2MA6A

Solution nmr structure of the ring finger domain from the kip1 ubiquitination-promoting e3 complex protein 1 (kpc1/rnf123) from homo sapiens, northeast structural genomics consortium (nesg) target hr8700a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
SHMPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF123
publication title Solution NMR Structure of the RING finger domain from the Kip1 ubiquitination-promoting E3 complex protein 1 (KPC1/RNF123) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8700A
rcsb
source organism Homo sapiens
total genus 10
structure length 61
sequence length 61
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ma6A00
3PUQA 4A0CD 2KGIA 2LGGA 2YT5A 2F6JA 2LGLA 3M99A 1WEPA 2EA6A 3MHSA 1Z2QA 4A49A 1VYXA 2OXQC 5B76A 1LDJB 2RI7A 1MM2A 2ECJA 2FUIA 2VPEA 5B77A 1HYIA 3V43A 2KWOA 4YBMA 3EB5A 2ECTA 3N9OA 1ZBDB 1RMDA 2KGGA 4WZ0A 3N9QA 2KREA 5D1MB 2L80A 3LQJA 4X3GA 2EODA 1X4JA 5KH9A 2UZGA 2BAYA 4YAXA 2PNXA 4LADB 4Q6FA 2M3HA 1WENA 3T7LA 1VFYA 5FB1A 3QZVA 3RPGC 3ZVZB 5LCWB 2ECWA 4YATA 4WZ3B 1LDKC 3L11A 2PUYA 3N9PA 3ZPV1 5KH3A 2YSMA 2D8SA 2ECIA 3N9NA 3EB6A 2XB1A 3O35A 2JRJA 4IC3A 1HYJA 3KV5A 3GL6A 2K4DA 1JM7A 4AYCB 2VJFB 2DX8A 2YUCA 4V3LC 2LN0A 3O33A 5B79A 2KWKA 2QICA 3ZVYA 2F6NA 2YQLA 1T1HA 2AN6A 2Y1NA 2MIQA 1WEOA 3LQIA 4XI1A 2FUUA 2KIZA 2H0DA 5C13A 1WESA 2VNFA 3ZNIA 2LQ6A 2G6QA 4R7EA 2LXPC 2Y43A 4BBQA 4GB0A 3I2DA 4MSXA 3U5NA 3U5PA 2VPGA 3ASLA 2YQMA 5G0FA 4BHWA 2IDAA 3T6RA 5D1LB 4YC9A 2CKLA 2ZETC 2K1JA 3N9MA 3LQHA 4LKAA 2YU4A 5G04B 1U6GB 2JMIA 5H1TA 5B8DA 3HCTA 2L0BA 1V87A 2VJEA 5DINA 4TKPB 4PTBA 4FJCA 3L1XA 2I50A 3SOWA 1JM7B 2YURA 4F52B 2VP7A 1WEMA 2LRIC 4NN2A 2MA6A 3HTKC 3M63A 4FK5A 1CHCA 2YHNA 4B86C 5H1VA 4V3KC 2K17A 2H0DB 1WEQA 2E6RA 1WE9A 3SOXA 3DQVR 4I7DA 4YBSA 1WEVA 4ZQLA 5TBNA 1IYMA 2M6MA 2HDPA 3RTRB 5DKAA 3SOUA 3KV6A 1N87A 4AUQB 2YREA 2KFTA 2MNYA 3N9LA 3VK6A 3LRQA 2CT2A 4CA1A 2CKLB 2MA5A 2VPBA 4LK9A 1X4UA 4S3OB 5H9MA 5LKXA 2YHOA 5LKUA 3M62A 2YSJA 1F62A 4GNGA 3O34A 3O70A 2KWNA 5LKTA 4N4FA 4YADA 4ZDTA 1JOCA 2HYED 4GNDA 4I7CA 4N3WA 3KNVA 4MVTA 1WEUA 2L5UA 1WIMA 4YABA 2KE1A 4UP5A 1WGMA 5EYAF 2KYUA 3O7AA 5G05B 1VD4A 3IHPA 4A4CA 4UP0A 3O36A 2YYRA 3U5MA 1G25A 4W4UA 4A4BA 5B75A 2F42A 3PHDA 1BORA 5TDRA 2C2LA 4O64A 3HCSA 2XEUA 4C9ZA 2C2VS 3MHHA 2G45A 2QIZA 3ZYQA 5FB0A 2M1RA 3SHBA 4R8PK 2LXHC 3NG2A 2MD7B 2VPDA 2NAAA 4LLBA 4R2YA 4LJNA 4AP4A 4YBTA 3GV4A 5KH7A 3RPGB 