1VYXA

Solution structure of the kshv k3 n-terminal domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
b'MEDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF K3
publication title Solution Structure of the Kaposi'S Sarcoma-Associated Herpesvirus K3 N-Terminal Domain Reveals a Novel E2-Binding C4Hc3-Type Ring Domain
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Zinc-binding protein
total genus 5
structure length 60
sequence length 60
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12906 RINGv RING-variant domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1vyxA00
4I7DA 2VNFA 2MUMA 2VJFA 2YQMA 4FK5A 1JM7B 5G0FA 2KYUA 3SOWA 2H0DB 3L1XA 5DINA 2DX8A 3DQVR 4FIPA 3ZTGA 4UI9B 2LXHC 5KH9A 4A0CD 2YSMA 4WZ2A 4YADA 2EODA 4O64A 1WEUA 3O33A 4A4CA 3O35A 1U6GB 2KFTA 3N9NA 5H9MA 4YBMA 4I7CA 2YT5A 4GNEA 1LDKC 2JRJA 2OXQC 4LKAA 2E6SA 1WESA 2MD7B 2QICA 1HYJA 4UP5A 1XWHA 1G25A 3PHDA 2C2LA 3O37A 2KREA 2LV9A 3M99A 3N9LA 5B8DA 4LK9A 2VP7A 2MD8C 5LCWB 3LQJA 3MHSA 1WEWA 3LQIA 5AIUA 2ECTA 1LDJB 2M85A 1VYXA 4L7XA 2MNZA 2FSAA 5H1VA 3ZYQA 2RSDA 5LKTA 2YQLA 2EGPA 4AUQB 2CT2A 2YYRA 2MT5A 2FUUA 4XI1A 2I50A 2JMDA 5B75A 5B78A 3HCTA 3U5PA 3RPGC 2VPBA 1DVPA 2L43A 2KWKA 3L11A 2ECVA 4QF3A 2MA6A 2UZGA 2G6QA 1MM3A 4YATA 1WEEA 2Y1MA 3NG2A 3PUQA 4WZ0A 3O7AA 1E4UA 5FB0A 2VPGA 1WEPA 5JG6A 2KGIA 4X3GA 5TDWA 2YSJA 1CHCA 2QJ0A 2VPDA 5D1KB 1WENA 5EYAF 5G05B 1HYIA 4UP0A 3MHHA 5FB1A 3DPLR 1WGMA 1WFKA 2L0BA 2L75A 3EB6A 3T7LA 1IYMA 1Z60A 2L5UA 4IC2A 2LQ6A 2VJFB 3QZVA 2KGGA 2YUCA 5D1LB 2KWJA 3O36A 1WEOA 4B86C 1JM7A 3C5KA 4R2YA 1WE9A 5FEYA 3KV5A 2IDAA 3SOUA 4AVXA 2M3HA 2HYED 4ZUXU 1VFYA 1WILA 5FERA 3HCUA 4L58A 4A49A 1FBVA 2Y43A 4FJCA 2K1JA 5AITA 1MM2A 3N9MA 4F52B 5TABA 3LQHA 1Z2QA 2KU3A 3KNVA 3PURA 2VPEA 4WZ3B 4B7YC 1WEMA 4LLBA 1WEVA 3IHPA 4N3WA 5C13A 2F42A 3LRQA 3O34A 2LDRA 2RI7A 3KV6A 2QIZA 1RMDA 3ZPVE 1WEQA 3V43A 4P5OB 1BORA 5KH7A 4PTBA 4W4UA 4GB0A 2LGGA 4AP4A 3EB5A 2K4DA 4AYCB 5B79A 2KE1A 4GNFA 3GV4A 3HTKC 5C11A 4Q6FA 4CCGX 4YAXA 4BBQA 2C2VS 2CKLB 5KH3A 4CA1A 4S3OC 2K17A 2LXPC 2ECGA 3M63A 2LGVA 3T6RA 4MVTA 2XEUA 3I2DA 1K2FA 2VJEB 2FUIA 2ECJA 5LKXA 1N87A 1T1HA 2ECIA 4QF2A 2YREA 2CSZA 3L1ZB 1X4UA 3ZVZB 2YU4A 2ZETC 2NAAA 5TBNA 4TKPB 3ASLA 2H0DA 3FL2A 1V87A 1ZBDB 4NN2A 4WA6A 2EA6A 4YBTA 5DKAA 3GL6A 4N4FA 5LKUA 2JMIA 4ZQLA 5TDRA 2PUYA 1F62A 4R7EA 1X4IA 2JMJA 1VD4A 2BAYA 2LN0A 2Y1NA 2MA5A 4YBSA 2ECNA 2KR4A 4LJNA 