2MA6A

Solution nmr structure of the ring finger domain from the kip1 ubiquitination-promoting e3 complex protein 1 (kpc1/rnf123) from homo sapiens, northeast structural genomics consortium (nesg) target hr8700a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
b'SHMPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF123
publication title Solution NMR Structure of the RING finger domain from the Kip1 ubiquitination-promoting E3 complex protein 1 (KPC1/RNF123) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8700A
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 61
sequence length 61
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ma6A00
4I7DA 1LDJB 3U5OA 1HYJA 1WESA 1WFKA 2OXQC 2VPGA 2MT5A 4L7XA 5KH9A 4C9ZA 1WIMA 3RPGC 3O37A 4YBMA 4LJNA 3C6WA 3ZVZB 1WILA 4AYCB 3O35A 5EYAF 4AP4A 4XI1A 3M63A 3ASLA 2YYRA 1WEMA 2CKLB 5TRBA 3SOXA 4FJCA 2LV9A 2F6NA 3PUQA 1RMDA 2JMJA 3GV4A 4IC2A 5H1UA 2YSJA 2ECJA 2KWNA 4GNDA 2MNYA 5B79A 1K2FA 1IYMA 3DQVR 4UP5A 2FUUA 5KH3A 1JM7A 1Z60A 4YATA 2C2LA 3N9QA 2PUYA 4GNFA 1WEUA 2L0BA 2RI7A 4FIPA 4WA6A 4R7EA 5B78A 5LCWB 5J3XA 1CHCA 2KE1A 5DINA 2K4DA 2L43A 4UP0A 2L75A 5G0FA 3HCSA 2I50A 4A4CA 3HCUA 3LQIA 4YADA 1E4UA 2VPBA 4S3OB 3FL2A 4QF3A 3RTRB 4YABA 4CCGX 2VNFA 2UZGA 2YHOA 2KWKA 2KWJA 1JM7B 2KGIA 4GNEA 4LADB 3N9PA 3EB6A 4BHWA 4NN2A 3N9OA 2LGLA 3U5MA 2G45A 2F6JA 2KIZA 5B77A 1BORA 4WZ3B 2BAYA 2NAAA 2XEUA 4B86C 1FP0A 3N9MA 1VD4A 2F42A 4A0CD 2YSMA 4Q6FA 5B8DA 2YU4A 3ZTGA 4I7BA 2VJFA 3IHPA 2QIZA 2ECVA 4B7YC 3O33A 2DX8A 2H0DB 3T6RA 2M1RA 4GB0A 2E6RA 2EODA 4N3WA 2HYED 3VK6A 2C2VS 3O7AA 5LKUA 4L58A 2KYUA 3RPGB 2MA5A 1WEEA 2EA6A 3U5NA 2CSYA 2M85A 3ZNIA 3I2DA 3SOWA 4MVTA 4A49A 5B76A 3HTKC 4PTBA 5FB0A 2KFTA 4QF2A 3MHHA 3N9NA 5H1VA 2VP7A 2VJFB 1U6GB 2D8SA 3V43A 4TKPB 5LKZA 5LKTA 4P5OB 2YQLA 3KQIA 3LRQA 4S3OC 5H1TA 2CT2A 2ZETC 4FO9A 2YHNA 4PPEA 2YQMA 2M6MA 2KU3A 1T1HA 2L80A 2LGKA 2AN6A 2XB1A 3EB5A 3SOUA 3PURA 1HYIA 1WEQA 4AUQB 1FBVA 1Z6UA 5TDWA 1VYXA 3NG2A 2Y43A 2JMIA 4I7CA 2K16A 3T7LA 1V87A 4BBQA 4WZ0A 2VPEA 2VJEA 4YBTA 4YBSA 5D1KB 2K17A 5C11A 3SHBA 1MM3A 2ECWA 2MD7B 5FB1A 2VPDA 3KNVA 2MIQA 2ECTA 5LKXA 2KREA 1WEWA 2JMDA 1DVPA 4R2YA 4V3KC 2HDPA 4ZDTA 2ECGA 2K1JA 2LXHC 2FUIA 3ZYQA 5TBNA 4V3LC 1WEPA 2FSAA 2ECNA 5FERA 2EGPA 4MSXA 2KR4A 4GNGA 4CA1A 2IDAA 4F52B 2VJEB 2ECIA 4UI9B 3M62A 1F62A 5AITA 5D1LB 3ZPV1 1JOCA 1X4UA 3C5KA 5D1MB 3U5PA 4LK9A 1WE9A 2YW8A 2YT5A 4O64A 1G25A 2LXPC 