2MA6A

Solution nmr structure of the ring finger domain from the kip1 ubiquitination-promoting e3 complex protein 1 (kpc1/rnf123) from homo sapiens, northeast structural genomics consortium (nesg) target hr8700a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
SHMPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF123
publication title Solution NMR Structure of the RING finger domain from the Kip1 ubiquitination-promoting E3 complex protein 1 (KPC1/RNF123) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8700A
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 61
sequence length 61
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ma6A00
5TDWA 4FK5A 4F52B 5J3XA 4AVXA 2ECJA 3O7AA 1WILA 1DVPA 3LQIA 1X4IA 2VJFA 4AYCB 4YBTA 4WZ0A 4YC9A 1WFKA 3U5PA 2FUUA 4YABA 2KFTA 2QIZA 3O70A 1VFYA 3DQVR 3N9MA 3SOUA 2EGPA 1WIMA 3GL6A 5H1UA 4XI1A 1VYXA 1X4UA 2LGLA 3ZTGA 2ECVA 5KH9A 2YUCA 4V3KC 2MD7B 2KWOA 4N4FA 2KWKA 2ECGA 5DKAA 4IC2A 3T7LA 5TRBA 1Z60A 4L7XA 4WZ2A 5B8DA 4L58A 2LGVA 3U5MA 2K1JA 2LN0A 4B86C 3ZNIA 2PNXA 4R7EA 3I2DA 5G04B 1XWHA 2LGGA 2VJFB 2BAYA 1JOCA 3KQIA 4LK9A 1G25A 2L5UA 1MM2A 2K16A 5KH3A 1WEPA 5H9MA 3IHPA 2D8SA 3O37A 2KGIA 4YATA 1X4JA 2YU4A 3RTRB 2MA5A 4I7CA 2VJEA 2M3HA 1Z2QA 1LDKC 2MUMA 5LKTA 2YQMA 5AITA 2JMIA 1WEOA 2KWNA 2M1RA 3ZPV1 4YADA 5B79A 2LGKA 1Z6UA 3QZVA 2LRIC 4GNFA 1BORA 3KV6A 2FSAA 2ECIA 3PUQA 5FB0A 2UZGA 3N9PA 5LKUA 4GNEA 1HYJA 3MHSA 5G05B 5FB1A 1HYIA 3PHDA 1WEUA 3LRQA 1JM7B 4AUQB 2NAAA 4O64A 2MIQA 4WA6A 2RSDA 2KGGA 4GNDA 2CSZA 2L75A 3V43A 3GV4A 2K4DA 4X3GA 5B76A 2VJEB 2MT5A 2JMJA 4ZQLA 1RMDA 2G6QA 4AP4A 1WEVA 3HCUA 1U6GB 2LXPC 1LDJB 4UP0A 3U5OA 3N9LA 5H1VA 3T6RA 2PUYA 4GNGA 5LKXA 2L43A 1E4UA 1WESA 3MHHA 5TABA 3HTKC 3L1XA 5DINA 4FJCA 2JRJA 3M63A 1WE9A 2CT2A 4I7BA 2H0DA 2I50A 3O34A 4UI9B 4FO9A 2F6JA 2MNZA 4MVTA 4UP5A 3C6WA 4A4BA 2VP7A 2M85A 3U5NA 4FIPA 5JG6A 5LKZA 1JM7A 2LV9A 3RPGB 2HYED 2LDRA 4QF2A 2RI7A 2QICA 3L11A 2C2VS 2YW8A 2Y43A 2QJ0A 1WEMA 3KNVA 4PTBA 2YURA 3HCSA 4GB0A 4C9ZA 2ECNA 2C2LA 3ZYQA 4ZUXU 3M62A 3PURA 2AN6A 1FP0A 4PPEA 2KREA 3O35A 4YBSA 2ECWA 3M99A 3N9OA 2H0DB 3ZVYA 2ZETC 3EB5A 3RPGC 1MM3A 2L0BA 2VPGA 4BBQA 5D1KB 3HCTA 5B78A 2YQLA 4S3OB 4LLBA 5LCWB 2MNYA 2MA6A 2VNFA 2KIZA 5C13A 4N3WA 4QF3A 3ASLA 3N9QA 2LXHC 3NG2A 3SOXA 3DPLR 5B77A 2G43A 2CKLA 2OXQC 4I7DA 4NN2A 1VD4A 3KV5A 4A4CA 5TDRA 5EYAF 1F62A 4LKAA 2VPBA 1WEWA 2YHOA 1WGMA 2K17A 3SHBA 3O33A 4S3OC 4IC3A 