4QF2A 3FL2A 2LGVA 3ZTGA 2QJ0A 2CSYA 4FO9A 5TABA 4AYCA 1Z6UA 2VJFA 2KR4A 2LV9A 5B78A 2L75A 2RSDA 2L43A 3U5OA 3C6WA 2MT5A 1E4UA 4I7BA 2E6SA 5FERA 5C11A 2K16A 3KQIA 1X4IA 2JMJA 1DVPA 2YW8A 1WILA 1FBVA 1XWHA 1WFKA 2LDRA 2JMDA 5TDWA 5FEYA 2MUMA 1MM3A 4WA6A 2Y1MA 2CSZA 4IC2A 5AIUA 2FSAA 5H1UA 2M85A 2LGKA 2KU3A 4L58A 5TRBA 1FP0A 2ECNA 2VJEB 3DPLR 2EGPA 4FIPA 3HCUA 4P5OB 5J3XA 3ZPVE 4L7XA 4UI9B 4GNFA 5I3LA 4B7YC 3C5KA 3PURA 1WEWA 2G43A 2ECVA 2KWJA 3O37A 2MD8C 5D1KB 4ZUXU 1Z60A 4PPEA 4CCGX 5LKZA 5AITA 4S3OC 4AVXA 4QF3A 5JG6A 2MNZA 3L1ZB 2ECGA 1WEEA 4WZ2A 1K2FA 4GNEA
chains in the Genus database with same CATH superfamily
3PUQA 4A0CD 2KGIA 2LGGA 2YT5A 3KDEC 2F6JA 2LGLA 3M99A 1WEPA 2EA6A 3MHSA 1Z2QA 4QQ4A 4A49A 1VYXA 2OXQC 5B76A 1LDJB 2RI7A 2DJAA 1MM2A 2ECJA 2FUIA 2VPEA 5B77A 1HYIA 3V43A 2KWOA 4YBMA 3EB5A 2ECTA 3N9OA 1ZBDB 1RMDA 2KGGA 4WZ0A 3N9QA 2KREA 5D1MB 2L80A 2JUNA 3LQJA 4X3GA 2EODA 1X4JA 5KH9A 2UZGA 2BAYA 4YAXA 2PNXA 4LADB 4Q6FA 2M3HA 1WENA 3T7LA 1VFYA 5FB1A 3QZVA 3RPGC 3ZVZB 5LCWB 2ECWA 4YATA 4WZ3B 1LDKC 3L11A 2PUYA 3N9PA 2EXUA 3ZPV1 5KH3A 2YSMA 2D8SA 2ECIA 3N9NA 3EB6A 2LAUA 2XB1A 3O35A 2YVRA 2D8UA 4OGCA 2JRJA 4IC3A 1HYJA 3KV5A 3GL6A 2K4DA 1JM7A 4AYCB 2VJFB 2DX8A 2YUCA 2CONA 4V3LC 2LN0A 5SVXA 3O33A 5B79A 3JUEA 2KWKA 5SVIA 5K3QA 2QICA 3ZVYA 2F6NA 2YQLA 1T1HA 2AN6A 2Y1NA 2B0OE 2MIQA 1WEOA 3PLWA 2MKEA 3LQIA 4XI1A 2DSMA 2FUUA 2H0DA 2KIZA 5C13A 3H7HA 1WESA 2VNFA 4Z0OA 3ZNIA 2LQ6A 2G6QA 2XOZA 2RR4A 4OGEA 4R7EA 2LXPC 2Y43A 3FANA 4BBQA 4GB0A 3I2DA 4MSXA 3U5NA 3U5PA 2VPGA 2XP0A 3ASLA 2YQMA 5G0FA 4BHWA 2IDAA 3T6RA 5D1LB 4YC9A 2CKLA 2ZETC 3Q1DA 2K1JA 3LVRE 3LDYA 3N9MA 3LQHA 4LKAA 2YU4A 5G04B 1U6GB 3DDTA 2JMIA 5H1TA 2KKXA 5B8DA 3HCTA 2L0BA 1V87A 2VJEA 3LJUX 5DINA 4TKPB 4PTBA 4Z0RA 4FJCA 3FM8C 3L1XA 2I50A 3SOWA 1JM7B 2YURA 4F52B 2VP7A 1WEMA 2LRIC 4NN2A 2MA6A 3HTKC 3M63A 4FK5A 5SVIB 3FEHA 1CHCA 2YHNA 4B86C 4H9DA 5H1VA 4V3KC 2K17A 2H0DB 1WEQA 2CSVA 2E6RA 1WE9A 2CRWA 3SOXA 3DQVR 2L7PA 4I7DA 4YBSA 1WEVA 4ZQLA 5TBNA 1IYMA 2M6MA 2HDPA 3RTRB 5DKAA 3SOUA 3KV6A 1N87A 4AUQB 1MBMA 2YREA 2KFTA 2MNYA 3N9LA 3VK6A 3LRQA 2CT2A 4CA1A 2CKLB 2MA5A 2VPBA 4LK9A 1X4UA 4S3OB 5H9MA 5LKXA 2YHOA 5LKUA 3M62A 2YSJA 1F62A 4GNGA 3O47A 3O34A 3O70A 2M13A 2KWNA 5LKTA 2XOYA 4N4FA 4YADA 4ZDTA 1JOCA 2HYED 4GNDA 4I7CA 4N3WA 1DCQA 2IQJA 3KNVA 4MVTA 1WEUA 2L5UA 1WIMA 4YABA 2KE1A 4UP5A 5SVYA 1WGMA 2FFWA 5EYAF 2KYUA 3O7AA 5G05B 1VD4A 3IHPA 4A4CA 4UP0A 