2LN0A 1N87A 2E6SA 1X4JA 1WENA 4N4FA 2CSZA 3N9LA 3ZPVE 2YUCA 4IC3A 4FK5A 2YREA 1XWHA 2KWOA 3LQHA 4WZ2A 1WEVA 5DKAA 2M3HA 4X3GA 3ZVYA 5C13A 4LKAA 3L1XA 1ZBDB 5I3LA 3KV5A 5TDRA 3MHSA 4LLBA 2QJ0A 2KGGA 3L1ZB 5TABA 3KV6A 2JRJA 3M99A 3O34A 4ZUXU 3O36A 5G05B 2LGVA 4R8PK 1VFYA 4YAXA 5AIUA 2QICA 2LDRA 3LQJA 2MNZA 3L11A 2Y1NA 3PHDA 3GL6A 3DPLR 5FEYA 2YURA 2MD8C 2Y1MA 2LQ6A 1MM2A 4W4UA 5JG6A 2PNXA 5H9MA 4AVXA 1Z2QA 1WGMA 2MUMA 2MA6A 5G04B 3QZVA 4A4BA 4ZQLA 2RSDA 1X4IA 2LGGA 1LDKC 4AYCA 2G6QA 5B75A 5KH7A 2H0DA 4YC9A 2L5UA 2G43A 2CKLA 3O70A 2LRIC 1WEOA 3HCTA
chains in the Genus database with same CATH superfamily
4I7DA 1LDJB 3U5OA 1HYJA 1WESA 1WFKA 2OXQC 2VPGA 2MT5A 4L7XA 5KH9A 4C9ZA 1WIMA 3RPGC 3O37A 4YBMA 4LJNA 3C6WA 3ZVZB 1WILA 4AYCB 3O35A 5EYAF 2CONA 4AP4A 4XI1A 3M63A 3ASLA 2YYRA 1WEMA 2CKLB 5TRBA 3SOXA 4FJCA 2LV9A 2F6NA 3PUQA 1RMDA 2JMJA 3GV4A 3LJUX 2KKYA 4IC2A 5H1UA 2YSJA 2ECJA 2KWNA 4GNDA 2MNYA 5B79A 1K2FA 1IYMA 3FAOA 3DQVR 4UP5A 2FUUA 5KH3A 2IQJA 1JM7A 5SVYA 1Z60A 4YATA 2C2LA 3N9QA 2PUYA 4GNFA 1WEUA 2L0BA 2RI7A 4FIPA 1MBMA 4WA6A 4R7EA 5B78A 5LCWB 5J3XA 1CHCA 2KE1A 5DINA 2K4DA 2L43A 3FANA 4UP0A 2L75A 3FEHA 3LDYA 5G0FA 2LAUA 3HCSA 2I50A 2CSVA 4A4CA 3HCUA 2OWAA 3LQIA 4YADA 2XOCA 1E4UA 2VPBA 4S3OB 3FL2A 4QF3A 3RTRB 4YABA 4H9DA 4CCGX 2VNFA 2UZGA 2YHOA 2KWKA 2KWJA 1JM7B 2KGIA 4GNEA 4LADB 3N9PA 3EB6A 4Z0OA 4BHWA 4NN2A 3N9OA 2LGLA 2JM3A 3U5MA 2FFWA 3JUEA 3FM8C 2G45A 2F6JA 2KIZA 5B77A 1BORA 2EGMA 4WZ3B 2BAYA 2NAAA 2XEUA 4B86C 1FP0A 3N9MA 1VD4A 2F42A 2CRRA 4A0CD 3DWDA 2YSMA 4Q6FA 2L7PA 5B8DA 2YU4A 3ZTGA 3MDBC 4I7BA 2VJFA 3IHPA 2QIZA 2ECVA 4B7YC 2RR4A 3O33A 2DX8A 2H0DB 3Q1DA 3T6RA 2M1RA 4GB0A 2E6RA 2XOYA 2EODA 4N3WA 2HYED 3VK6A 2C2VS 3O7AA 5LKUA 4L58A 2KYUA 3RPGB 2MA5A 1WEEA 3O47A 2EA6A 4O62A 3U5NA 2CSYA 2M85A 3ZNIA 3I2DA 3SOWA 4MVTA 4A49A 5B76A 3HTKC 4PTBA 5FB0A 2KFTA 4QF2A 3MHHA 3N9NA 3LVRE 2VP7A 2VJFB 1U6GB 5H1VA 2D8SA 3V43A 2KKXA 4TKPB 5LKZA 2B0OE 5LKTA 4P5OB 2YQLA 3KQIA 3LVQE 3LRQA 3KDEC 3T9KA 5SVXA 4S3OC 5H1TA 2CT2A 2ZETC 4FO9A 2YHNA 4PPEA 2YQMA 2M6MA 3E2DA 2KU3A 1T1HA 2L80A 2LGKA 2XOZA 3M7KA 2AN6A 2XB1A 2JUNA 2M13A 3EB5A 3SOUA 3PURA 1HYIA 1WEQA 4AUQB 1FBVA 1Z6UA 5TDWA 1VYXA 3NG2A 2Y43A 2JMIA 4I7CA 2CRWA 2K16A 3T7LA 1V87A 4BBQA 4OGCA 2D8UA 4WZ0A 5K3QA 2VPEA 2VJEA 4YBTA 4YBSA 5D1KB 2K17A 5C11A 3SHBA 1MM3A 2ECWA 2MD7B 3H7HA 5FB1A 3PLWA 4Z0RA 2VPDA 3KNVA 2MIQA 2ECTA 5LKXA 2KREA 3FJUB 1WEWA 2JMDA 1DVPA 