4WZ3B 1V87A 3LQJA 5AIUA 5H1TA 4YBMA 4YAXA 3EB6A 4LJNA 5D1LB 2IDAA 2YREA 2HDPA 4CCGX 2XB1A 1FBVA 3O36A 3ZPVE 2DX8A 1WEQA 4R2YA 4LADB 2Y1MA 5TBNA 2VPEA 2CSYA 2YT5A 2YSMA 4W4UA 3C5KA 2KWJA 1ZBDB 4BHWA 4R8PK 1CHCA 2YYRA 4CA1A 2LQ6A 2KR4A 5I3LA 2YHNA 2CKLB 5B75A 4Q6FA 2VPDA 5KH7A 2E6RA 3LQHA 4P5OB 2F6NA 4A0CD 3FL2A 4AYCA 1IYMA 2KE1A 2JMDA 2XEUA 3VK6A 1N87A 2FUIA 4ZDTA 2Y1NA 1K2FA 2M6MA 4MSXA 2L80A 2MD8C 5FEYA 4V3LC 1WEEA 5G0FA 5FERA 4TKPB 2E6SA 2G45A 3SOWA 2YSJA 5C11A 1WENA 2EA6A 3L1ZB 4A49A 2EODA 2F42A 2ECTA 3N9NA 3ZVZB 2KYUA 5D1MB 4B7YC 2KU3A 1T1HA
chains in the Genus database with same CATH superfamily
5SVXA 5TDWA 4FK5A 3JUEA 4F52B 5J3XA 4AVXA 2ECJA 3O7AA 1WILA 1DVPA 3LQIA 1X4IA 4F1PA 2VJFA 4AYCB 4YBTA 4WZ0A 4YC9A 1WFKA 3PLWA 3U5PA 2FUUA 4YABA 2KFTA 2QIZA 3O70A 1VFYA 3KDEC 3DQVR 1DCQA 3N9MA 3SOUA 2EGPA 1WIMA 2RR4A 3T9KA 3GL6A 5H1UA 4XI1A 1VYXA 1X4UA 2LGLA 3ZTGA 2ECVA 5KH9A 2YUCA 4V3KC 2MD7B 2KWOA 2XOZA 4N4FA 2KWKA 2ECGA 5DKAA 4IC2A 3T7LA 5TRBA 1Z60A 4L7XA 4WZ2A 5B8DA 4L58A 2LGVA 3U5MA 2K1JA 2LN0A 4B86C 3ZNIA 2PNXA 4R7EA 3I2DA 5G04B 1XWHA 2LGGA 2VJFB 2XP0A 4O62A 2BAYA 1JOCA 3KQIA 4LK9A 1G25A 2L5UA 1MM2A 2K16A 5KH3A 1WEPA 3DWDA 5H9MA 3IHPA 2D8SA 3O37A 2KGIA 4YATA 2KKYA 1X4JA 4OGEA 2YU4A 3RTRB 2MA5A 4I7CA 2VJEA 2M3HA 1Z2QA 1LDKC 2MUMA 3FM8C 5LKTA 3O47A 2YQMA 5AITA 2JMIA 1WEOA 2KWNA 2M1RA 3ZPV1 4YADA 5B79A 2LGKA 1Z6UA 2XOCA 2LRIC 3QZVA 4GNFA 1BORA 3KV6A 4Z0RA 2FSAA 2ECIA 3PUQA 5FB0A 2UZGA 3N9PA 5LKUA 4GNEA 1HYJA 3MHSA 5G05B 2EGMA 5FB1A 1HYIA 3PHDA 1WEUA 3LRQA 1JM7B 4AUQB 2NAAA 4O64A 2FD4A 2MIQA 4WA6A 3H7HA 2RSDA 2KGGA 5SVIB 4GNDA 2CSZA 2L75A 3V43A 3GV4A 3FAOA 2K4DA 2D8UA 4X3GA 5B76A 2VJEB 2MT5A 2JMJA 4ZQLA 1RMDA 2G6QA 4AP4A 1WEVA 3HCUA 1U6GB 2LXPC 1LDJB 4UP0A 3U5OA 2OWAA 3N9LA 5H1VA 2CRRA 3T6RA 2PUYA 3FEHA 4Z0OA 4GNGA 5LKXA 2IQJA 2L43A 1E4UA 1WESA 3MHHA 5TABA 3HTKC 3L1XA 5DINA 2EXUA 4FJCA 2JRJA 3FANA 3M63A 1WE9A 2CT2A 4I7BA 2H0DA 2I50A 3O34A 4UI9B 4FO9A 2F6JA 3E2DA 2MNZA 4MVTA 4UP5A 3C6WA 4A4BA 2VP7A 2M85A 3U5NA 5K3QA 4FIPA 5JG6A 5LKZA 1JM7A 2LV9A 3RPGB 2HYED 2LDRA 4QF2A 2RI7A 2QICA 3L11A 2C2VS 5SVIA 2YW8A 2L7PA 2Y43A 2QJ0A 1WEMA 3KNVA 4PTBA 2YURA 3HCSA 4GB0A 2CONA 4C9ZA 2ECNA 2YVRA 2C2LA 3DDTA 3ZYQA 4ZUXU 3M62A 3PURA 2AN6A 1FP0A 4PPEA 2KREA 2DSMA 3O35A 4YBSA 2ECWA 3M99A 3N9OA 2H0DB 3ZVYA 2ZETC 3EB5A 3RPGC 1MM3A 2L0BA 2VPGA 4BBQA 5D1KB 3HCTA 2M13A 5B78A 2YQLA 4S3OB 4LLBA 5LCWB 2MNYA 4QQ4A 2MA6A 2VNFA 