3O36A 2YYRA 3U5MA 1G25A 3E2DA 4W4UA 4A4BA 5B75A 2F42A 3PHDA 1BORA 5TDRA 2C2LA 4O64A 3HCSA 2XEUA 4C9ZA 2C2VS 3MHHA 2G45A 2QIZA 3ZYQA 5FB0A 2M1RA 3SHBA 4R8PK 2LXHC 3NG2A 2MD7B 2VPDA 2NAAA 4LLBA 4R2YA 4LJNA 2JM3A 4O62A 4AP4A 4YBTA 3GV4A 5KH7A 3RPGB 4QF2A 3FL2A 2KKYA 2E61A 2LGVA 3ZTGA 2QJ0A 2CSYA 4FO9A 5TABA 4AYCA 2XOCA 1Z6UA 3M7KA 2VJFA 2KR4A 2LV9A 5B78A 2L75A 2RSDA 2L43A 3U5OA 3C6WA 2MT5A 1E4UA 4I7BA 2E6SA 5FERA 5C11A 2K16A 2FD4A 2P57A 3KQIA 1X4IA 2JMJA 1DVPA 2YW8A 3FJUB 1WILA 1FBVA 1XWHA 1WFKA 3FAOA 2LDRA 2JMDA 5TDWA 5FEYA 2MUMA 1MM3A 4WA6A 2Y1MA 2CSZA 4IC2A 5AIUA 2FSAA 2EGMA 3MDBC 5H1UA 2M85A 2LGKA 2KU3A 4L58A 5TRBA 4F1PA 1FP0A 2ECNA 2VJEB 3DPLR 2EGPA 4FIPA 3HCUA 4P5OB 5J3XA 3ZPVE 4L7XA 4UI9B 4GNFA 5I3LA 4B7YC 3DWDA 3C5KA 3PURA 1WEWA 2G43A 3LVQE 2ECVA 2KWJA 3T9KA 3O37A 2MD8C 5D1KB 4ZUXU 1Z60A 2OWAA 4PPEA 3SUBA 4CCGX 5LKZA 5AITA 4S3OC 4AVXA 4QF3A 5JG6A 2MNZA 3L1ZB 2CRRA 2ECGA 1WEEA 4WZ2A 1K2FA 4GNEA
chains in the Genus database with same CATH topology
3PUQA 4A0CD 2KGIA 2LGGA 2YT5A 2F6JA 2LGLA 3M99A 1WEPA 2EA6A 3MHSA 1Z2QA 4A49A 1VYXA 2OXQC 5B76A 1LDJB 2RI7A 1MM2A 2ECJA 2FUIA 2VPEA 5B77A 1HYIA 3V43A 2KWOA 4YBMA 3EB5A 2ECTA 3N9OA 1ZBDB 1RMDA 2KGGA 4WZ0A 3N9QA 2KREA 5D1MB 2L80A 3LQJA 4X3GA 2EODA 1X4JA 5KH9A 2UZGA 2BAYA 4YAXA 2PNXA 4LADB 4Q6FA 2M3HA 1WENA 3T7LA 1VFYA 5FB1A 3QZVA 3RPGC 3ZVZB 5LCWB 2ECWA 4YATA 4WZ3B 1LDKC 3L11A 2PUYA 3N9PA 3ZPV1 5KH3A 2YSMA 2D8SA 2ECIA 3N9NA 3EB6A 2XB1A 3O35A 2JRJA 4IC3A 1HYJA 3KV5A 3GL6A 2K4DA 1JM7A 4AYCB 2VJFB 2DX8A 2YUCA 4V3LC 2LN0A 3O33A 5B79A 2KWKA 2QICA 3ZVYA 2F6NA 2YQLA 1T1HA 2AN6A 2Y1NA 2MIQA 1WEOA 3LQIA 4XI1A 2FUUA 2KIZA 2H0DA 5C13A 1WESA 2VNFA 3ZNIA 2LQ6A 2G6QA 4R7EA 2LXPC 2Y43A 4BBQA 4GB0A 3I2DA 4MSXA 3U5NA 3U5PA 2VPGA 3ASLA 2YQMA 5G0FA 4BHWA 2IDAA 3T6RA 5D1LB 4YC9A 2CKLA 2ZETC 2K1JA 3N9MA 3LQHA 4LKAA 2YU4A 5G04B 1U6GB 2JMIA 5H1TA 5B8DA 3HCTA 2L0BA 1V87A 2VJEA 5DINA 4TKPB 4PTBA 4FJCA 3L1XA 2I50A 3SOWA 1JM7B 2YURA 4F52B 2VP7A 1WEMA 2LRIC 4NN2A 2MA6A 3HTKC 3M63A 4FK5A 1CHCA 2YHNA 4B86C 5H1VA 4V3KC 2K17A 2H0DB 1WEQA 2E6RA 1WE9A 3SOXA 3DQVR 4I7DA 4YBSA 1WEVA 4ZQLA 5TBNA 1IYMA 2M6MA 2HDPA 3RTRB 5DKAA 3SOUA 3KV6A 1N87A 4AUQB 2YREA 2KFTA 2MNYA 3N9LA 3VK6A 3LRQA 2CT2A 4CA1A 2CKLB 2MA5A 2VPBA 4LK9A 1X4UA 4S3OB 5H9MA 5LKXA 2YHOA 5LKUA 3M62A 2YSJA 1F62A 4GNGA 3O34A 3O70A 2KWNA 5LKTA 4N4FA 4YADA 4ZDTA 1JOCA 2HYED 4GNDA 4I7CA 4N3WA 3KNVA 4MVTA 1WEUA 2L5UA 1WIMA 4YABA 2KE1A 