4R2YA 4V3KC 2HDPA 4ZDTA 2ECGA 2K1JA 2LXHC 2FUIA 3ZYQA 5TBNA 3SUBA 4V3LC 1WEPA 2FSAA 2ECNA 2E61A 5FERA 2EGPA 4MSXA 2KR4A 4GNGA 4CA1A 2IDAA 4F52B 4OGEA 2VJEB 2XP0A 2ECIA 4UI9B 3M62A 1F62A 5AITA 2DSMA 5D1LB 3ZPV1 1JOCA 1X4UA 3C5KA 5SVIA 5D1MB 3U5PA 4LK9A 1WE9A 2YW8A 2P57A 2YT5A 4O64A 1G25A 2LXPC 2LN0A 1N87A 2E6SA 1X4JA 1WENA 4N4FA 2CSZA 4F1PA 3N9LA 3ZPVE 2YUCA 4IC3A 4FK5A 2YREA 1XWHA 2KWOA 3LQHA 4WZ2A 1WEVA 5DKAA 2M3HA 4X3GA 3ZVYA 5C13A 4LKAA 3L1XA 1ZBDB 5I3LA 3KV5A 5TDRA 3MHSA 5SVIB 4LLBA 2QJ0A 2KGGA 3L1ZB 5TABA 3KV6A 2JRJA 3M99A 3O34A 2EXUA 4ZUXU 3O36A 5G05B 4QQ4A 2LGVA 4R8PK 1VFYA 4YAXA 5AIUA 2QICA 2MKEA 2LDRA 2FD4A 3LQJA 2MNZA 3L11A 2Y1NA 3PHDA 3GL6A 3DPLR 5FEYA 2YURA 2Y1MA 2MD8C 2LQ6A 1MM2A 4W4UA 5JG6A 2PNXA 5H9MA 4AVXA 1Z2QA 1WGMA 2MUMA 2MA6A 5G04B 3QZVA 4A4BA 4ZQLA 2RSDA 1X4IA 2LGGA 1LDKC 3DDTA 2YVRA 4AYCA 2G6QA 5B75A 5KH7A 2H0DA 4YC9A 2L5UA 2DJAA 2G43A 2CKLA 3O70A 2LRIC 1WEOA 1DCQA 3HCTA
chains in the Genus database with same CATH topology
4I7DA 1LDJB 3U5OA 1HYJA 1WESA 1WFKA 2OXQC 2VPGA 2MT5A 4L7XA 5KH9A 4C9ZA 1WIMA 3RPGC 3O37A 4YBMA 4LJNA 3C6WA 3ZVZB 1WILA 4AYCB 3O35A 5EYAF 4AP4A 4XI1A 3M63A 3ASLA 2YYRA 1WEMA 2CKLB 5TRBA 3SOXA 4FJCA 2LV9A 2F6NA 3PUQA 1RMDA 2JMJA 3GV4A 4IC2A 5H1UA 2YSJA 2ECJA 2KWNA 4GNDA 2MNYA 5B79A 1K2FA 1IYMA 3DQVR 4UP5A 2FUUA 5KH3A 1JM7A 1Z60A 4YATA 2C2LA 3N9QA 2PUYA 4GNFA 1WEUA 2L0BA 2RI7A 4FIPA 4WA6A 4R7EA 5B78A 5LCWB 5J3XA 1CHCA 2KE1A 5DINA 2K4DA 2L43A 4UP0A 2L75A 5G0FA 3HCSA 2I50A 4A4CA 3HCUA 3LQIA 4YADA 1E4UA 2VPBA 4S3OB 3FL2A 4QF3A 3RTRB 4YABA 4CCGX 2VNFA 2UZGA 2YHOA 2KWKA 2KWJA 1JM7B 2KGIA 4GNEA 4LADB 3N9PA 3EB6A 4BHWA 4NN2A 3N9OA 2LGLA 3U5MA 2G45A 2F6JA 2KIZA 5B77A 1BORA 4WZ3B 2BAYA 2NAAA 2XEUA 4B86C 1FP0A 3N9MA 1VD4A 2F42A 4A0CD 2YSMA 4Q6FA 5B8DA 2YU4A 3ZTGA 4I7BA 2VJFA 3IHPA 2QIZA 2ECVA 4B7YC 3O33A 2DX8A 2H0DB 3T6RA 2M1RA 4GB0A 2E6RA 2EODA 4N3WA 2HYED 3VK6A 2C2VS 3O7AA 5LKUA 4L58A 2KYUA 3RPGB 2MA5A 1WEEA 2EA6A 3U5NA 2CSYA 2M85A 3ZNIA 3I2DA 3SOWA 4MVTA 4A49A 5B76A 3HTKC 4PTBA 5FB0A 2KFTA 4QF2A 3MHHA 3N9NA 5H1VA 2VP7A 2VJFB 1U6GB 2D8SA 3V43A 4TKPB 5LKZA 5LKTA 4P5OB 2YQLA 3KQIA 3LRQA 4S3OC 5H1TA 2CT2A 2ZETC 4FO9A 2YHNA 4PPEA 2YQMA 2M6MA 2KU3A 1T1HA 2L80A 2LGKA 2AN6A 2XB1A 3EB5A 3SOUA 3PURA 1HYIA 1WEQA 4AUQB 1FBVA 1Z6UA 5TDWA 1VYXA 3NG2A 2Y43A 2JMIA 4I7CA 2K16A 3T7LA 1V87A 4BBQA 4WZ0A 2VPEA 2VJEA 4YBTA 4YBSA 5D1KB 2K17A 5C11A 3SHBA 1MM3A 2ECWA 2MD7B 5FB1A 2VPDA 3KNVA 