2E6RA 2F6JA 5D1MB 3VK6A 3C6WA 3HCSA 5LKZA 4LADB 2MIQA 4MSXA 1JOCA 4V3KC 3SOXA 2YHOA 2YHNA 2CSYA 1Z6UA 5H1TA 2G43A 3ZVYA 4C9ZA 2LRIC 2KWOA 2KWNA 2YW8A 2XB1A 4I7BA 1FP0A 2M1RA 5B76A 3KQIA 2LGKA 3N9OA 2HDPA 3RPGB 4PPEA 1X4JA 5G04B 4IC3A 3O70A 4AYCA 3SHBA 5J3XA 4A4BA 3N9QA 3ZPV1 4YABA 2MNYA 4GNDA 2M6MA 2ECWA 2CKLA 2L80A 1WIMA 4FO9A 2LGLA 5H1UA 2K16A 4R8PK 3U5MA 4GNGA 2G45A 5TRBA 5B77A 4S3OB 2VJEA 2F6NA 4V3LC 3ZNIA 2YURA 4ZDTA 3RTRB 3U5NA 2PNXA 4YC9A 4BHWA 2D8SA 5I3LA 3N9PA 2KIZA 2AN6A 3M62A 3U5OA
chains in the Genus database with same CATH superfamily
4I7DA 4QQ4A 2VNFA 3H7HA 2MUMA 2VJFA 2YQMA 4FK5A 1JM7B 5G0FA 2KYUA 3SOWA 2H0DB 3L1XA 5DINA 2DX8A 3DQVR 4FIPA 3ZTGA 4UI9B 2LXHC 5KH9A 4A0CD 2YSMA 4WZ2A 4YADA 2EODA 4O64A 1WEUA 3O33A 4A4CA 5K3QA 3O35A 1U6GB 2KFTA 3N9NA 3FJUB 5H9MA 2KKXA 4YBMA 4I7CA 2YT5A 4GNEA 3KDEC 3JUEA 1LDKC 2JRJA 2OXQC 4LKAA 2E6SA 1WESA 2MD7B 2QICA 1HYJA 4UP5A 1XWHA 1G25A 3PHDA 2FFWA 2C2LA 3O37A 2CRWA 3FM8C 2KREA 2LV9A 3M99A 3N9LA 5B8DA 4LK9A 2VP7A 3DWDA 2MD8C 2JUNA 2EXUA 5LCWB 3SUBA 3LQJA 3MHSA 1WEWA 3LQIA 5AIUA 2ECTA 1LDJB 2M85A 1VYXA 4L7XA 2MNZA 2FSAA 2IQJA 3E2DA 5H1VA 3ZYQA 2RSDA 2CRRA 5LKTA 2YQLA 2EGPA 4AUQB 2CT2A 2YYRA 2MT5A 2FUUA 4XI1A 2I50A 2JMDA 5B75A 3LVQE 5B78A 3HCTA 3U5PA 3RPGC 2VPBA 1DVPA 2L43A 2KWKA 3L11A 2ECVA 3Q1DA 4QF3A 2MA6A 2UZGA 2XOCA 2G6QA 1MM3A 4YATA 1WEEA 2Y1MA 3NG2A 3PUQA 4WZ0A 2XOYA 4Z0RA 3O7AA 1E4UA 5FB0A 2VPGA 1WEPA 5JG6A 2KGIA 4X3GA 5TDWA 2YSJA 5SVYA 1CHCA 2P57A 3O47A 2QJ0A 2VPDA 5D1KB 1WENA 5EYAF 2RR4A 5G05B 4OGEA 1HYIA 4UP0A 3MHHA 5FB1A 3DPLR 1WGMA 1WFKA 2L0BA 2L75A 3EB6A 3T7LA 1IYMA 1Z60A 2CSVA 2L5UA 2OWAA 4IC2A 2JM3A 2LQ6A 2VJFB 3QZVA 2KGGA 2YUCA 5D1LB 2KWJA 3O36A 1WEOA 4B86C 1JM7A 3C5KA 4R2YA 1MBMA 1WE9A 3FANA 5FEYA 3KV5A 2IDAA 3SOUA 4AVXA 2M3HA 2HYED 4ZUXU 1VFYA 1WILA 5FERA 3HCUA 4L58A 4A49A 2M13A 1FBVA 2Y43A 4FJCA 2K1JA 5AITA 2CONA 1MM2A 3N9MA 4F52B 5TABA 3LQHA 1Z2QA 2KU3A 3KNVA 3PURA 2VPEA 4WZ3B 4B7YC 3MDBC 1WEMA 4LLBA 1WEVA 3IHPA 4N3WA 4Z0OA 3FAOA 3LVRE 5C13A 2F42A 3LRQA 3O34A 2LDRA 4F1PA 2RI7A 3KV6A 2QIZA 1RMDA 3ZPVE 1WEQA 4H9DA 3V43A 4P5OB 1BORA 5KH7A 4PTBA 4W4UA 4GB0A 2LGGA 4AP4A 3EB5A 2K4DA 4AYCB 5B79A 2KE1A 4GNFA 3GV4A 3HTKC 5SVXA 5C11A 4O62A 4Q6FA 4CCGX 4YAXA 4BBQA 2C2VS 2CKLB 5KH3A 3LJUX 5SVIA 4CA1A 4S3OC 2XP0A 2K17A 2LXPC 2ECGA 3M63A 2LGVA 3T6RA 4MVTA 2XEUA 3I2DA 1K2FA 2VJEB 2FUIA 2LAUA 2ECJA 5LKXA 1N87A 3PLWA 1T1HA 2ECIA 4QF2A 2YREA 