4UP5A 1WGMA 5EYAF 2KYUA 3O7AA 5G05B 1VD4A 3IHPA 4A4CA 4UP0A 3O36A 2YYRA 3U5MA 1G25A 4W4UA 4A4BA 5B75A 2F42A 3PHDA 1BORA 5TDRA 2C2LA 4O64A 3HCSA 2XEUA 4C9ZA 2C2VS 3MHHA 2G45A 2QIZA 3ZYQA 5FB0A 2M1RA 3SHBA 4R8PK 2LXHC 3NG2A 2MD7B 2VPDA 2NAAA 4LLBA 4R2YA 4LJNA 4AP4A 4YBTA 3GV4A 5KH7A 3RPGB 4QF2A 3FL2A 2LGVA 3ZTGA 2QJ0A 2CSYA 4FO9A 5TABA 4AYCA 1Z6UA 2VJFA 2KR4A 2LV9A 5B78A 2L75A 2RSDA 2L43A 3U5OA 3C6WA 2MT5A 1E4UA 4I7BA 2E6SA 5FERA 5C11A 2K16A 3KQIA 1X4IA 2JMJA 1DVPA 2YW8A 1WILA 1FBVA 1XWHA 1WFKA 2LDRA 2JMDA 5TDWA 5FEYA 2MUMA 1MM3A 4WA6A 2Y1MA 2CSZA 4IC2A 5AIUA 2FSAA 5H1UA 2M85A 2LGKA 2KU3A 4L58A 5TRBA 1FP0A 2ECNA 2VJEB 3DPLR 2EGPA 4FIPA 3HCUA 4P5OB 5J3XA 3ZPVE 4L7XA 4UI9B 4GNFA 5I3LA 4B7YC 3C5KA 3PURA 1WEWA 2G43A 2ECVA 2KWJA 3O37A 2MD8C 5D1KB 4ZUXU 1Z60A 4PPEA 4CCGX 5LKZA 5AITA 4S3OC 4AVXA 4QF3A 5JG6A 2MNZA 3L1ZB 2ECGA 1WEEA 4WZ2A 1K2FA 4GNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUQ A;  4A0C D;  2KGI A;  2LGG A;  2YT5 A;  2F6J A;  2LGL A;  3M99 A;  1WEP A;  2EA6 A;  3MHS A;  1Z2Q A;  4A49 A;  1VYX A;  2OXQ C;  5B76 A;  1LDJ B;  2RI7 A;  1MM2 A;  2ECJ A;  2FUI A;  2VPE A;  5B77 A;  1HYI A;  3V43 A;  2KWO A;  4YBM A;  3EB5 A;  2ECT A;  3N9O A;  1ZBD B;  1RMD A;  2KGG A;  4WZ0 A;  3N9Q A;  2KRE A;  5D1M B;  2L80 A;  3LQJ A;  4X3G A;  2EOD A;  1X4J A;  5KH9 A;  2UZG A;  2BAY A;  4YAX A;  2PNX A;  4LAD B;  4Q6F A;  2M3H A;  1WEN A;  3T7L A;  1VFY A;  5FB1 A;  3QZV A;  3RPG C;  3ZVZ B;  5LCW B;  2ECW A;  4YAT A;  4WZ3 B;  1LDK C;  3L11 A;  2PUY A;  3N9P A;  3ZPV 1;  5KH3 A;  2YSM A;  2D8S A;  2ECI A;  3N9N A;  3EB6 A;  2XB1 A;  3O35 A;  2JRJ A;  4IC3 A;  1HYJ A;  3KV5 A;  3GL6 A;  2K4D A;  1JM7 A;  4AYC B;  2VJF B;  2DX8 A;  2YUC A;  4V3L C;  2LN0 A;  3O33 A;  5B79 A;  2KWK A;  2QIC A;  3ZVY A;  2F6N A;  2YQL A;  1T1H A;  2AN6 A;  2Y1N A;  2MIQ A;  1WEO A;  3LQI A;  4XI1 A;  2FUU A;  2KIZ A;  2H0D A;  5C13 A;  1WES A;  2VNF A;  3ZNI A;  2LQ6 A;  2G6Q A;  4R7E A;  2LXP C;  2Y43 A;  4BBQ A;  4GB0 A;  3I2D A;  4MSX A;  3U5N A;  3U5P A;  2VPG A;  3ASL A;  2YQM A;  5G0F A;  4BHW A;  2IDA A;  3T6R A;  5D1L B;  4YC9 A;  2CKL A;  2ZET C;  2K1J A;  3N9M A;  3LQH A;  4LKA A;  2YU4 A;  5G04 B;  1U6G B;  2JMI A;  5H1T A;  5B8D A;  3HCT A;  2L0B A;  1V87 A;  2VJE A;  5DIN A;  4TKP B;  4PTB A;  4FJC A;  3L1X A;  2I50 A;  3SOW A;  1JM7 B;  2YUR A;  4F52 B;  2VP7 A;  1WEM A;  2LRI C;  4NN2 A;  2MA6 A;  3HTK