2MA6A

Solution nmr structure of the ring finger domain from the kip1 ubiquitination-promoting e3 complex protein 1 (kpc1/rnf123) from homo sapiens, northeast structural genomics consortium (nesg) target hr8700a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
SHMPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of the RING finger domain from the Kip1 ubiquitination-promoting E3 complex protein 1 (KPC1/RNF123) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8700A
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF123
total genus 10
structure length 61
sequence length 61
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2ma6A00
3PHDA 2KFTA 2KWOA 2QICA 3N9PA 3T7LA 2DX8A 1XWHA 4BHWA 1E4UA 1VFYA 2E6RA 3KNVA 3U5MA 4IC2A 1V87A 1VYXA 2KGIA 2Y1MA 2FUUA 2Y1NA 4CCGX 5AITA 3RPGB 5C13A 2XEUA 1WGMA 2XB1A 1WEUA 4YBSA 1JM7B 2K16A 2LV9A 2ECVA 4QF2A 2K4DA 2Y43A 5B78A 1Z6UA 3DPLR 4MVTA 3RTRB 4YABA 3ZYQA 4V3LC 4PTBA 1WEWA 4YBMA 5JG6A 1Z2QA 4GNFA 4XI1A 5KH9A 2YREA 3C5KA 3ZVZB 2L43A 3N9MA 1MM2A 5D1MB 5G05B 3O33A 4L7XA 2IDAA 3M62A 5I3LA 3HCUA 2OXQC 5B76A 4N4FA 3FL2A 1DVPA 5G04B 3T6RA 4AYCA 2LDRA 1X4UA 3DQVR 2F42A 3IHPA 3N9QA 4LKAA 2EODA 1WEEA 4R8PK 4V3KC 3L1XA 2K17A 3LQHA 4WZ2A 1FBVA 5G0FA 2YYRA 2LGKA 2MT5A 2QJ0A 1MM3A 4AYCB 3ASLA 3SOWA 3L11A 2LGVA 5DKAA 2VPEA 5FB1A 2FSAA 2F6NA 3PUQA 4B86C 2KYUA 2KE1A 2KU3A 1FP0A 2VPGA 5H9MA 4LJNA 2JMJA 2YHOA 1F62A 3KV5A 2C2LA 2BAYA 2KIZA 3ZPVE 1RMDA 1WIMA 5TABA 5LKTA 3N9LA 4R7EA 5KH3A 4GNDA 2MNYA 2ECTA 3O37A 2LXPC 3SOXA 3LRQA 4AP4A 5B75A 5DINA 1WEMA 4FK5A 2MA6A 3ZNIA 3I2DA 2EA6A 1WILA 4ZQLA 5TDRA 1BORA 4F52B 3MHSA 2VJEA 2C2VS 4MSXA 2JRJA 2YQMA 5FERA 2LN0A 4WZ3B 2YQLA 5KH7A 4LK9A 3ZVYA 1WENA 2JMDA 5B8DA 5LKZA 1WEPA 1U6GB 2ECGA 2HDPA 2NAAA 4UI9B 2UZGA 5LKXA 3HTKC 1WEVA 4AUQB 3U5NA 3GL6A 2YURA 2RSDA 1K2FA 5LKUA 2RI7A 4WA6A 3U5OA 4YAXA 5B77A 