2CSZA 2DJAA 3L1ZB 1X4UA 3ZVZB 2YU4A 3M7KA 3FEHA 2ZETC 2NAAA 5TBNA 4TKPB 2D8UA 3ASLA 2H0DA 3FL2A 2MKEA 2E61A 1V87A 1ZBDB 4NN2A 4WA6A 2EA6A 2L7PA 4YBTA 5DKAA 3GL6A 4N4FA 5LKUA 2JMIA 4ZQLA 5TDRA 2PUYA 1F62A 4R7EA 1X4IA 2JMJA 1VD4A 2BAYA 2LN0A 2Y1NA 2MA5A 4YBSA 2ECNA 2KR4A 4LJNA 2E6RA 2F6JA 5D1MB 3VK6A 3C6WA 3HCSA 5LKZA 4LADB 2MIQA 4MSXA 1DCQA 1JOCA 4V3KC 3SOXA 2YHOA 3LDYA 2YHNA 2CSYA 1Z6UA 5H1TA 2KKYA 2G43A 2XOZA 3ZVYA 4C9ZA 2LRIC 2KWOA 2KWNA 2B0OE 2YW8A 2XB1A 4I7BA 1FP0A 2M1RA 5B76A 3KQIA 2LGKA 3N9OA 2EGMA 2HDPA 3RPGB 4PPEA 1X4JA 5G04B 4IC3A 3O70A 4AYCA 3SHBA 5J3XA 4A4BA 3N9QA 3ZPV1 4YABA 2MNYA 4GNDA 2M6MA 2ECWA 2CKLA 2L80A 4OGCA 1WIMA 4FO9A 2LGLA 5SVIB 5H1UA 2K16A 4R8PK 3U5MA 4GNGA 2YVRA 2G45A 5TRBA 5B77A 2FD4A 2VJEA 2F6NA 4S3OB 4V3LC 3ZNIA 2YURA 4ZDTA 2DSMA 3T9KA 3RTRB 3U5NA 2PNXA 4YC9A 4BHWA 2D8SA 5I3LA 3DDTA 3N9PA 2KIZA 2AN6A 3M62A 3U5OA
chains in the Genus database with same CATH topology
4I7DA 2VNFA 2MUMA 2VJFA 2YQMA 4FK5A 1JM7B 5G0FA 2KYUA 3SOWA 2H0DB 3L1XA 5DINA 2DX8A 3DQVR 4FIPA 3ZTGA 4UI9B 2LXHC 5KH9A 4A0CD 2YSMA 4WZ2A 4YADA 2EODA 4O64A 1WEUA 3O33A 4A4CA 3O35A 1U6GB 2KFTA 3N9NA 5H9MA 4YBMA 4I7CA 2YT5A 4GNEA 1LDKC 2JRJA 2OXQC 4LKAA 2E6SA 1WESA 2MD7B 2QICA 1HYJA 4UP5A 1XWHA 1G25A 3PHDA 2C2LA 3O37A 2KREA 2LV9A 3M99A 3N9LA 5B8DA 4LK9A 2VP7A 2MD8C 5LCWB 3LQJA 3MHSA 1WEWA 3LQIA 5AIUA 2ECTA 1LDJB 2M85A 1VYXA 4L7XA 2MNZA 2FSAA 5H1VA 3ZYQA 2RSDA 5LKTA 2YQLA 2EGPA 4AUQB 2CT2A 2YYRA 2MT5A 2FUUA 4XI1A 2I50A 2JMDA 5B75A 5B78A 3HCTA 3U5PA 3RPGC 2VPBA 1DVPA 2L43A 2KWKA 3L11A 2ECVA 4QF3A 2MA6A 2UZGA 2G6QA 1MM3A 4YATA 1WEEA 2Y1MA 3NG2A 3PUQA 4WZ0A 3O7AA 1E4UA 5FB0A 2VPGA 1WEPA 5JG6A 2KGIA 4X3GA 5TDWA 2YSJA 1CHCA 2QJ0A 2VPDA 5D1KB 1WENA 5EYAF 5G05B 1HYIA 4UP0A 3MHHA 5FB1A 3DPLR 1WGMA 1WFKA 2L0BA 2L75A 3EB6A 3T7LA 1IYMA 1Z60A 2L5UA 4IC2A 2LQ6A 2VJFB 3QZVA 2KGGA 2YUCA 5D1LB 2KWJA 3O36A 1WEOA 4B86C 1JM7A 3C5KA 4R2YA 1WE9A 5FEYA 3KV5A 2IDAA 3SOUA 4AVXA 2M3HA 2HYED 4ZUXU 1VFYA 1WILA 5FERA 3HCUA 4L58A 4A49A 1FBVA 2Y43A 4FJCA 2K1JA 5AITA 1MM2A 3N9MA 4F52B 5TABA 3LQHA 1Z2QA 2KU3A 3KNVA 3PURA 2VPEA 4WZ3B 4B7YC 1WEMA 4LLBA 1WEVA 3IHPA 4N3WA 5C13A 2F42A 3LRQA 3O34A 2LDRA 2RI7A 3KV6A 2QIZA 1RMDA 3ZPVE 1WEQA 3V43A 4P5OB 1BORA 5KH7A 4PTBA 4W4UA 4GB0A 2LGGA 4AP4A 3EB5A 2K4DA 4AYCB 5B79A 2KE1A 4GNFA 3GV4A 3HTKC 5C11A 4Q6FA 4CCGX 4YAXA 4BBQA 2C2VS 2CKLB 5KH3A 4CA1A 4S3OC 2K17A 2LXPC 2ECGA 3M63A 2LGVA 3T6RA 4MVTA 