2KIZA 5C13A 4H9DA 4N3WA 3FJUB 4QF3A 3ASLA 3N9QA 2LXHC 3NG2A 3SOXA 3DPLR 5B77A 2G43A 2KKXA 2CSVA 2CKLA 4OGCA 2OXQC 4I7DA 4NN2A 1VD4A 3KV5A 4A4CA 5TDRA 5EYAF 5SVYA 1F62A 2LAUA 3LJUX 2JM3A 4LKAA 2VPBA 1WEWA 2YHOA 1WGMA 2K17A 3SHBA 3O33A 4S3OC 4IC3A 2DJAA 4WZ3B 1V87A 3LQJA 5AIUA 5H1TA 4YBMA 4YAXA 3EB6A 4LJNA 5D1LB 2IDAA 2YREA 2HDPA 4CCGX 2XB1A 1FBVA 3O36A 2MKEA 3ZPVE 2B0OE 2DX8A 3LVRE 1WEQA 4R2YA 4LADB 2E61A 2Y1MA 5TBNA 2VPEA 2CSYA 2YT5A 2YSMA 4W4UA 3C5KA 2KWJA 1ZBDB 4BHWA 4R8PK 1CHCA 2YYRA 4CA1A 2CRWA 2LQ6A 2KR4A 5I3LA 2YHNA 2CKLB 2P57A 5B75A 4Q6FA 2VPDA 5KH7A 2XOYA 2E6RA 3LQHA 4P5OB 2F6NA 4A0CD 3FL2A 4AYCA 1MBMA 1IYMA 3M7KA 2KE1A 2JMDA 2XEUA 3VK6A 1N87A 2FUIA 4ZDTA 3SUBA 2Y1NA 1K2FA 3LDYA 2M6MA 4MSXA 2L80A 2MD8C 3Q1DA 5FEYA 4V3LC 1WEEA 5G0FA 5FERA 4TKPB 2E6SA 2G45A 3SOWA 2YSJA 2FFWA 5C11A 1WENA 2EA6A 3L1ZB 4A49A 2EODA 2F42A 3MDBC 2ECTA 3LVQE 2JUNA 3N9NA 3ZVZB 2KYUA 5D1MB 4B7YC 2KU3A 1T1HA
chains in the Genus database with same CATH topology
5TDWA 4FK5A 4F52B 5J3XA 4AVXA 2ECJA 3O7AA 1WILA 1DVPA 3LQIA 1X4IA 2VJFA 4AYCB 4YBTA 4WZ0A 4YC9A 1WFKA 3U5PA 2FUUA 4YABA 2KFTA 2QIZA 3O70A 1VFYA 3DQVR 3N9MA 3SOUA 2EGPA 1WIMA 3GL6A 5H1UA 4XI1A 1VYXA 1X4UA 2LGLA 3ZTGA 2ECVA 5KH9A 2YUCA 4V3KC 2MD7B 2KWOA 4N4FA 2KWKA 2ECGA 5DKAA 4IC2A 3T7LA 5TRBA 1Z60A 4L7XA 4WZ2A 5B8DA 4L58A 2LGVA 3U5MA 2K1JA 2LN0A 4B86C 3ZNIA 2PNXA 4R7EA 3I2DA 5G04B 1XWHA 2LGGA 2VJFB 2BAYA 1JOCA 3KQIA 4LK9A 1G25A 2L5UA 1MM2A 2K16A 5KH3A 1WEPA 5H9MA 3IHPA 2D8SA 3O37A 2KGIA 4YATA 1X4JA 2YU4A 3RTRB 2MA5A 4I7CA 2VJEA 2M3HA 1Z2QA 1LDKC 2MUMA 5LKTA 2YQMA 5AITA 2JMIA 1WEOA 2KWNA 2M1RA 3ZPV1 4YADA 5B79A 2LGKA 1Z6UA 3QZVA 2LRIC 4GNFA 1BORA 3KV6A 2FSAA 2ECIA 3PUQA 5FB0A 2UZGA 3N9PA 5LKUA 4GNEA 1HYJA 3MHSA 5G05B 5FB1A 1HYIA 3PHDA 1WEUA 3LRQA 1JM7B 4AUQB 2NAAA 4O64A 2MIQA 4WA6A 2RSDA 2KGGA 4GNDA 2CSZA 2L75A 3V43A 3GV4A 2K4DA 4X3GA 5B76A 2VJEB 2MT5A 2JMJA 4ZQLA 1RMDA 2G6QA 4AP4A 1WEVA 3HCUA 1U6GB 2LXPC 1LDJB 4UP0A 3U5OA 3N9LA 5H1VA 3T6RA 2PUYA 4GNGA 5LKXA 2L43A 1E4UA 1WESA 3MHHA 5TABA 3HTKC 3L1XA 5DINA 4FJCA 2JRJA 3M63A 1WE9A 2CT2A 4I7BA 2H0DA 2I50A 3O34A 4UI9B 4FO9A 2F6JA 2MNZA 4MVTA 4UP5A 3C6WA 4A4BA 2VP7A 2M85A 3U5NA 4FIPA 5JG6A 5LKZA 1JM7A 2LV9A 3RPGB 2HYED 2LDRA 4QF2A 2RI7A 2QICA 3L11A 2C2VS 2YW8A 2Y43A 2QJ0A 1WEMA 3KNVA 4PTBA 2YURA 3HCSA 4GB0A 4C9ZA 2ECNA 2C2LA 3ZYQA 4ZUXU 3M62A 3PURA 2AN6A 1FP0A 4PPEA 2KREA 3O35A 4YBSA 2ECWA 3M99A 3N9OA 2H0DB 3ZVYA 