2MIQA 2ECTA 5LKXA 2KREA 1WEWA 2JMDA 1DVPA 4R2YA 4V3KC 2HDPA 4ZDTA 2ECGA 2K1JA 2LXHC 2FUIA 3ZYQA 5TBNA 4V3LC 1WEPA 2FSAA 2ECNA 5FERA 2EGPA 4MSXA 2KR4A 4GNGA 4CA1A 2IDAA 4F52B 2VJEB 2ECIA 4UI9B 3M62A 1F62A 5AITA 5D1LB 3ZPV1 1JOCA 1X4UA 3C5KA 5D1MB 3U5PA 4LK9A 1WE9A 2YW8A 2YT5A 4O64A 1G25A 2LXPC 2LN0A 1N87A 2E6SA 1X4JA 1WENA 4N4FA 2CSZA 3N9LA 3ZPVE 2YUCA 4IC3A 4FK5A 2YREA 1XWHA 2KWOA 3LQHA 4WZ2A 1WEVA 5DKAA 2M3HA 4X3GA 3ZVYA 5C13A 4LKAA 3L1XA 1ZBDB 5I3LA 3KV5A 5TDRA 3MHSA 4LLBA 2QJ0A 2KGGA 3L1ZB 5TABA 3KV6A 2JRJA 3M99A 3O34A 4ZUXU 3O36A 5G05B 2LGVA 4R8PK 1VFYA 4YAXA 5AIUA 2QICA 2LDRA 3LQJA 2MNZA 3L11A 2Y1NA 3PHDA 3GL6A 3DPLR 5FEYA 2YURA 2MD8C 2Y1MA 2LQ6A 1MM2A 4W4UA 5JG6A 2PNXA 5H9MA 4AVXA 1Z2QA 1WGMA 2MUMA 2MA6A 5G04B 3QZVA 4A4BA 4ZQLA 2RSDA 1X4IA 2LGGA 1LDKC 4AYCA 2G6QA 5B75A 5KH7A 2H0DA 4YC9A 2L5UA 2G43A 2CKLA 3O70A 2LRIC 1WEOA 3HCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7D A;  1LDJ B;  3U5O A;  1HYJ A;  1WES A;  1WFK A;  2OXQ C;  2VPG A;  2MT5 A;  4L7X A;  5KH9 A;  4C9Z A;  1WIM A;  3RPG C;  3O37 A;  4YBM A;  4LJN A;  3C6W A;  3ZVZ B;  1WIL A;  4AYC B;  3O35 A;  5EYA F;  4AP4 A;  4XI1 A;  3M63 A;  3ASL A;  2YYR A;  1WEM A;  2CKL B;  5TRB A;  3SOX A;  4FJC A;  2LV9 A;  2F6N A;  3PUQ A;  1RMD A;  2JMJ A;  3GV4 A;  4IC2 A;  5H1U A;  2YSJ A;  2ECJ A;  2KWN A;  4GND A;  2MNY A;  5B79 A;  1K2F A;  1IYM A;  3DQV R;  4UP5 A;  2FUU A;  5KH3 A;  1JM7 A;  1Z60 A;  4YAT A;  2C2L A;  3N9Q A;  2PUY A;  4GNF A;  1WEU A;  2L0B A;  2RI7 A;  4FIP A;  4WA6 A;  4R7E A;  5B78 A;  5LCW B;  5J3X A;  1CHC A;  2KE1 A;  5DIN A;  2K4D A;  2L43 A;  4UP0 A;  2L75 A;  5G0F A;  3HCS A;  2I50 A;  4A4C A;  3HCU A;  3LQI A;  4YAD A;  1E4U A;  2VPB A;  4S3O B;  3FL2 A;  4QF3 A;  3RTR B;  4YAB A;  4CCG X;  2VNF A;  2UZG A;  2YHO A;  2KWK A;  2KWJ A;  1JM7 B;  2KGI A;  4GNE A;  4LAD B;  3N9P A;  3EB6 A;  4BHW A;  4NN2 A;  3N9O A;  2LGL A;  3U5M A;  2G45 A;  2F6J A;  2KIZ A;  5B77 A;  1BOR A;  4WZ3 B;  2BAY A;  2NAA A;  2XEU A;  4B86 C;  1FP0 A;  3N9M A;  1VD4 A;  2F42 A;  4A0C D;  2YSM A;  4Q6F A;  5B8D A;  2YU4 A;  3ZTG A;  4I7B A;  2VJF A;  3IHP A;  2QIZ A;  2ECV A;  4B7Y C;  3O33 A;  2DX8 A;  2H0D B;  3T6R A;  2M1R A;  4GB0 A;  2E6R A;  2EOD A;  4N3W A;  2HYE D;  3VK6 A;  2C2V S;  3O7A A;  5LKU A;  4L58 A;  2KYU A;  3RPG B;  2MA5 A;  1WEE A;  2EA6 A;  3U5N A;  2CSY A;  2M85 A;  3ZNI A;  3I2D A;  3SOW A;  4MVT A;  