2XEUA 3I2DA 1K2FA 2VJEB 2FUIA 2ECJA 5LKXA 1N87A 1T1HA 2ECIA 4QF2A 2YREA 2CSZA 3L1ZB 1X4UA 3ZVZB 2YU4A 2ZETC 2NAAA 5TBNA 4TKPB 3ASLA 2H0DA 3FL2A 1V87A 1ZBDB 4NN2A 4WA6A 2EA6A 4YBTA 5DKAA 3GL6A 4N4FA 5LKUA 2JMIA 4ZQLA 5TDRA 2PUYA 1F62A 4R7EA 1X4IA 2JMJA 1VD4A 2BAYA 2LN0A 2Y1NA 2MA5A 4YBSA 2ECNA 2KR4A 4LJNA 2E6RA 2F6JA 5D1MB 3VK6A 3C6WA 3HCSA 5LKZA 4LADB 2MIQA 4MSXA 1JOCA 4V3KC 3SOXA 2YHOA 2YHNA 2CSYA 1Z6UA 5H1TA 2G43A 3ZVYA 4C9ZA 2LRIC 2KWOA 2KWNA 2YW8A 2XB1A 4I7BA 1FP0A 2M1RA 5B76A 3KQIA 2LGKA 3N9OA 2HDPA 3RPGB 4PPEA 1X4JA 5G04B 4IC3A 3O70A 4AYCA 3SHBA 5J3XA 4A4BA 3N9QA 3ZPV1 4YABA 2MNYA 4GNDA 2M6MA 2ECWA 2CKLA 2L80A 1WIMA 4FO9A 2LGLA 5H1UA 2K16A 4R8PK 3U5MA 4GNGA 2G45A 5TRBA 5B77A 4S3OB 2VJEA 2F6NA 4V3LC 3ZNIA 2YURA 4ZDTA 3RTRB 3U5NA 2PNXA 4YC9A 4BHWA 2D8SA 5I3LA 3N9PA 2KIZA 2AN6A 3M62A 3U5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7D A;  2VNF A;  2MUM A;  2VJF A;  2YQM A;  4FK5 A;  1JM7 B;  5G0F A;  2KYU A;  3SOW A;  2H0D B;  3L1X A;  5DIN A;  2DX8 A;  3DQV R;  4FIP A;  3ZTG A;  4UI9 B;  2LXH C;  5KH9 A;  4A0C D;  2YSM A;  4WZ2 A;  4YAD A;  2EOD A;  4O64 A;  1WEU A;  3O33 A;  4A4C A;  3O35 A;  1U6G B;  2KFT A;  3N9N A;  5H9M A;  4YBM A;  4I7C A;  2YT5 A;  4GNE A;  1LDK C;  2JRJ A;  2OXQ C;  4LKA A;  2E6S A;  1WES A;  2MD7 B;  2QIC A;  1HYJ A;  4UP5 A;  1XWH A;  1G25 A;  3PHD A;  2C2L A;  3O37 A;  2KRE A;  2LV9 A;  3M99 A;  3N9L A;  5B8D A;  4LK9 A;  2VP7 A;  2MD8 C;  5LCW B;  3LQJ A;  3MHS A;  1WEW A;  3LQI A;  5AIU A;  2ECT A;  1LDJ B;  2M85 A;  1VYX A;  4L7X A;  2MNZ A;  2FSA A;  5H1V A;  3ZYQ A;  2RSD A;  5LKT A;  2YQL A;  2EGP A;  4AUQ B;  2CT2 A;  2YYR A;  2MT5 A;  2FUU A;  4XI1 A;  2I50 A;  2JMD A;  5B75 A;  5B78 A;  3HCT A;  3U5P A;  3RPG C;  2VPB A;  1DVP A;  2L43 A;  2KWK A;  3L11 A;  2ECV A;  4QF3 A;  2MA6 A;  2UZG A;  2G6Q A;  1MM3 A;  4YAT A;  1WEE A;  2Y1M A;  3NG2 A;  3PUQ A;  4WZ0 A;  3O7A A;  1E4U A;  5FB0 A;  2VPG A;  1WEP A;  5JG6 A;  2KGI A;  4X3G A;  5TDW A;  2YSJ A;  1CHC A;  2QJ0 A;  2VPD A;  5D1K B;  1WEN A;  5EYA F;  5G05 B;  1HYI A;  4UP0 A;  3MHH A;  5FB1 A;  3DPL R;  1WGM A;  1WFK A;  2L0B A;  2L75 A;  3EB6 A;  3T7L A;  1IYM A;  1Z60 A;  2L5U A;  4IC2 A;  2LQ6 A;  2VJF B;  3QZV A;  2KGG A;  2YUC A;  5D1L B;  2KWJ A;  3O36 A;  1WEO A;  4B86 C;  1JM7 A;  3C5K A;  4R2Y A;  1WE9 A;  5FEY A;  3KV5 A;  2IDA A;  3SOU A;  4AVX A;  2M3H A;  2HYE D;  4ZUX