2ZETC 3EB5A 3RPGC 1MM3A 2L0BA 2VPGA 4BBQA 5D1KB 3HCTA 5B78A 2YQLA 4S3OB 4LLBA 5LCWB 2MNYA 2MA6A 2VNFA 2KIZA 5C13A 4N3WA 4QF3A 3ASLA 3N9QA 2LXHC 3NG2A 3SOXA 3DPLR 5B77A 2G43A 2CKLA 2OXQC 4I7DA 4NN2A 1VD4A 3KV5A 4A4CA 5TDRA 5EYAF 1F62A 4LKAA 2VPBA 1WEWA 2YHOA 1WGMA 2K17A 3SHBA 3O33A 4S3OC 4IC3A 4WZ3B 1V87A 3LQJA 5AIUA 5H1TA 4YBMA 4YAXA 3EB6A 4LJNA 5D1LB 2IDAA 2YREA 2HDPA 4CCGX 2XB1A 1FBVA 3O36A 3ZPVE 2DX8A 1WEQA 4R2YA 4LADB 2Y1MA 5TBNA 2VPEA 2CSYA 2YT5A 2YSMA 4W4UA 3C5KA 2KWJA 1ZBDB 4BHWA 4R8PK 1CHCA 2YYRA 4CA1A 2LQ6A 2KR4A 5I3LA 2YHNA 2CKLB 5B75A 4Q6FA 2VPDA 5KH7A 2E6RA 3LQHA 4P5OB 2F6NA 4A0CD 3FL2A 4AYCA 1IYMA 2KE1A 2JMDA 2XEUA 3VK6A 1N87A 2FUIA 4ZDTA 2Y1NA 1K2FA 2M6MA 4MSXA 2L80A 2MD8C 5FEYA 4V3LC 1WEEA 5G0FA 5FERA 4TKPB 2E6SA 2G45A 3SOWA 2YSJA 5C11A 1WENA 2EA6A 3L1ZB 4A49A 2EODA 2F42A 2ECTA 3N9NA 3ZVZB 2KYUA 5D1MB 4B7YC 2KU3A 1T1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDW A;  4FK5 A;  4F52 B;  5J3X A;  4AVX A;  2ECJ A;  3O7A A;  1WIL A;  1DVP A;  3LQI A;  1X4I A;  2VJF A;  4AYC B;  4YBT A;  4WZ0 A;  4YC9 A;  1WFK A;  3U5P A;  2FUU A;  4YAB A;  2KFT A;  2QIZ A;  3O70 A;  1VFY A;  3DQV R;  3N9M A;  3SOU A;  2EGP A;  1WIM A;  3GL6 A;  5H1U A;  4XI1 A;  1VYX A;  1X4U A;  2LGL A;  3ZTG A;  2ECV A;  5KH9 A;  2YUC A;  4V3K C;  2MD7 B;  2KWO A;  4N4F A;  2KWK A;  2ECG A;  5DKA A;  4IC2 A;  3T7L A;  5TRB A;  1Z60 A;  4L7X A;  4WZ2 A;  5B8D A;  4L58 A;  2LGV A;  3U5M A;  2K1J A;  2LN0 A;  4B86 C;  3ZNI A;  2PNX A;  4R7E A;  3I2D A;  5G04 B;  1XWH A;  2LGG A;  2VJF B;  2BAY A;  1JOC A;  3KQI A;  4LK9 A;  1G25 A;  2L5U A;  1MM2 A;  2K16 A;  5KH3 A;  1WEP A;  5H9M A;  3IHP A;  2D8S A;  3O37 A;  2KGI A;  4YAT A;  1X4J A;  2YU4 A;  3RTR B;  2MA5 A;  4I7C A;  2VJE A;  2M3H A;  1Z2Q A;  1LDK C;  2MUM A;  5LKT A;  2YQM A;  5AIT A;  2JMI A;  1WEO A;  2KWN A;  2M1R A;  3ZPV 1;  4YAD A;  5B79 A;  2LGK A;  1Z6U A;  3QZV A;  2LRI C;  4GNF A;  1BOR A;  3KV6 A;  2FSA A;  2ECI A;  3PUQ A;  5FB0 A;  2UZG A;  3N9P A;  5LKU A;  4GNE A;  1HYJ A;  3MHS A;  5G05 B;  5FB1 A;  1HYI A;  3PHD A;  1WEU A;  3LRQ A;  1JM7 B;  4AUQ B;  2NAA A;  4O64 A;  2MIQ A;  4WA6 A;  2RSD A;  2KGG A;  4GND A;  2CSZ A;  2L75 A;  3V43 A;  3GV4 A;  2K4D A;  4X3G A;  5B76 A;  2VJE B;  2MT5 A;  2JMJ A;  4ZQL A;  1RMD A;  2G6Q A;  4AP4 A;  1WEV A;  3HCU A;  1U6G B;  2LXP C;  1LDJ B;  4UP0 A;  3U5O A;  3N9L A;  5H1V A;  3T6R A;  2PUY A;  