C;  3M63 A;  4FK5 A;  1CHC A;  2YHN A;  4B86 C;  5H1V A;  4V3K C;  2K17 A;  2H0D B;  1WEQ A;  2E6R A;  1WE9 A;  3SOX A;  3DQV R;  4I7D A;  4YBS A;  1WEV A;  4ZQL A;  5TBN A;  1IYM A;  2M6M A;  2HDP A;  3RTR B;  5DKA A;  3SOU A;  3KV6 A;  1N87 A;  4AUQ B;  2YRE A;  2KFT A;  2MNY A;  3N9L A;  3VK6 A;  3LRQ A;  2CT2 A;  4CA1 A;  2CKL B;  2MA5 A;  2VPB A;  4LK9 A;  1X4U A;  4S3O B;  5H9M A;  5LKX A;  2YHO A;  5LKU A;  3M62 A;  2YSJ A;  1F62 A;  4GNG A;  3O34 A;  3O70 A;  2KWN A;  5LKT A;  4N4F A;  4YAD A;  4ZDT A;  1JOC A;  2HYE D;  4GND A;  4I7C A;  4N3W A;  3KNV A;  4MVT A;  1WEU A;  2L5U A;  1WIM A;  4YAB A;  2KE1 A;  4UP5 A;  1WGM A;  5EYA F;  2KYU A;  3O7A A;  5G05 B;  1VD4 A;  3IHP A;  4A4C A;  4UP0 A;  3O36 A;  2YYR A;  3U5M A;  1G25 A;  4W4U A;  4A4B A;  5B75 A;  2F42 A;  3PHD A;  1BOR A;  5TDR A;  2C2L A;  4O64 A;  3HCS A;  2XEU A;  4C9Z A;  2C2V S;  3MHH A;  2G45 A;  2QIZ A;  3ZYQ A;  5FB0 A;  2M1R A;  3SHB A;  4R8P K;  2LXH C;  3NG2 A;  2MD7 B;  2VPD A;  2NAA A;  4LLB A;  4R2Y A;  4LJN A;  4AP4 A;  4YBT A;  3GV4 A;  5KH7 A;  3RPG B;  4QF2 A;  3FL2 A;  2LGV A;  3ZTG A;  2QJ0 A;  2CSY A;  4FO9 A;  5TAB A;  4AYC A;  1Z6U A;  2VJF A;  2KR4 A;  2LV9 A;  5B78 A;  2L75 A;  2RSD A;  2L43 A;  3U5O A;  3C6W A;  2MT5 A;  1E4U A;  4I7B A;  2E6S A;  5FER A;  5C11 A;  2K16 A;  3KQI A;  1X4I A;  2JMJ A;  1DVP A;  2YW8 A;  1WIL A;  1FBV A;  1XWH A;  1WFK A;  2LDR A;  2JMD A;  5TDW A;  5FEY A;  2MUM A;  1MM3 A;  4WA6 A;  2Y1M A;  2CSZ A;  4IC2 A;  5AIU A;  2FSA A;  5H1U A;  2M85 A;  2LGK A;  2KU3 A;  4L58 A;  5TRB A;  1FP0 A;  2ECN A;  2VJE B;  3DPL R;  2EGP A;  4FIP A;  3HCU A;  4P5O B;  5J3X A;  3ZPV E;  4L7X A;  4UI9 B;  4GNF A;  5I3L A;  4B7Y C;  3C5K A;  3PUR A;  1WEW A;  2G43 A;  2ECV A;  2KWJ A;  3O37 A;  2MD8 C;  5D1K B;  4ZUX U;  1Z60 A;  4PPE A;  4CCG X;  5LKZ A;  5AIT A;  4S3O C;  4AVX A;  4QF3 A;  5JG6 A;  2MNZ A;  3L1Z B;  2ECG A;  1WEE A;  4WZ2 A;  1K2F A;  4GNE A; 
#chains in the Genus database with same CATH topology
 3PUQ A;  4A0C D;  2KGI A;  2LGG A;  2YT5 A;  3KDE C;  2F6J A;  2LGL A;  3M99 A;  1WEP A;  2EA6 A;  3MHS A;  1Z2Q A;  4QQ4 A;  4A49 A;  1VYX A;  2OXQ C;  5B76 A;  1LDJ B;  2RI7 A;  2DJA A;  1MM2 A;  2ECJ A;  2FUI A;  2VPE A;  5B77 A;  1HYI A;  3V43 A;  2KWO A;  4YBM A;  3EB5 A;  2ECT A;  3N9O A;  1ZBD B;  1RMD A;  2KGG A;  4WZ0 A;  3N9Q A;  2KRE A;  5D1M B;  2L80 A;  2JUN A;  