U;  1VFY A;  1WIL A;  5FER A;  3HCU A;  4L58 A;  4A49 A;  1FBV A;  2Y43 A;  4FJC A;  2K1J A;  5AIT A;  1MM2 A;  3N9M A;  4F52 B;  5TAB A;  3LQH A;  1Z2Q A;  2KU3 A;  3KNV A;  3PUR A;  2VPE A;  4WZ3 B;  4B7Y C;  1WEM A;  4LLB A;  1WEV A;  3IHP A;  4N3W A;  5C13 A;  2F42 A;  3LRQ A;  3O34 A;  2LDR A;  2RI7 A;  3KV6 A;  2QIZ A;  1RMD A;  3ZPV E;  1WEQ A;  3V43 A;  4P5O B;  1BOR A;  5KH7 A;  4PTB A;  4W4U A;  4GB0 A;  2LGG A;  4AP4 A;  3EB5 A;  2K4D A;  4AYC B;  5B79 A;  2KE1 A;  4GNF A;  3GV4 A;  3HTK C;  5C11 A;  4Q6F A;  4CCG X;  4YAX A;  4BBQ A;  2C2V S;  2CKL B;  5KH3 A;  4CA1 A;  4S3O C;  2K17 A;  2LXP C;  2ECG A;  3M63 A;  2LGV A;  3T6R A;  4MVT A;  2XEU A;  3I2D A;  1K2F A;  2VJE B;  2FUI A;  2ECJ A;  5LKX A;  1N87 A;  1T1H A;  2ECI A;  4QF2 A;  2YRE A;  2CSZ A;  3L1Z B;  1X4U A;  3ZVZ B;  2YU4 A;  2ZET C;  2NAA A;  5TBN A;  4TKP B;  3ASL A;  2H0D A;  3FL2 A;  1V87 A;  1ZBD B;  4NN2 A;  4WA6 A;  2EA6 A;  4YBT A;  5DKA A;  3GL6 A;  4N4F A;  5LKU A;  2JMI A;  4ZQL A;  5TDR A;  2PUY A;  1F62 A;  4R7E A;  1X4I A;  2JMJ A;  1VD4 A;  2BAY A;  2LN0 A;  2Y1N A;  2MA5 A;  4YBS A;  2ECN A;  2KR4 A;  4LJN A;  2E6R A;  2F6J A;  5D1M B;  3VK6 A;  3C6W A;  3HCS A;  5LKZ A;  4LAD B;  2MIQ A;  4MSX A;  1JOC A;  4V3K C;  3SOX A;  2YHO A;  2YHN A;  2CSY A;  1Z6U A;  5H1T A;  2G43 A;  3ZVY A;  4C9Z A;  2LRI C;  2KWO A;  2KWN A;  2YW8 A;  2XB1 A;  4I7B A;  1FP0 A;  2M1R A;  5B76 A;  3KQI A;  2LGK A;  3N9O A;  2HDP A;  3RPG B;  4PPE A;  1X4J A;  5G04 B;  4IC3 A;  3O70 A;  4AYC A;  3SHB A;  5J3X A;  4A4B A;  3N9Q A;  3ZPV 1;  4YAB A;  2MNY A;  4GND A;  2M6M A;  2ECW A;  2CKL A;  2L80 A;  1WIM A;  4FO9 A;  2LGL A;  5H1U A;  2K16 A;  4R8P K;  3U5M A;  4GNG A;  2G45 A;  5TRB A;  5B77 A;  4S3O B;  2VJE A;  2F6N A;  4V3L C;  3ZNI A;  2YUR A;  4ZDT A;  3RTR B;  3U5N A;  2PNX A;  4YC9 A;  4BHW A;  2D8S A;  5I3L A;  3N9P A;  2KIZ A;  2AN6 A;  3M62 A;  3U5O A; 
#chains in the Genus database with same CATH topology
 4I7D A;  4QQ4 A;  2VNF A;  3H7H A;  2MUM A;  2VJF A;  2YQM A;  4FK5 A;  1JM7 B;  5G0F A;  2KYU A;  3SOW A;  2H0D B;  3L1X A;  5DIN A;  2DX8 A;  3DQV R;  4FIP A;  3ZTG A;  4UI9 B;  2LXH C;  5KH9 A;  4A0C D;  2YSM A;  4WZ2 A;  4YAD A;  2EOD A;  4O64 A;  1WEU A;  3O33 A;  4A4C A;  5K3Q A;  3O35 A;  1U6G B;  2KFT A;  3N9N A;  3FJU B;  5H9M A;  2KKX A;  4YBM A;  4I7C A;  2YT5 A;  4GNE A;  3KDE C;  3JUE A;  