4GNG A;  5LKX A;  2L43 A;  1E4U A;  1WES A;  3MHH A;  5TAB A;  3HTK C;  3L1X A;  5DIN A;  4FJC A;  2JRJ A;  3M63 A;  1WE9 A;  2CT2 A;  4I7B A;  2H0D A;  2I50 A;  3O34 A;  4UI9 B;  4FO9 A;  2F6J A;  2MNZ A;  4MVT A;  4UP5 A;  3C6W A;  4A4B A;  2VP7 A;  2M85 A;  3U5N A;  4FIP A;  5JG6 A;  5LKZ A;  1JM7 A;  2LV9 A;  3RPG B;  2HYE D;  2LDR A;  4QF2 A;  2RI7 A;  2QIC A;  3L11 A;  2C2V S;  2YW8 A;  2Y43 A;  2QJ0 A;  1WEM A;  3KNV A;  4PTB A;  2YUR A;  3HCS A;  4GB0 A;  4C9Z A;  2ECN A;  2C2L A;  3ZYQ A;  4ZUX U;  3M62 A;  3PUR A;  2AN6 A;  1FP0 A;  4PPE A;  2KRE A;  3O35 A;  4YBS A;  2ECW A;  3M99 A;  3N9O A;  2H0D B;  3ZVY A;  2ZET C;  3EB5 A;  3RPG C;  1MM3 A;  2L0B A;  2VPG A;  4BBQ A;  5D1K B;  3HCT A;  5B78 A;  2YQL A;  4S3O B;  4LLB A;  5LCW B;  2MNY A;  2MA6 A;  2VNF A;  2KIZ A;  5C13 A;  4N3W A;  4QF3 A;  3ASL A;  3N9Q A;  2LXH C;  3NG2 A;  3SOX A;  3DPL R;  5B77 A;  2G43 A;  2CKL A;  2OXQ C;  4I7D A;  4NN2 A;  1VD4 A;  3KV5 A;  4A4C A;  5TDR A;  5EYA F;  1F62 A;  4LKA A;  2VPB A;  1WEW A;  2YHO A;  1WGM A;  2K17 A;  3SHB A;  3O33 A;  4S3O C;  4IC3 A;  4WZ3 B;  1V87 A;  3LQJ A;  5AIU A;  5H1T A;  4YBM A;  4YAX A;  3EB6 A;  4LJN A;  5D1L B;  2IDA A;  2YRE A;  2HDP A;  4CCG X;  2XB1 A;  1FBV A;  3O36 A;  3ZPV E;  2DX8 A;  1WEQ A;  4R2Y A;  4LAD B;  2Y1M A;  5TBN A;  2VPE A;  2CSY A;  2YT5 A;  2YSM A;  4W4U A;  3C5K A;  2KWJ A;  1ZBD B;  4BHW A;  4R8P K;  1CHC A;  2YYR A;  4CA1 A;  2LQ6 A;  2KR4 A;  5I3L A;  2YHN A;  2CKL B;  5B75 A;  4Q6F A;  2VPD A;  5KH7 A;  2E6R A;  3LQH A;  4P5O B;  2F6N A;  4A0C D;  3FL2 A;  4AYC A;  1IYM A;  2KE1 A;  2JMD A;  2XEU A;  3VK6 A;  1N87 A;  2FUI A;  4ZDT A;  2Y1N A;  1K2F A;  2M6M A;  4MSX A;  2L80 A;  2MD8 C;  5FEY A;  4V3L C;  1WEE A;  5G0F A;  5FER A;  4TKP B;  2E6S A;  2G45 A;  3SOW A;  2YSJ A;  5C11 A;  1WEN A;  2EA6 A;  3L1Z B;  4A49 A;  2EOD A;  2F42 A;  2ECT A;  3N9N A;  3ZVZ B;  2KYU A;  5D1M B;  4B7Y C;  2KU3 A;  1T1H A; 
#chains in the Genus database with same CATH topology
 5SVX A;  5TDW A;  4FK5 A;  3JUE A;  4F52 B;  5J3X A;  4AVX A;  2ECJ A;  3O7A A;  1WIL A;  1DVP A;  3LQI A;  1X4I A;  4F1P A;  2VJF A;  4AYC B;  4YBT A;  4WZ0 A;  4YC9 A;  1WFK A;  3PLW A;  3U5P A;  2FUU A;  4YAB A;  2KFT A;  2QIZ A;  3O70 A;  1VFY A;  3KDE C;  3DQV R;  1DCQ A;  3N9M A;  3SOU A;  2EGP A;  1WIM A;  2RR4 A;  3T9K A;  3GL6 A;  5H1U A;  4XI1 A;  1VYX A;  1X4U A;  2LGL