4A49 A;  5B76 A;  3HTK C;  4PTB A;  5FB0 A;  2KFT A;  4QF2 A;  3MHH A;  3N9N A;  5H1V A;  2VP7 A;  2VJF B;  1U6G B;  2D8S A;  3V43 A;  4TKP B;  5LKZ A;  5LKT A;  4P5O B;  2YQL A;  3KQI A;  3LRQ A;  4S3O C;  5H1T A;  2CT2 A;  2ZET C;  4FO9 A;  2YHN A;  4PPE A;  2YQM A;  2M6M A;  2KU3 A;  1T1H A;  2L80 A;  2LGK A;  2AN6 A;  2XB1 A;  3EB5 A;  3SOU A;  3PUR A;  1HYI A;  1WEQ A;  4AUQ B;  1FBV A;  1Z6U A;  5TDW A;  1VYX A;  3NG2 A;  2Y43 A;  2JMI A;  4I7C A;  2K16 A;  3T7L A;  1V87 A;  4BBQ A;  4WZ0 A;  2VPE A;  2VJE A;  4YBT A;  4YBS A;  5D1K B;  2K17 A;  5C11 A;  3SHB A;  1MM3 A;  2ECW A;  2MD7 B;  5FB1 A;  2VPD A;  3KNV A;  2MIQ A;  2ECT A;  5LKX A;  2KRE A;  1WEW A;  2JMD A;  1DVP A;  4R2Y A;  4V3K C;  2HDP A;  4ZDT A;  2ECG A;  2K1J A;  2LXH C;  2FUI A;  3ZYQ A;  5TBN A;  4V3L C;  1WEP A;  2FSA A;  2ECN A;  5FER A;  2EGP A;  4MSX A;  2KR4 A;  4GNG A;  4CA1 A;  2IDA A;  4F52 B;  2VJE B;  2ECI A;  4UI9 B;  3M62 A;  1F62 A;  5AIT A;  5D1L B;  3ZPV 1;  1JOC A;  1X4U A;  3C5K A;  5D1M B;  3U5P A;  4LK9 A;  1WE9 A;  2YW8 A;  2YT5 A;  4O64 A;  1G25 A;  2LXP C;  2LN0 A;  1N87 A;  2E6S A;  1X4J A;  1WEN A;  4N4F A;  2CSZ A;  3N9L A;  3ZPV E;  2YUC A;  4IC3 A;  4FK5 A;  2YRE A;  1XWH A;  2KWO A;  3LQH A;  4WZ2 A;  1WEV A;  5DKA A;  2M3H A;  4X3G A;  3ZVY A;  5C13 A;  4LKA A;  3L1X A;  1ZBD B;  5I3L A;  3KV5 A;  5TDR A;  3MHS A;  4LLB A;  2QJ0 A;  2KGG A;  3L1Z B;  5TAB A;  3KV6 A;  2JRJ A;  3M99 A;  3O34 A;  4ZUX U;  3O36 A;  5G05 B;  2LGV A;  4R8P K;  1VFY A;  4YAX A;  5AIU A;  2QIC A;  2LDR A;  3LQJ A;  2MNZ A;  3L11 A;  2Y1N A;  3PHD A;  3GL6 A;  3DPL R;  5FEY A;  2YUR A;  2MD8 C;  2Y1M A;  2LQ6 A;  1MM2 A;  4W4U A;  5JG6 A;  2PNX A;  5H9M A;  4AVX A;  1Z2Q A;  1WGM A;  2MUM A;  2MA6 A;  5G04 B;  3QZV A;  4A4B A;  4ZQL A;  2RSD A;  1X4I A;  2LGG A;  1LDK C;  4AYC A;  2G6Q A;  5B75 A;  5KH7 A;  2H0D A;  4YC9 A;  2L5U A;  2G43 A;  2CKL A;  3O70 A;  2LRI C;  1WEO A;  3HCT A; 
#chains in the Genus database with same CATH topology
 4I7D A;  1LDJ B;  3U5O A;  1HYJ A;  1WES A;  1WFK A;  2OXQ C;  2VPG A;  2MT5 A;  4L7X A;  5KH9 A;  4C9Z A;  1WIM A;  3RPG C;  3O37 A;  4YBM A;  4LJN A;  3C6W A;  3ZVZ B;  1WIL A;  4AYC B;  3O35 A;  5EYA F;  2CON A;  4AP4 A;  4XI1 A;  3M63 A;  3ASL A;  2YYR A;  1WEM A;  2CKL B;  5TRB A;  3SOX A;  4FJC A;  2LV9 A;  2F6N A;  3PUQ A;  1RMD A;  2JMJ A;  3GV4 A;  3LJU X;  2KKY A;  4IC2 