 A;  3LRQ A;  4IC3 A;  2I50 A;  1MM3 A;  4CCG X;  2C2V S;  4S3O B;  4Z0O A;  4GB0 A;  3E2D A;  2LGV A;  5SVI B;  2CSV A;  4AP4 A;  1WEM A;  5FB0 A;  2PUY A;  2LN0 A;  5TDW A;  3LJU X;  3M62 A;  4QF3 A;  1MBM A;  1HYI A;  2VPE A;  1MM2 A;  4R2Y A;  4A0C D;  2OXQ C; 
#chains in the Genus database with same CATH homology
 4I7C A;  2ECW A;  5TDR A;  3O7A A;  3ASL A;  2UZG A;  1HYJ A;  2VJF B;  1K2F A;  3O34 A;  2FUU A;  4TKP B;  5TRB A;  2JMJ A;  4LJN A;  5LKX A;  2ECI A;  2YHO A;  1DVP A;  1Z6U A;  2QIZ A;  3L11 A;  4MVT A;  4A4C A;  4GNG A;  5B8D A;  4YAX A;  4YAT A;  2VJE B;  3O36 A;  2XEU A;  3T7L A;  2MD7 B;  2PNX A;  3O33 A;  2YW8 A;  5TAB A;  3T6R A;  4B7Y C;  3PUR A;  4IC2 A;  2LXP C;  1WEQ A;  2VJF A;  4R8P K;  2KFT A;  3ZTG A;  2KGI A;  2BAY A;  4N4F A;  2JMD A;  2LGG A;  1X4U A;  4XI1 A;  4V3L C;  5FB1 A;  4C9Z A;  3PHD A;  1WEV A;  3GV4 A;  4R7E A;  2KE1 A;  3HTK C;  3C6W A;  2G45 A;  2RI7 A;  1CHC A;  2MNY A;  2EA6 A;  2QIC A;  1F62 A;  1WEP A;  4UP0 A;  3DPL R;  5FEY A;  1Z60 A;  5I3L A;  1JM7 A;  2VPG A;  3SOW A;  3N9N A;  2C2L A;  2YT5 A;  3C5K A;  3QZV A;  2L75 A;  3U5O A;  2LGL A;  5D1M B;  1WEW A;  2NAA A;  4YBS A;  2K17 A;  3N9O A;  4LLB A;  3KV5 A;  3HCS A;  5TBN A;  4A4B A;  2YYR A;  3HCU A;  4YBM A;  5C11 A;  3NG2 A;  4AVX A;  3ZPV E;  2VPB A;  2M6M A;  2G43 A;  2MT5 A;  2YQM A;  3MHH A;  1VFY A;  4YAB A;  2L5U A;  2RSD A;  2YQL A;  2YU4 A;  3IHP A;  4F52 B;  5B79 A;  1WGM A;  2KGG A;  3L1Z B;  4YBT A;  5H1T A;  2KWJ A;  3SOU A;  2KRE A;  4BBQ A;  5B77 A;  2MA6 A;  2LGK A;  5G0F A;  1T1H A;  4L58 A;  3L1X A;  5DKA A;  2ECJ A;  3U5M A;  3DQV R;  4FK5 A;  4X3G A;  5KH9 A;  1WFK A;  3KQI A;  3I2D A;  1WE9 A;  2JMI A;  2MA5 A;  2K4D A;  2E6R A;  1RMD A;  4WZ3 B;  1WEN A;  3U5P A;  3LQJ A;  2XB1 A;  3N9M A;  2H0D A;  4I7D A;  4GNF A;  5AIT A;  2EOD A;  2LDR A;  3SHB A;  4BHW A;  3N9P A;  1JM7 B;  2LQ6 A;  3MHS A;  1FP0 A;  4LAD B;  4YAD A;  4ZQL A;  1E4U A;  2CSY A;  2D8S A;  3O70 A;  4ZUX U;  2AN6 A;  4CA1 A;  5B78 A;  2KWK A;  1FBV A;  3FL2 A;  4PTB A;  1ZBD B;  3O35 A;  4MSX A;  4GND A;  5D1K B;  5KH3 A;  5LCW B;  2EGP A;  2QJ0 A;  1VD4 A;  5C13 A;  2K1J A;  1WIL A;  4I7B A;  2YSJ A;  2DX8 A;  1XWH A;  2ECG A;  1U6G B;  2ECV A;  4A49 A;  2F6N A;  5EYA F;  3M63 A;  3N9L A;  3RPG C;  4UI9 B;  3RTR B;  1V87 A;  2KWN A;  2L0B A;  2ZET C;  4FO9 A;  1LDK C;  4N3W A;  4P5O B;  3GL6 A;  1BOR A;  1WEU A;  2K16 A;  5AIU A;  3LQH A;  2KU3 A;  1X4I A;  2CSZ A;  1WES A;  4O64 A;  3U5N A;  2MD8 C;  4FIP A;  2HDP A;  3HCT A;  3O37 A;  2G6Q A;  5H9M A;  2E6S A;  1N87 A;  3N9Q A;  1VYX A;  2LRI C;  2ECT A;  3ZVZ B;  2VPD A;  3ZPV 1;  4WZ2 A;  2H0D B;  1Z2Q A;  3V43 A;  4B86 C;  4UP5 A;  4YC9 A;  4Q6F A;  4WA6 A;  2KIZ A;  2F6J A;  4AYC A;  2IDA A;  4WZ0 A;  2YUC A;  5G05 B;  4ZDT A;  4AUQ B;  3LQI A;  2ECN A;  4S3O C;  3ZVY A;  2MUM A;  2Y1N A;  5JG6 A;  2Y1M A;  2HYE D;  3SOX A;  2KR4 A;  2LV9 A;  5DIN A;  2Y43 A;  1LDJ B;  2VP7 A;  3EB6 A;  4NN2 A;  5H1U A;  5J3X A;  2M1R A;  5G04 B;  5FER A;  3KNV A;  2JRJ A;  3RPG B;  2LXH C;  2YUR A;  4V3K C;  2CT2 A;  5H1V A;  3ZNI A;  2M85 A;  3EB5 A;  3VK6 A;  4LKA A;  3ZYQ A;  2YRE A;  2MIQ A;  2VJE A;  2CKL B;  5LKU A;  4L7X A;  2MNZ A;  2YSM A;  4PPE A;  5D1L B;  4GNE A;  5B76 A;  4LK9 A;  3PUQ A;  4QF2 A;  2FUI A;  2KYU A;  1X4J A;  5LKT A;  5KH7 A;  4W4U A;  1WEE A;  1G25 A;  4FJC A;  1WEO A;  3KV6 A;  2CKL A;  4AYC B;  2YHN A;  2L80 A;  1WIM A;  5B75 A;  2L43 A;  2FSA A;  2F42 A;  2VNF A;  1IYM A;  2KWO A;  2M3H A;  1JOC A;  3M99 A;  5LKZ A;  3LRQ A;  4IC3 A;  2I50 A;  1MM3 A;  4CCG X;  2C2V S;  4S3O B;  4GB0 A;  2LGV A;  4AP4 A;  1WEM A;  5FB0 A;  2PUY A;  2LN0 A;  5TDW A;  3M62 A;  4QF3 A;  1HYI A;  2VPE A;  1MM2 A;  4R2Y A;  4A0C D;  2OXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...