1LDK C;  2JRJ A;  2OXQ C;  4LKA A;  2E6S A;  1WES A;  2MD7 B;  2QIC A;  1HYJ A;  4UP5 A;  1XWH A;  1G25 A;  3PHD A;  2FFW A;  2C2L A;  3O37 A;  2CRW A;  3FM8 C;  2KRE A;  2LV9 A;  3M99 A;  3N9L A;  5B8D A;  4LK9 A;  2VP7 A;  3DWD A;  2MD8 C;  2JUN A;  2EXU A;  5LCW B;  3SUB A;  3LQJ A;  3MHS A;  1WEW A;  3LQI A;  5AIU A;  2ECT A;  1LDJ B;  2M85 A;  1VYX A;  4L7X A;  2MNZ A;  2FSA A;  2IQJ A;  3E2D A;  5H1V A;  3ZYQ A;  2RSD A;  2CRR A;  5LKT A;  2YQL A;  2EGP A;  4AUQ B;  2CT2 A;  2YYR A;  2MT5 A;  2FUU A;  4XI1 A;  2I50 A;  2JMD A;  5B75 A;  3LVQ E;  5B78 A;  3HCT A;  3U5P A;  3RPG C;  2VPB A;  1DVP A;  2L43 A;  2KWK A;  3L11 A;  2ECV A;  3Q1D A;  4QF3 A;  2MA6 A;  2UZG A;  2XOC A;  2G6Q A;  1MM3 A;  4YAT A;  1WEE A;  2Y1M A;  3NG2 A;  3PUQ A;  4WZ0 A;  2XOY A;  4Z0R A;  3O7A A;  1E4U A;  5FB0 A;  2VPG A;  1WEP A;  5JG6 A;  2KGI A;  4X3G A;  5TDW A;  2YSJ A;  5SVY A;  1CHC A;  2P57 A;  3O47 A;  2QJ0 A;  2VPD A;  5D1K B;  1WEN A;  5EYA F;  2RR4 A;  5G05 B;  4OGE A;  1HYI A;  4UP0 A;  3MHH A;  5FB1 A;  3DPL R;  1WGM A;  1WFK A;  2L0B A;  2L75 A;  3EB6 A;  3T7L A;  1IYM A;  1Z60 A;  2CSV A;  2L5U A;  2OWA A;  4IC2 A;  2JM3 A;  2LQ6 A;  2VJF B;  3QZV A;  2KGG A;  2YUC A;  5D1L B;  2KWJ A;  3O36 A;  1WEO A;  4B86 C;  1JM7 A;  3C5K A;  4R2Y A;  1MBM A;  1WE9 A;  3FAN A;  5FEY A;  3KV5 A;  2IDA A;  3SOU A;  4AVX A;  2M3H A;  2HYE D;  4ZUX U;  1VFY A;  1WIL A;  5FER A;  3HCU A;  4L58 A;  4A49 A;  2M13 A;  1FBV A;  2Y43 A;  4FJC A;  2K1J A;  5AIT A;  2CON A;  1MM2 A;  3N9M A;  4F52 B;  5TAB A;  3LQH A;  1Z2Q A;  2KU3 A;  3KNV A;  3PUR A;  2VPE A;  4WZ3 B;  4B7Y C;  3MDB C;  1WEM A;  4LLB A;  1WEV A;  3IHP A;  4N3W A;  4Z0O A;  3FAO A;  3LVR E;  5C13 A;  2F42 A;  3LRQ A;  3O34 A;  2LDR A;  4F1P A;  2RI7 A;  3KV6 A;  2QIZ A;  1RMD A;  3ZPV E;  1WEQ A;  4H9D A;  3V43 A;  4P5O B;  1BOR A;  5KH7 A;  4PTB A;  4W4U A;  4GB0 A;  2LGG A;  4AP4 A;  3EB5 A;  2K4D A;  4AYC B;  5B79 A;  2KE1 A;  4GNF A;  3GV4 A;  3HTK C;  5SVX A;  5C11 A;  4O62 A;  4Q6F A;  4CCG X;  4YAX A;  4BBQ A;  2C2V S;  2CKL B;  5KH3 A;  3LJU X;  5SVI A;  4CA1 A;  4S3O C;  2XP0 A;  2K17 A;  2LXP C;  2ECG A;  3M63 A;  2LGV A;  3T6R A;  4MVT A;  2XEU A;  3I2D A;  1K2F A;  2VJE B;  2FUI A;  2LAU A;  2ECJ A;  5LKX A;  1N87 A;  3PLW A;  1T1H A;  2ECI A;  4QF2 A;  2YRE A;  2CSZ A;  2DJA A;  3L1Z B;  1X4U A;  3ZVZ B;  2YU4 A;  3M7K A;  3FEH