3LQJ A;  4X3G A;  2EOD A;  1X4J A;  5KH9 A;  2UZG A;  2BAY A;  4YAX A;  2PNX A;  4LAD B;  4Q6F A;  2M3H A;  1WEN A;  3T7L A;  1VFY A;  5FB1 A;  3QZV A;  3RPG C;  3ZVZ B;  5LCW B;  2ECW A;  4YAT A;  4WZ3 B;  1LDK C;  3L11 A;  2PUY A;  3N9P A;  2EXU A;  3ZPV 1;  5KH3 A;  2YSM A;  2D8S A;  2ECI A;  3N9N A;  3EB6 A;  2LAU A;  2XB1 A;  3O35 A;  2YVR A;  2D8U A;  4OGC A;  2JRJ A;  4IC3 A;  1HYJ A;  3KV5 A;  3GL6 A;  2K4D A;  1JM7 A;  4AYC B;  2VJF B;  2DX8 A;  2YUC A;  2CON A;  4V3L C;  2LN0 A;  5SVX A;  3O33 A;  5B79 A;  3JUE A;  2KWK A;  5SVI A;  5K3Q A;  2QIC A;  3ZVY A;  2F6N A;  2YQL A;  1T1H A;  2AN6 A;  2Y1N A;  2B0O E;  2MIQ A;  1WEO A;  3PLW A;  2MKE A;  3LQI A;  4XI1 A;  2DSM A;  2FUU A;  2H0D A;  2KIZ A;  5C13 A;  3H7H A;  1WES A;  2VNF A;  4Z0O A;  3ZNI A;  2LQ6 A;  2G6Q A;  2XOZ A;  2RR4 A;  4OGE A;  4R7E A;  2LXP C;  2Y43 A;  3FAN A;  4BBQ A;  4GB0 A;  3I2D A;  4MSX A;  3U5N A;  3U5P A;  2VPG A;  2XP0 A;  3ASL A;  2YQM A;  5G0F A;  4BHW A;  2IDA A;  3T6R A;  5D1L B;  4YC9 A;  2CKL A;  2ZET C;  3Q1D A;  2K1J A;  3LVR E;  3LDY A;  3N9M A;  3LQH A;  4LKA A;  2YU4 A;  5G04 B;  1U6G B;  3DDT A;  2JMI A;  5H1T A;  2KKX A;  5B8D A;  3HCT A;  2L0B A;  1V87 A;  2VJE A;  3LJU X;  5DIN A;  4TKP B;  4PTB A;  4Z0R A;  4FJC A;  3FM8 C;  3L1X A;  2I50 A;  3SOW A;  1JM7 B;  2YUR A;  4F52 B;  2VP7 A;  1WEM A;  2LRI C;  4NN2 A;  2MA6 A;  3HTK C;  3M63 A;  4FK5 A;  5SVI B;  3FEH A;  1CHC A;  2YHN A;  4B86 C;  4H9D A;  5H1V A;  4V3K C;  2K17 A;  2H0D B;  1WEQ A;  2CSV A;  2E6R A;  1WE9 A;  2CRW A;  3SOX A;  3DQV R;  2L7P A;  4I7D A;  4YBS A;  1WEV A;  4ZQL A;  5TBN A;  1IYM A;  2M6M A;  2HDP A;  3RTR B;  5DKA A;  3SOU A;  3KV6 A;  1N87 A;  4AUQ B;  1MBM A;  2YRE A;  2KFT A;  2MNY A;  3N9L A;  3VK6 A;  3LRQ A;  2CT2 A;  4CA1 A;  2CKL B;  2MA5 A;  2VPB A;  4LK9 A;  1X4U A;  4S3O B;  5H9M A;  5LKX A;  2YHO A;  5LKU A;  3M62 A;  2YSJ A;  1F62 A;  4GNG A;  3O47 A;  3O34 A;  3O70 A;  2M13 A;  2KWN A;  5LKT A;  2XOY A;  4N4F A;  4YAD A;  4ZDT A;  1JOC A;  2HYE D;  4GND A;  4I7C A;  4N3W A;  1DCQ A;  2IQJ A;  3KNV A;  4MVT A;  1WEU A;  2L5U A;  1WIM A;  4YAB A;  2KE1 A;  4UP5 A;  5SVY A;  1WGM A;  2FFW A;  5EYA F;  2KYU A;  3O7A A;  5G05 B;  1VD4 A;  3IHP A;  4A4C A;  4UP0 A;  3O36 A;  2YYR A;  3U5M A;  1G25 A;  3E2D A;  4W4U A;  4A4B A;  5B75 A;  2F42 A;  3PHD A;  1BOR A;  5TDR A;  2C2L A;  4O64 A;  3HCS A;  2XEU