A;  3ZTG A;  2ECV A;  5KH9 A;  2YUC A;  4V3K C;  2MD7 B;  2KWO A;  2XOZ A;  4N4F A;  2KWK A;  2ECG A;  5DKA A;  4IC2 A;  3T7L A;  5TRB A;  1Z60 A;  4L7X A;  4WZ2 A;  5B8D A;  4L58 A;  2LGV A;  3U5M A;  2K1J A;  2LN0 A;  4B86 C;  3ZNI A;  2PNX A;  4R7E A;  3I2D A;  5G04 B;  1XWH A;  2LGG A;  2VJF B;  2XP0 A;  4O62 A;  2BAY A;  1JOC A;  3KQI A;  4LK9 A;  1G25 A;  2L5U A;  1MM2 A;  2K16 A;  5KH3 A;  1WEP A;  3DWD A;  5H9M A;  3IHP A;  2D8S A;  3O37 A;  2KGI A;  4YAT A;  2KKY A;  1X4J A;  4OGE A;  2YU4 A;  3RTR B;  2MA5 A;  4I7C A;  2VJE A;  2M3H A;  1Z2Q A;  1LDK C;  2MUM A;  3FM8 C;  5LKT A;  3O47 A;  2YQM A;  5AIT A;  2JMI A;  1WEO A;  2KWN A;  2M1R A;  3ZPV 1;  4YAD A;  5B79 A;  2LGK A;  1Z6U A;  2XOC A;  2LRI C;  3QZV A;  4GNF A;  1BOR A;  3KV6 A;  4Z0R A;  2FSA A;  2ECI A;  3PUQ A;  5FB0 A;  2UZG A;  3N9P A;  5LKU A;  4GNE A;  1HYJ A;  3MHS A;  5G05 B;  2EGM A;  5FB1 A;  1HYI A;  3PHD A;  1WEU A;  3LRQ A;  1JM7 B;  4AUQ B;  2NAA A;  4O64 A;  2FD4 A;  2MIQ A;  4WA6 A;  3H7H A;  2RSD A;  2KGG A;  5SVI B;  4GND A;  2CSZ A;  2L75 A;  3V43 A;  3GV4 A;  3FAO A;  2K4D A;  2D8U A;  4X3G A;  5B76 A;  2VJE B;  2MT5 A;  2JMJ A;  4ZQL A;  1RMD A;  2G6Q A;  4AP4 A;  1WEV A;  3HCU A;  1U6G B;  2LXP C;  1LDJ B;  4UP0 A;  3U5O A;  2OWA A;  3N9L A;  5H1V A;  2CRR A;  3T6R A;  2PUY A;  3FEH A;  4Z0O A;  4GNG A;  5LKX A;  2IQJ A;  2L43 A;  1E4U A;  1WES A;  3MHH A;  5TAB A;  3HTK C;  3L1X A;  5DIN A;  2EXU A;  4FJC A;  2JRJ A;  3FAN A;  3M63 A;  1WE9 A;  2CT2 A;  4I7B A;  2H0D A;  2I50 A;  3O34 A;  4UI9 B;  4FO9 A;  2F6J A;  3E2D A;  2MNZ A;  4MVT A;  4UP5 A;  3C6W A;  4A4B A;  2VP7 A;  2M85 A;  3U5N A;  5K3Q A;  4FIP A;  5JG6 A;  5LKZ A;  1JM7 A;  2LV9 A;  3RPG B;  2HYE D;  2LDR A;  4QF2 A;  2RI7 A;  2QIC A;  3L11 A;  2C2V S;  5SVI A;  2YW8 A;  2L7P A;  2Y43 A;  2QJ0 A;  1WEM A;  3KNV A;  4PTB A;  2YUR A;  3HCS A;  4GB0 A;  2CON A;  4C9Z A;  2ECN A;  2YVR A;  2C2L A;  3DDT A;  3ZYQ A;  4ZUX U;  3M62 A;  3PUR A;  2AN6 A;  1FP0 A;  4PPE A;  2KRE A;  2DSM A;  3O35 A;  4YBS A;  2ECW A;  3M99 A;  3N9O A;  2H0D B;  3ZVY A;  2ZET C;  3EB5 A;  3RPG C;  1MM3 A;  2L0B A;  2VPG A;  4BBQ A;  5D1K B;  3HCT A;  2M13 A;  5B78 A;  2YQL A;  4S3O B;  4LLB A;  5LCW B;  2MNY A;  4QQ4 A;  2MA6 A;  2VNF A;  2KIZ A;  5C13 A;  4H9D A;  4N3W A;  3FJU B;  4QF3 A;  3ASL A;  3N9Q A;  2LXH C;  3NG2 A;  3SOX A;  3DPL R;  5B77 A;  2G43 A;  