A;  5H1U A;  2YSJ A;  2ECJ A;  2KWN A;  4GND A;  2MNY A;  5B79 A;  1K2F A;  1IYM A;  3FAO A;  3DQV R;  4UP5 A;  2FUU A;  5KH3 A;  2IQJ A;  1JM7 A;  5SVY A;  1Z60 A;  4YAT A;  2C2L A;  3N9Q A;  2PUY A;  4GNF A;  1WEU A;  2L0B A;  2RI7 A;  4FIP A;  1MBM A;  4WA6 A;  4R7E A;  5B78 A;  5LCW B;  5J3X A;  1CHC A;  2KE1 A;  5DIN A;  2K4D A;  2L43 A;  3FAN A;  4UP0 A;  2L75 A;  3FEH A;  3LDY A;  5G0F A;  2LAU A;  3HCS A;  2I50 A;  2CSV A;  4A4C A;  3HCU A;  2OWA A;  3LQI A;  4YAD A;  2XOC A;  1E4U A;  2VPB A;  4S3O B;  3FL2 A;  4QF3 A;  3RTR B;  4YAB A;  4H9D A;  4CCG X;  2VNF A;  2UZG A;  2YHO A;  2KWK A;  2KWJ A;  1JM7 B;  2KGI A;  4GNE A;  4LAD B;  3N9P A;  3EB6 A;  4Z0O A;  4BHW A;  4NN2 A;  3N9O A;  2LGL A;  2JM3 A;  3U5M A;  2FFW A;  3JUE A;  3FM8 C;  2G45 A;  2F6J A;  2KIZ A;  5B77 A;  1BOR A;  2EGM A;  4WZ3 B;  2BAY A;  2NAA A;  2XEU A;  4B86 C;  1FP0 A;  3N9M A;  1VD4 A;  2F42 A;  2CRR A;  4A0C D;  3DWD A;  2YSM A;  4Q6F A;  2L7P A;  5B8D A;  2YU4 A;  3ZTG A;  3MDB C;  4I7B A;  2VJF A;  3IHP A;  2QIZ A;  2ECV A;  4B7Y C;  2RR4 A;  3O33 A;  2DX8 A;  2H0D B;  3Q1D A;  3T6R A;  2M1R A;  4GB0 A;  2E6R A;  2XOY A;  2EOD A;  4N3W A;  2HYE D;  3VK6 A;  2C2V S;  3O7A A;  5LKU A;  4L58 A;  2KYU A;  3RPG B;  2MA5 A;  1WEE A;  3O47 A;  2EA6 A;  4O62 A;  3U5N A;  2CSY A;  2M85 A;  3ZNI A;  3I2D A;  3SOW A;  4MVT A;  4A49 A;  5B76 A;  3HTK C;  4PTB A;  5FB0 A;  2KFT A;  4QF2 A;  3MHH A;  3N9N A;  3LVR E;  2VP7 A;  2VJF B;  1U6G B;  5H1V A;  2D8S A;  3V43 A;  2KKX A;  4TKP B;  5LKZ A;  2B0O E;  5LKT A;  4P5O B;  2YQL A;  3KQI A;  3LVQ E;  3LRQ A;  3KDE C;  3T9K A;  5SVX A;  4S3O C;  5H1T A;  2CT2 A;  2ZET C;  4FO9 A;  2YHN A;  4PPE A;  2YQM A;  2M6M A;  3E2D A;  2KU3 A;  1T1H A;  2L80 A;  2LGK A;  2XOZ A;  3M7K A;  2AN6 A;  2XB1 A;  2JUN A;  2M13 A;  3EB5 A;  3SOU A;  3PUR A;  1HYI A;  1WEQ A;  4AUQ B;  1FBV A;  1Z6U A;  5TDW A;  1VYX A;  3NG2 A;  2Y43 A;  2JMI A;  4I7C A;  2CRW A;  2K16 A;  3T7L A;  1V87 A;  4BBQ A;  4OGC A;  2D8U A;  4WZ0 A;  5K3Q A;  2VPE A;  2VJE A;  4YBT A;  4YBS A;  5D1K B;  2K17 A;  5C11 A;  3SHB A;  1MM3 A;  2ECW A;  2MD7 B;  3H7H A;  5FB1 A;  3PLW A;  4Z0R A;  2VPD A;  3KNV A;  2MIQ A;  2ECT A;  5LKX A;  2KRE A;  3FJU B;  1WEW A;  2JMD A;  1DVP A;  4R2Y A;  4V3K C;  2HDP A;  4ZDT A;  2ECG A;  2K1J A;  2LXH C;  2FUI A;  3ZYQ A;  5TBN A;  3SUB A;  4V3L C;  1WEP A;  2FSA A;  2ECN