4FJCA 5TDWA 2YHNA 2KWNA 1IYMA 3KV6A 2MNZA 2VJFA 3SOUA 4L58A 2LQ6A 2KWJA 1X4JA 2KWKA 4A4CA 4A0CD 1JOCA 2H0DA 5AIUA 4WZ0A 2I50A 2FUIA 4C9ZA 3HCTA 2YW8A 4YC9A 2HYED 2VP7A 2ECNA 2M1RA 4I7DA 3ZPV1 2ECJA 2MD8C 5H1VA 4W4UA 4B7YC 3NG2A 2JMIA 3O35A 2L5UA 3M99A 2CKLB 4A49A 4AVXA 5TBNA 4FO9A 2F6JA 5J3XA 2L75A 4GB0A 2LGLA 4UP0A 1WEOA 3SHBA 2MA5A 4QF3A 2KGGA 4X3GA 2VNFA 3U5PA 3RPGC 4TKPB 1G25A 4LADB 1LDJB 4R2YA 1T1HA 3PURA 3V43A 4N3WA 2CKLA 4I7BA 2YT5A 2LXHC 5H1UA 2EGPA 2L0BA 3O7AA 2M85A 2M6MA 2ECWA 2MD7B 5C11A 2YUCA 1Z60A 2MUMA 1WE9A 2M3HA 2MIQA 3VK6A 3L1ZB 2CSYA 5FEYA 2G43A 3O36A 3M63A 1HYIA 4BBQA 5D1LB 5EYAF 4CA1A 1CHCA 2VPBA 1VD4A 1LDKC 4YATA 2G6QA 1X4IA 3ZTGA 4S3OC 2E6SA 3EB6A 5D1KB 4YBTA 3C6WA 3MHHA 4ZUXU 2AN6A 1N87A 5TRBA 2H0DB 2CT2A 5B79A 3N9OA 5H1TA 3HCSA 2VJEB 3N9NA 2LRIC 2ZETC 4LLBA 4S3OB 4Q6FA 1HYJA 4PPEA 3O70A 2KR4A 3GV4A 2LGGA 4GNEA 2L80A 4ZDTA 1WESA 2YU4A 2ECIA 3LQIA 2YSJA 4I7CA 1WEQA 2CSZA 4FIPA 2G45A 1ZBDB 3O34A 1JM7A 2PNXA 2KREA 5FB0A 2YSMA 3KQIA 4NN2A 4P5OB 3EB5A 2K1JA 3LQJA 4YADA 2D8SA 4IC3A 5LCWB 4O64A 4A4BA 2VPDA 2QIZA 2PUYA 1WFKA 4GNGA 2VJFB 4UP5A 3QZVA
chains in the Genus database with same CATH superfamily
3PHDA 2KFTA 3Q1DA 2FD4A 2KWOA 2QICA 3N9PA 3LVQE 3T7LA 3LVRE 2DX8A 3PLWA 1XWHA 4BHWA 4OGEA 1E4UA 1VFYA 4OGCA 2E6RA 3KNVA 3U5MA 4IC2A 1V87A 1VYXA 2KGIA 2Y1MA 2FUUA 2Y1NA 4CCGX 5AITA 2OWAA 3RPGB 5C13A 2XEUA 1WGMA 2XB1A 1WEUA 4YBSA 1JM7B 2K16A 2LV9A 2ECVA 4QF2A 2K4DA 2Y43A 2XOCA 5B78A 1Z6UA 3DPLR 3JUEA 4MVTA 3RTRB 4YABA 3ZYQA 4V3LC 4PTBA 1WEWA 4YBMA 5JG6A 1Z2QA 4GNFA 4XI1A 5KH9A 2MKEA 2YREA 3C5KA 3ZVZB 2L43A 3N9MA 1MM2A 5D1MB 5G05B 3O33A 4L7XA 2IDAA 3M62A 5I3LA 3HCUA 2OXQC 5B76A 4N4FA 3FL2A 1DVPA 5G04B 3T6RA 3E2DA 4AYCA 2LDRA 2JM3A 1X4UA 3DQVR 5SVIB 2F42A 3IHPA 3N9QA 4LKAA 2EODA 1WEEA 4R8PK 4V3KC 3DDTA 3L1XA 2K17A 3LJUX 3LQHA 4WZ2A 1FBVA 5G0FA 2YYRA 2LGKA 