2KKX A;  2CSV A;  2CKL A;  4OGC A;  2OXQ C;  4I7D A;  4NN2 A;  1VD4 A;  3KV5 A;  4A4C A;  5TDR A;  5EYA F;  5SVY A;  1F62 A;  2LAU A;  3LJU X;  2JM3 A;  4LKA A;  2VPB A;  1WEW A;  2YHO A;  1WGM A;  2K17 A;  3SHB A;  3O33 A;  4S3O C;  4IC3 A;  2DJA A;  4WZ3 B;  1V87 A;  3LQJ A;  5AIU A;  5H1T A;  4YBM A;  4YAX A;  3EB6 A;  4LJN A;  5D1L B;  2IDA A;  2YRE A;  2HDP A;  4CCG X;  2XB1 A;  1FBV A;  3O36 A;  2MKE A;  3ZPV E;  2B0O E;  2DX8 A;  3LVR E;  1WEQ A;  4R2Y A;  4LAD B;  2E61 A;  2Y1M A;  5TBN A;  2VPE A;  2CSY A;  2YT5 A;  2YSM A;  4W4U A;  3C5K A;  2KWJ A;  1ZBD B;  4BHW A;  4R8P K;  1CHC A;  2YYR A;  4CA1 A;  2CRW A;  2LQ6 A;  2KR4 A;  5I3L A;  2YHN A;  2CKL B;  2P57 A;  5B75 A;  4Q6F A;  2VPD A;  5KH7 A;  2XOY A;  2E6R A;  3LQH A;  4P5O B;  2F6N A;  4A0C D;  3FL2 A;  4AYC A;  1MBM A;  1IYM A;  3M7K A;  2KE1 A;  2JMD A;  2XEU A;  3VK6 A;  1N87 A;  2FUI A;  4ZDT A;  3SUB A;  2Y1N A;  1K2F A;  3LDY A;  2M6M A;  4MSX A;  2L80 A;  2MD8 C;  3Q1D A;  5FEY A;  4V3L C;  1WEE A;  5G0F A;  5FER A;  4TKP B;  2E6S A;  2G45 A;  3SOW A;  2YSJ A;  2FFW A;  5C11 A;  1WEN A;  2EA6 A;  3L1Z B;  4A49 A;  2EOD A;  2F42 A;  3MDB C;  2ECT A;  3LVQ E;  2JUN A;  3N9N A;  3ZVZ B;  2KYU A;  5D1M B;  4B7Y C;  2KU3 A;  1T1H A; 
#chains in the Genus database with same CATH homology
 5TDW A;  4FK5 A;  4F52 B;  5J3X A;  4AVX A;  2ECJ A;  3O7A A;  1WIL A;  1DVP A;  3LQI A;  1X4I A;  2VJF A;  4AYC B;  4YBT A;  4WZ0 A;  4YC9 A;  1WFK A;  3U5P A;  2FUU A;  4YAB A;  2KFT A;  2QIZ A;  3O70 A;  1VFY A;  3DQV R;  3N9M A;  3SOU A;  2EGP A;  1WIM A;  3GL6 A;  5H1U A;  4XI1 A;  1VYX A;  1X4U A;  2LGL A;  3ZTG A;  2ECV A;  5KH9 A;  2YUC A;  4V3K C;  2MD7 B;  2KWO A;  4N4F A;  2KWK A;  2ECG A;  5DKA A;  4IC2 A;  3T7L A;  5TRB A;  1Z60 A;  4L7X A;  4WZ2 A;  5B8D A;  4L58 A;  2LGV A;  3U5M A;  2K1J A;  2LN0 A;  4B86 C;  3ZNI A;  2PNX A;  4R7E A;  3I2D A;  5G04 B;  1XWH A;  2LGG A;  2VJF B;  2BAY A;  1JOC A;  3KQI A;  4LK9 A;  1G25 A;  2L5U A;  1MM2 A;  2K16 A;  5KH3 A;  1WEP A;  5H9M A;  3IHP A;  2D8S A;  3O37 A;  2KGI A;  4YAT A;  1X4J A;  2YU4 A;  3RTR B;  2MA5 A;  4I7C A;  2VJE A;  2M3H A;  1Z2Q A;  1LDK C;  2MUM A;  5LKT A;  2YQM A;  5AIT A;  2JMI A;  1WEO A;  2KWN A;  2M1R A;  3ZPV 1;  4YAD A;  5B79 A;  2LGK A;  1Z6U A;  3QZV A;  2LRI C;  4GNF A;  1BOR A;  3KV6 A;  2FSA A;  2ECI A;  3PUQ A;  5FB0 A;  2UZG A;  3N9P A;  5LKU A;  