A;  2ZET C;  2NAA A;  5TBN A;  4TKP B;  2D8U A;  3ASL A;  2H0D A;  3FL2 A;  2MKE A;  2E61 A;  1V87 A;  1ZBD B;  4NN2 A;  4WA6 A;  2EA6 A;  2L7P A;  4YBT A;  5DKA A;  3GL6 A;  4N4F A;  5LKU A;  2JMI A;  4ZQL A;  5TDR A;  2PUY A;  1F62 A;  4R7E A;  1X4I A;  2JMJ A;  1VD4 A;  2BAY A;  2LN0 A;  2Y1N A;  2MA5 A;  4YBS A;  2ECN A;  2KR4 A;  4LJN A;  2E6R A;  2F6J A;  5D1M B;  3VK6 A;  3C6W A;  3HCS A;  5LKZ A;  4LAD B;  2MIQ A;  4MSX A;  1DCQ A;  1JOC A;  4V3K C;  3SOX A;  2YHO A;  3LDY A;  2YHN A;  2CSY A;  1Z6U A;  5H1T A;  2KKY A;  2G43 A;  2XOZ A;  3ZVY A;  4C9Z A;  2LRI C;  2KWO A;  2KWN A;  2B0O E;  2YW8 A;  2XB1 A;  4I7B A;  1FP0 A;  2M1R A;  5B76 A;  3KQI A;  2LGK A;  3N9O A;  2EGM A;  2HDP A;  3RPG B;  4PPE A;  1X4J A;  5G04 B;  4IC3 A;  3O70 A;  4AYC A;  3SHB A;  5J3X A;  4A4B A;  3N9Q A;  3ZPV 1;  4YAB A;  2MNY A;  4GND A;  2M6M A;  2ECW A;  2CKL A;  2L80 A;  4OGC A;  1WIM A;  4FO9 A;  2LGL A;  5SVI B;  5H1U A;  2K16 A;  4R8P K;  3U5M A;  4GNG A;  2YVR A;  2G45 A;  5TRB A;  5B77 A;  2FD4 A;  2VJE A;  2F6N A;  4S3O B;  4V3L C;  3ZNI A;  2YUR A;  4ZDT A;  2DSM A;  3T9K A;  3RTR B;  3U5N A;  2PNX A;  4YC9 A;  4BHW A;  2D8S A;  5I3L A;  3DDT A;  3N9P A;  2KIZ A;  2AN6 A;  3M62 A;  3U5O A; 
#chains in the Genus database with same CATH homology
 4I7D A;  2VNF A;  2MUM A;  2VJF A;  2YQM A;  4FK5 A;  1JM7 B;  5G0F A;  2KYU A;  3SOW A;  2H0D B;  3L1X A;  5DIN A;  2DX8 A;  3DQV R;  4FIP A;  3ZTG A;  4UI9 B;  2LXH C;  5KH9 A;  4A0C D;  2YSM A;  4WZ2 A;  4YAD A;  2EOD A;  4O64 A;  1WEU A;  3O33 A;  4A4C A;  3O35 A;  1U6G B;  2KFT A;  3N9N A;  5H9M A;  4YBM A;  4I7C A;  2YT5 A;  4GNE A;  1LDK C;  2JRJ A;  2OXQ C;  4LKA A;  2E6S A;  1WES A;  2MD7 B;  2QIC A;  1HYJ A;  4UP5 A;  1XWH A;  1G25 A;  3PHD A;  2C2L A;  3O37 A;  2KRE A;  2LV9 A;  3M99 A;  3N9L A;  5B8D A;  4LK9 A;  2VP7 A;  2MD8 C;  5LCW B;  3LQJ A;  3MHS A;  1WEW A;  3LQI A;  5AIU A;  2ECT A;  1LDJ B;  2M85 A;  1VYX A;  4L7X A;  2MNZ A;  2FSA A;  5H1V A;  3ZYQ A;  2RSD A;  5LKT A;  2YQL A;  2EGP A;  4AUQ B;  2CT2 A;  2YYR A;  2MT5 A;  2FUU A;  4XI1 A;  2I50 A;  2JMD A;  5B75 A;  5B78 A;  3HCT A;  3U5P A;  3RPG C;  2VPB A;  1DVP A;  2L43 A;  2KWK A;  3L11 A;  2ECV A;  4QF3 A;  2MA6 A;  2UZG A;  2G6Q A;  1MM3 A;  4YAT A;  1WEE A;  2Y1M A;  3NG2 A;  3PUQ A;  4WZ0 A;  3O7A A;  1E4U A;  5FB0 A;  2VPG A;  1WEP A;  5JG6 A;  2KGI A;  4X3G A;  