A;  2E61 A;  5FER A;  2EGP A;  4MSX A;  2KR4 A;  4GNG A;  4CA1 A;  2IDA A;  4F52 B;  4OGE A;  2VJE B;  2XP0 A;  2ECI A;  4UI9 B;  3M62 A;  1F62 A;  5AIT A;  2DSM A;  5D1L B;  3ZPV 1;  1JOC A;  1X4U A;  3C5K A;  5SVI A;  5D1M B;  3U5P A;  4LK9 A;  1WE9 A;  2YW8 A;  2P57 A;  2YT5 A;  4O64 A;  1G25 A;  2LXP C;  2LN0 A;  1N87 A;  2E6S A;  1X4J A;  1WEN A;  4N4F A;  2CSZ A;  4F1P A;  3N9L A;  3ZPV E;  2YUC A;  4IC3 A;  4FK5 A;  2YRE A;  1XWH A;  2KWO A;  3LQH A;  4WZ2 A;  1WEV A;  5DKA A;  2M3H A;  4X3G A;  3ZVY A;  5C13 A;  4LKA A;  3L1X A;  1ZBD B;  5I3L A;  3KV5 A;  5TDR A;  3MHS A;  5SVI B;  4LLB A;  2QJ0 A;  2KGG A;  3L1Z B;  5TAB A;  3KV6 A;  2JRJ A;  3M99 A;  3O34 A;  2EXU A;  4ZUX U;  3O36 A;  5G05 B;  4QQ4 A;  2LGV A;  4R8P K;  1VFY A;  4YAX A;  5AIU A;  2QIC A;  2MKE A;  2LDR A;  2FD4 A;  3LQJ A;  2MNZ A;  3L11 A;  2Y1N A;  3PHD A;  3GL6 A;  3DPL R;  5FEY A;  2YUR A;  2Y1M A;  2MD8 C;  2LQ6 A;  1MM2 A;  4W4U A;  5JG6 A;  2PNX A;  5H9M A;  4AVX A;  1Z2Q A;  1WGM A;  2MUM A;  2MA6 A;  5G04 B;  3QZV A;  4A4B A;  4ZQL A;  2RSD A;  1X4I A;  2LGG A;  1LDK C;  3DDT A;  2YVR A;  4AYC A;  2G6Q A;  5B75 A;  5KH7 A;  2H0D A;  4YC9 A;  2L5U A;  2DJA A;  2G43 A;  2CKL A;  3O70 A;  2LRI C;  1WEO A;  1DCQ A;  3HCT A; 
#chains in the Genus database with same CATH homology
 4I7D A;  1LDJ B;  3U5O A;  1HYJ A;  1WES A;  1WFK A;  2OXQ C;  2VPG A;  2MT5 A;  4L7X A;  5KH9 A;  4C9Z A;  1WIM A;  3RPG C;  3O37 A;  4YBM A;  4LJN A;  3C6W A;  3ZVZ B;  1WIL A;  4AYC B;  3O35 A;  5EYA F;  4AP4 A;  4XI1 A;  3M63 A;  3ASL A;  2YYR A;  1WEM A;  2CKL B;  5TRB A;  3SOX A;  4FJC A;  2LV9 A;  2F6N A;  3PUQ A;  1RMD A;  2JMJ A;  3GV4 A;  4IC2 A;  5H1U A;  2YSJ A;  2ECJ A;  2KWN A;  4GND A;  2MNY A;  5B79 A;  1K2F A;  1IYM A;  3DQV R;  4UP5 A;  2FUU A;  5KH3 A;  1JM7 A;  1Z60 A;  4YAT A;  2C2L A;  3N9Q A;  2PUY A;  4GNF A;  1WEU A;  2L0B A;  2RI7 A;  4FIP A;  4WA6 A;  4R7E A;  5B78 A;  5LCW B;  5J3X A;  1CHC A;  2KE1 A;  5DIN A;  2K4D A;  2L43 A;  4UP0 A;  2L75 A;  5G0F A;  3HCS A;  2I50 A;  4A4C A;  3HCU A;  3LQI A;  4YAD A;  1E4U A;  2VPB A;  4S3O B;  3FL2 A;  4QF3 A;  3RTR B;  4YAB A;  4CCG X;  2VNF A;  2UZG A;  2YHO A;  2KWK A;  2KWJ A;  1JM7 B;  2KGI A;  4GNE A;  4LAD B;  3N9P A;  3EB6 A;  4BHW A;  4NN2 A;  3N9O A;  2LGL A;  3U5M A;  2G45 A;  2F6J A;  2KIZ A;  5B77 A;  1BOR A;  4WZ3 B;  2BAY A;  2NAA A;  2XEU A;  4B86 C;  