4GNE A;  1HYJ A;  3MHS A;  5G05 B;  5FB1 A;  1HYI A;  3PHD A;  1WEU A;  3LRQ A;  1JM7 B;  4AUQ B;  2NAA A;  4O64 A;  2MIQ A;  4WA6 A;  2RSD A;  2KGG A;  4GND A;  2CSZ A;  2L75 A;  3V43 A;  3GV4 A;  2K4D A;  4X3G A;  5B76 A;  2VJE B;  2MT5 A;  2JMJ A;  4ZQL A;  1RMD A;  2G6Q A;  4AP4 A;  1WEV A;  3HCU A;  1U6G B;  2LXP C;  1LDJ B;  4UP0 A;  3U5O A;  3N9L A;  5H1V A;  3T6R A;  2PUY A;  4GNG A;  5LKX A;  2L43 A;  1E4U A;  1WES A;  3MHH A;  5TAB A;  3HTK C;  3L1X A;  5DIN A;  4FJC A;  2JRJ A;  3M63 A;  1WE9 A;  2CT2 A;  4I7B A;  2H0D A;  2I50 A;  3O34 A;  4UI9 B;  4FO9 A;  2F6J A;  2MNZ A;  4MVT A;  4UP5 A;  3C6W A;  4A4B A;  2VP7 A;  2M85 A;  3U5N A;  4FIP A;  5JG6 A;  5LKZ A;  1JM7 A;  2LV9 A;  3RPG B;  2HYE D;  2LDR A;  4QF2 A;  2RI7 A;  2QIC A;  3L11 A;  2C2V S;  2YW8 A;  2Y43 A;  2QJ0 A;  1WEM A;  3KNV A;  4PTB A;  2YUR A;  3HCS A;  4GB0 A;  4C9Z A;  2ECN A;  2C2L A;  3ZYQ A;  4ZUX U;  3M62 A;  3PUR A;  2AN6 A;  1FP0 A;  4PPE A;  2KRE A;  3O35 A;  4YBS A;  2ECW A;  3M99 A;  3N9O A;  2H0D B;  3ZVY A;  2ZET C;  3EB5 A;  3RPG C;  1MM3 A;  2L0B A;  2VPG A;  4BBQ A;  5D1K B;  3HCT A;  5B78 A;  2YQL A;  4S3O B;  4LLB A;  5LCW B;  2MNY A;  2MA6 A;  2VNF A;  2KIZ A;  5C13 A;  4N3W A;  4QF3 A;  3ASL A;  3N9Q A;  2LXH C;  3NG2 A;  3SOX A;  3DPL R;  5B77 A;  2G43 A;  2CKL A;  2OXQ C;  4I7D A;  4NN2 A;  1VD4 A;  3KV5 A;  4A4C A;  5TDR A;  5EYA F;  1F62 A;  4LKA A;  2VPB A;  1WEW A;  2YHO A;  1WGM A;  2K17 A;  3SHB A;  3O33 A;  4S3O C;  4IC3 A;  4WZ3 B;  1V87 A;  3LQJ A;  5AIU A;  5H1T A;  4YBM A;  4YAX A;  3EB6 A;  4LJN A;  5D1L B;  2IDA A;  2YRE A;  2HDP A;  4CCG X;  2XB1 A;  1FBV A;  3O36 A;  3ZPV E;  2DX8 A;  1WEQ A;  4R2Y A;  4LAD B;  2Y1M A;  5TBN A;  2VPE A;  2CSY A;  2YT5 A;  2YSM A;  4W4U A;  3C5K A;  2KWJ A;  1ZBD B;  4BHW A;  4R8P K;  1CHC A;  2YYR A;  4CA1 A;  2LQ6 A;  2KR4 A;  5I3L A;  2YHN A;  2CKL B;  5B75 A;  4Q6F A;  2VPD A;  5KH7 A;  2E6R A;  3LQH A;  4P5O B;  2F6N A;  4A0C D;  3FL2 A;  4AYC A;  1IYM A;  2KE1 A;  2JMD A;  2XEU A;  3VK6 A;  1N87 A;  2FUI A;  4ZDT A;  2Y1N A;  1K2F A;  2M6M A;  4MSX A;  2L80 A;  2MD8 C;  5FEY A;  4V3L C;  1WEE A;  5G0F A;  5FER A;  4TKP B;  2E6S A;  2G45 A;  3SOW A;  2YSJ A;  5C11 A;  1WEN A;  2EA6 A;  3L1Z B;  4A49 A;  2EOD A;  2F42 A;  2ECT A;  3N9N A;  3ZVZ B;  2KYU A;  5D1M B;  4B7Y C;  2KU3 A;  1T1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...