A;  4C9Z A;  2C2V S;  3MHH A;  2G45 A;  2QIZ A;  3ZYQ A;  5FB0 A;  2M1R A;  3SHB A;  4R8P K;  2LXH C;  3NG2 A;  2MD7 B;  2VPD A;  2NAA A;  4LLB A;  4R2Y A;  4LJN A;  2JM3 A;  4O62 A;  4AP4 A;  4YBT A;  3GV4 A;  5KH7 A;  3RPG B;  4QF2 A;  3FL2 A;  2KKY A;  2E61 A;  2LGV A;  3ZTG A;  2QJ0 A;  2CSY A;  4FO9 A;  5TAB A;  4AYC A;  2XOC A;  1Z6U A;  3M7K A;  2VJF A;  2KR4 A;  2LV9 A;  5B78 A;  2L75 A;  2RSD A;  2L43 A;  3U5O A;  3C6W A;  2MT5 A;  1E4U A;  4I7B A;  2E6S A;  5FER A;  5C11 A;  2K16 A;  2FD4 A;  2P57 A;  3KQI A;  1X4I A;  2JMJ A;  1DVP A;  2YW8 A;  3FJU B;  1WIL A;  1FBV A;  1XWH A;  1WFK A;  3FAO A;  2LDR A;  2JMD A;  5TDW A;  5FEY A;  2MUM A;  1MM3 A;  4WA6 A;  2Y1M A;  2CSZ A;  4IC2 A;  5AIU A;  2FSA A;  2EGM A;  3MDB C;  5H1U A;  2M85 A;  2LGK A;  2KU3 A;  4L58 A;  5TRB A;  4F1P A;  1FP0 A;  2ECN A;  2VJE B;  3DPL R;  2EGP A;  4FIP A;  3HCU A;  4P5O B;  5J3X A;  3ZPV E;  4L7X A;  4UI9 B;  4GNF A;  5I3L A;  4B7Y C;  3DWD A;  3C5K A;  3PUR A;  1WEW A;  2G43 A;  3LVQ E;  2ECV A;  2KWJ A;  3T9K A;  3O37 A;  2MD8 C;  5D1K B;  4ZUX U;  1Z60 A;  2OWA A;  4PPE A;  3SUB A;  4CCG X;  5LKZ A;  5AIT A;  4S3O C;  4AVX A;  4QF3 A;  5JG6 A;  2MNZ A;  3L1Z B;  2CRR A;  2ECG A;  1WEE A;  4WZ2 A;  1K2F A;  4GNE A; 
#chains in the Genus database with same CATH homology
 3PUQ A;  4A0C D;  2KGI A;  2LGG A;  2YT5 A;  2F6J A;  2LGL A;  3M99 A;  1WEP A;  2EA6 A;  3MHS A;  1Z2Q A;  4A49 A;  1VYX A;  2OXQ C;  5B76 A;  1LDJ B;  2RI7 A;  1MM2 A;  2ECJ A;  2FUI A;  2VPE A;  5B77 A;  1HYI A;  3V43 A;  2KWO A;  4YBM A;  3EB5 A;  2ECT A;  3N9O A;  1ZBD B;  1RMD A;  2KGG A;  4WZ0 A;  3N9Q A;  2KRE A;  5D1M B;  2L80 A;  3LQJ A;  4X3G A;  2EOD A;  1X4J A;  5KH9 A;  2UZG A;  2BAY A;  4YAX A;  2PNX A;  4LAD B;  4Q6F A;  2M3H A;  1WEN A;  3T7L A;  1VFY A;  5FB1 A;  3QZV A;  3RPG C;  3ZVZ B;  5LCW B;  2ECW A;  4YAT A;  4WZ3 B;  1LDK C;  3L11 A;  2PUY A;  3N9P A;  3ZPV 1;  5KH3 A;  2YSM A;  2D8S A;  2ECI A;  3N9N A;  3EB6 A;  2XB1 A;  3O35 A;  2JRJ A;  4IC3 A;  1HYJ A;  3KV5 A;  3GL6 A;  2K4D A;  1JM7 A;  4AYC B;  2VJF B;  2DX8 A;  2YUC A;  4V3L C;  2LN0 A;  3O33 A;  5B79 A;  2KWK A;  2QIC A;  3ZVY A;  2F6N A;  2YQL A;  1T1H A;  2AN6 A;  2Y1N A;  2MIQ A;  1WEO A;  3LQI A;  4XI1 A;  2FUU A;  2KIZ A;  2H0D A;  5C13 A;  1WES A;  2VNF A;  3ZNI A;  2LQ6 A;  2G6Q A;  4R7E A;  2LXP C;  2Y43 A;  4BBQ A;  4GB0 A;  3I2D A;  4MSX A;  