1FP0 A;  3N9M A;  1VD4 A;  2F42 A;  4A0C D;  2YSM A;  4Q6F A;  5B8D A;  2YU4 A;  3ZTG A;  4I7B A;  2VJF A;  3IHP A;  2QIZ A;  2ECV A;  4B7Y C;  3O33 A;  2DX8 A;  2H0D B;  3T6R A;  2M1R A;  4GB0 A;  2E6R A;  2EOD A;  4N3W A;  2HYE D;  3VK6 A;  2C2V S;  3O7A A;  5LKU A;  4L58 A;  2KYU A;  3RPG B;  2MA5 A;  1WEE A;  2EA6 A;  3U5N A;  2CSY A;  2M85 A;  3ZNI A;  3I2D A;  3SOW A;  4MVT A;  4A49 A;  5B76 A;  3HTK C;  4PTB A;  5FB0 A;  2KFT A;  4QF2 A;  3MHH A;  3N9N A;  5H1V A;  2VP7 A;  2VJF B;  1U6G B;  2D8S A;  3V43 A;  4TKP B;  5LKZ A;  5LKT A;  4P5O B;  2YQL A;  3KQI A;  3LRQ A;  4S3O C;  5H1T A;  2CT2 A;  2ZET C;  4FO9 A;  2YHN A;  4PPE A;  2YQM A;  2M6M A;  2KU3 A;  1T1H A;  2L80 A;  2LGK A;  2AN6 A;  2XB1 A;  3EB5 A;  3SOU A;  3PUR A;  1HYI A;  1WEQ A;  4AUQ B;  1FBV A;  1Z6U A;  5TDW A;  1VYX A;  3NG2 A;  2Y43 A;  2JMI A;  4I7C A;  2K16 A;  3T7L A;  1V87 A;  4BBQ A;  4WZ0 A;  2VPE A;  2VJE A;  4YBT A;  4YBS A;  5D1K B;  2K17 A;  5C11 A;  3SHB A;  1MM3 A;  2ECW A;  2MD7 B;  5FB1 A;  2VPD A;  3KNV A;  2MIQ A;  2ECT A;  5LKX A;  2KRE A;  1WEW A;  2JMD A;  1DVP A;  4R2Y A;  4V3K C;  2HDP A;  4ZDT A;  2ECG A;  2K1J A;  2LXH C;  2FUI A;  3ZYQ A;  5TBN A;  4V3L C;  1WEP A;  2FSA A;  2ECN A;  5FER A;  2EGP A;  4MSX A;  2KR4 A;  4GNG A;  4CA1 A;  2IDA A;  4F52 B;  2VJE B;  2ECI A;  4UI9 B;  3M62 A;  1F62 A;  5AIT A;  5D1L B;  3ZPV 1;  1JOC A;  1X4U A;  3C5K A;  5D1M B;  3U5P A;  4LK9 A;  1WE9 A;  2YW8 A;  2YT5 A;  4O64 A;  1G25 A;  2LXP C;  2LN0 A;  1N87 A;  2E6S A;  1X4J A;  1WEN A;  4N4F A;  2CSZ A;  3N9L A;  3ZPV E;  2YUC A;  4IC3 A;  4FK5 A;  2YRE A;  1XWH A;  2KWO A;  3LQH A;  4WZ2 A;  1WEV A;  5DKA A;  2M3H A;  4X3G A;  3ZVY A;  5C13 A;  4LKA A;  3L1X A;  1ZBD B;  5I3L A;  3KV5 A;  5TDR A;  3MHS A;  4LLB A;  2QJ0 A;  2KGG A;  3L1Z B;  5TAB A;  3KV6 A;  2JRJ A;  3M99 A;  3O34 A;  4ZUX U;  3O36 A;  5G05 B;  2LGV A;  4R8P K;  1VFY A;  4YAX A;  5AIU A;  2QIC A;  2LDR A;  3LQJ A;  2MNZ A;  3L11 A;  2Y1N A;  3PHD A;  3GL6 A;  3DPL R;  5FEY A;  2YUR A;  2MD8 C;  2Y1M A;  2LQ6 A;  1MM2 A;  4W4U A;  5JG6 A;  2PNX A;  5H9M A;  4AVX A;  1Z2Q A;  1WGM A;  2MUM A;  2MA6 A;  5G04 B;  3QZV A;  4A4B A;  4ZQL A;  2RSD A;  1X4I A;  2LGG A;  1LDK C;  4AYC A;  2G6Q A;  5B75 A;  5KH7 A;  2H0D A;  4YC9 A;  2L5U A;  2G43 A;  2CKL A;  3O70 A;  2LRI C;  1WEO A;  3HCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...