5TDW A;  2YSJ A;  1CHC A;  2QJ0 A;  2VPD A;  5D1K B;  1WEN A;  5EYA F;  5G05 B;  1HYI A;  4UP0 A;  3MHH A;  5FB1 A;  3DPL R;  1WGM A;  1WFK A;  2L0B A;  2L75 A;  3EB6 A;  3T7L A;  1IYM A;  1Z60 A;  2L5U A;  4IC2 A;  2LQ6 A;  2VJF B;  3QZV A;  2KGG A;  2YUC A;  5D1L B;  2KWJ A;  3O36 A;  1WEO A;  4B86 C;  1JM7 A;  3C5K A;  4R2Y A;  1WE9 A;  5FEY A;  3KV5 A;  2IDA A;  3SOU A;  4AVX A;  2M3H A;  2HYE D;  4ZUX U;  1VFY A;  1WIL A;  5FER A;  3HCU A;  4L58 A;  4A49 A;  1FBV A;  2Y43 A;  4FJC A;  2K1J A;  5AIT A;  1MM2 A;  3N9M A;  4F52 B;  5TAB A;  3LQH A;  1Z2Q A;  2KU3 A;  3KNV A;  3PUR A;  2VPE A;  4WZ3 B;  4B7Y C;  1WEM A;  4LLB A;  1WEV A;  3IHP A;  4N3W A;  5C13 A;  2F42 A;  3LRQ A;  3O34 A;  2LDR A;  2RI7 A;  3KV6 A;  2QIZ A;  1RMD A;  3ZPV E;  1WEQ A;  3V43 A;  4P5O B;  1BOR A;  5KH7 A;  4PTB A;  4W4U A;  4GB0 A;  2LGG A;  4AP4 A;  3EB5 A;  2K4D A;  4AYC B;  5B79 A;  2KE1 A;  4GNF A;  3GV4 A;  3HTK C;  5C11 A;  4Q6F A;  4CCG X;  4YAX A;  4BBQ A;  2C2V S;  2CKL B;  5KH3 A;  4CA1 A;  4S3O C;  2K17 A;  2LXP C;  2ECG A;  3M63 A;  2LGV A;  3T6R A;  4MVT A;  2XEU A;  3I2D A;  1K2F A;  2VJE B;  2FUI A;  2ECJ A;  5LKX A;  1N87 A;  1T1H A;  2ECI A;  4QF2 A;  2YRE A;  2CSZ A;  3L1Z B;  1X4U A;  3ZVZ B;  2YU4 A;  2ZET C;  2NAA A;  5TBN A;  4TKP B;  3ASL A;  2H0D A;  3FL2 A;  1V87 A;  1ZBD B;  4NN2 A;  4WA6 A;  2EA6 A;  4YBT A;  5DKA A;  3GL6 A;  4N4F A;  5LKU A;  2JMI A;  4ZQL A;  5TDR A;  2PUY A;  1F62 A;  4R7E A;  1X4I A;  2JMJ A;  1VD4 A;  2BAY A;  2LN0 A;  2Y1N A;  2MA5 A;  4YBS A;  2ECN A;  2KR4 A;  4LJN A;  2E6R A;  2F6J A;  5D1M B;  3VK6 A;  3C6W A;  3HCS A;  5LKZ A;  4LAD B;  2MIQ A;  4MSX A;  1JOC A;  4V3K C;  3SOX A;  2YHO A;  2YHN A;  2CSY A;  1Z6U A;  5H1T A;  2G43 A;  3ZVY A;  4C9Z A;  2LRI C;  2KWO A;  2KWN A;  2YW8 A;  2XB1 A;  4I7B A;  1FP0 A;  2M1R A;  5B76 A;  3KQI A;  2LGK A;  3N9O A;  2HDP A;  3RPG B;  4PPE A;  1X4J A;  5G04 B;  4IC3 A;  3O70 A;  4AYC A;  3SHB A;  5J3X A;  4A4B A;  3N9Q A;  3ZPV 1;  4YAB A;  2MNY A;  4GND A;  2M6M A;  2ECW A;  2CKL A;  2L80 A;  1WIM A;  4FO9 A;  2LGL A;  5H1U A;  2K16 A;  4R8P K;  3U5M A;  4GNG A;  2G45 A;  5TRB A;  5B77 A;  4S3O B;  2VJE A;  2F6N A;  4V3L C;  3ZNI A;  2YUR A;  4ZDT A;  3RTR B;  3U5N A;  2PNX A;  4YC9 A;  4BHW A;  2D8S A;  5I3L A;  3N9P A;  2KIZ A;  2AN6 A;  3M62 A;  3U5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...