3U5N A;  3U5P A;  2VPG A;  3ASL A;  2YQM A;  5G0F A;  4BHW A;  2IDA A;  3T6R A;  5D1L B;  4YC9 A;  2CKL A;  2ZET C;  2K1J A;  3N9M A;  3LQH A;  4LKA A;  2YU4 A;  5G04 B;  1U6G B;  2JMI A;  5H1T A;  5B8D A;  3HCT A;  2L0B A;  1V87 A;  2VJE A;  5DIN A;  4TKP B;  4PTB A;  4FJC A;  3L1X A;  2I50 A;  3SOW A;  1JM7 B;  2YUR A;  4F52 B;  2VP7 A;  1WEM A;  2LRI C;  4NN2 A;  2MA6 A;  3HTK C;  3M63 A;  4FK5 A;  1CHC A;  2YHN A;  4B86 C;  5H1V A;  4V3K C;  2K17 A;  2H0D B;  1WEQ A;  2E6R A;  1WE9 A;  3SOX A;  3DQV R;  4I7D A;  4YBS A;  1WEV A;  4ZQL A;  5TBN A;  1IYM A;  2M6M A;  2HDP A;  3RTR B;  5DKA A;  3SOU A;  3KV6 A;  1N87 A;  4AUQ B;  2YRE A;  2KFT A;  2MNY A;  3N9L A;  3VK6 A;  3LRQ A;  2CT2 A;  4CA1 A;  2CKL B;  2MA5 A;  2VPB A;  4LK9 A;  1X4U A;  4S3O B;  5H9M A;  5LKX A;  2YHO A;  5LKU A;  3M62 A;  2YSJ A;  1F62 A;  4GNG A;  3O34 A;  3O70 A;  2KWN A;  5LKT A;  4N4F A;  4YAD A;  4ZDT A;  1JOC A;  2HYE D;  4GND A;  4I7C A;  4N3W A;  3KNV A;  4MVT A;  1WEU A;  2L5U A;  1WIM A;  4YAB A;  2KE1 A;  4UP5 A;  1WGM A;  5EYA F;  2KYU A;  3O7A A;  5G05 B;  1VD4 A;  3IHP A;  4A4C A;  4UP0 A;  3O36 A;  2YYR A;  3U5M A;  1G25 A;  4W4U A;  4A4B A;  5B75 A;  2F42 A;  3PHD A;  1BOR A;  5TDR A;  2C2L A;  4O64 A;  3HCS A;  2XEU A;  4C9Z A;  2C2V S;  3MHH A;  2G45 A;  2QIZ A;  3ZYQ A;  5FB0 A;  2M1R A;  3SHB A;  4R8P K;  2LXH C;  3NG2 A;  2MD7 B;  2VPD A;  2NAA A;  4LLB A;  4R2Y A;  4LJN A;  4AP4 A;  4YBT A;  3GV4 A;  5KH7 A;  3RPG B;  4QF2 A;  3FL2 A;  2LGV A;  3ZTG A;  2QJ0 A;  2CSY A;  4FO9 A;  5TAB A;  4AYC A;  1Z6U A;  2VJF A;  2KR4 A;  2LV9 A;  5B78 A;  2L75 A;  2RSD A;  2L43 A;  3U5O A;  3C6W A;  2MT5 A;  1E4U A;  4I7B A;  2E6S A;  5FER A;  5C11 A;  2K16 A;  3KQI A;  1X4I A;  2JMJ A;  1DVP A;  2YW8 A;  1WIL A;  1FBV A;  1XWH A;  1WFK A;  2LDR A;  2JMD A;  5TDW A;  5FEY A;  2MUM A;  1MM3 A;  4WA6 A;  2Y1M A;  2CSZ A;  4IC2 A;  5AIU A;  2FSA A;  5H1U A;  2M85 A;  2LGK A;  2KU3 A;  4L58 A;  5TRB A;  1FP0 A;  2ECN A;  2VJE B;  3DPL R;  2EGP A;  4FIP A;  3HCU A;  4P5O B;  5J3X A;  3ZPV E;  4L7X A;  4UI9 B;  4GNF A;  5I3L A;  4B7Y C;  3C5K A;  3PUR A;  1WEW A;  2G43 A;  2ECV A;  2KWJ A;  3O37 A;  2MD8 C;  5D1K B;  4ZUX U;  1Z60 A;  4PPE A;  4CCG X;  5LKZ A;  5AIT A;  4S3O C;  4AVX A;  4QF3 A;  5JG6 A;  2MNZ A;  3L1Z B;  2ECG A;  1WEE A;  4WZ2 A;  1K2F A;  4GNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...