2MT5A 2QJ0A 3T9KA 2CRWA 1MM3A 4AYCB 3ASLA 3SOWA 3L11A 2LGVA 5DKAA 2VPEA 5FB1A 2FSAA 2F6NA 3PUQA 4B86C 2CRRA 2KYUA 2KE1A 2KU3A 1FP0A 2VPGA 3FM8C 2RR4A 5H9MA 4LJNA 3M7KA 2JMJA 2YHOA 1F62A 3KV5A 2C2LA 2BAYA 2KIZA 3ZPVE 1RMDA 1WIMA 5TABA 5LKTA 3N9LA 4R7EA 5KH3A 2P57A 4GNDA 2MNYA 2ECTA 3O37A 2LXPC 2L7PA 3SOXA 3LRQA 4AP4A 5B75A 5DINA 1WEMA 4FK5A 2MA6A 2B0OE 3ZNIA 3I2DA 2EA6A 1WILA 4ZQLA 5TDRA 1BORA 4F52B 3MHSA 2VJEA 3FAOA 2C2VS 4MSXA 2JRJA 2YQMA 5FERA 2LN0A 4WZ3B 2YQLA 5KH7A 4LK9A 5SVIA 2DJAA 2EXUA 3ZVYA 1WENA 2JMDA 5B8DA 5LKZA 1WEPA 4Z0OA 1U6GB 2ECGA 2HDPA 2NAAA 4UI9B 2UZGA 5LKXA 3HTKC 1WEVA 4AUQB 3U5NA 3GL6A 2YURA 2CSVA 2RSDA 1K2FA 5LKUA 2RI7A 4WA6A 3U5OA 2XOZA 4YAXA 5B77A 4FJCA 5TDWA 2YHNA 2KWNA 1IYMA 3KV6A 2MNZA 2VJFA 4H9DA 3SOUA 4L58A 2LQ6A 2KWJA 1X4JA 2KWKA 4A4CA 4A0CD 1JOCA 2H0DA 5AIUA 4WZ0A 2I50A 2D8UA 2FUIA 4C9ZA 3HCTA 2YW8A 4YC9A 2HYED 2VP7A 2ECNA 3DWDA 2M1RA 4I7DA 3ZPV1 2ECJA 2MD8C 1DCQA 5H1VA 4W4UA 4B7YC 3NG2A 3O47A 2JMIA 3O35A 2L5UA 3M99A 2CKLB 4A49A 4AVXA 5TBNA 4FO9A 2F6JA 5J3XA 2L75A 4GB0A 2LGLA 4UP0A 1WEOA 3SHBA 2MA5A 3LDYA 3MDBC 4QF3A 2KGGA 4X3GA 2VNFA 3FEHA 3U5PA 3RPGC 5SVYA 1MBMA 4TKPB 1G25A 4LADB 4QQ4A 1LDJB 4R2YA 1T1HA 3PURA 3V43A 2FFWA 4N3WA 3KDEC 2CKLA 4I7BA 3H7HA 2YT5A 5K3QA 2LXHC 5H1UA 2EGPA 2L0BA 3O7AA 2XOYA 2M85A 2M6MA 2ECWA 2MD7B 5C11A 2LAUA 2YUCA 1Z60A 2MUMA 1WE9A 2M3HA 2MIQA 2EGMA 2YVRA 3VK6A 3L1ZB 2XP0A 2KKXA 2CSYA 5FEYA 2CONA 2M13A 2E61A 2G43A 3O36A 3M63A 1HYIA 4BBQA 4Z0RA 5D1LB 5EYAF 2JUNA 4CA1A 1CHCA 2VPBA 1VD4A 1LDKC 4YATA 2G6QA 1X4IA 3ZTGA 4S3OC 2E6SA 3EB6A 5D1KB 4YBTA 3C6WA 3MHHA 4ZUXU 2AN6A 1N87A 5TRBA 2H0DB 2CT2A 5B79A 2IQJA 3N9OA 5H1TA 3HCSA 2VJEB 3N9NA 2LRIC 2ZETC 4LLBA 4S3OB 4Q6FA 1HYJA 5SVXA 4PPEA 4O62A 3O70A 2DSMA 2KR4A 3GV4A 2LGGA 4GNEA 2L80A 4ZDTA 1WESA 2YU4A 2ECIA 3LQIA 2YSJA 4I7CA 1WEQA 2CSZA 4FIPA 2G45A 1ZBDB 3FJUB 3O34A 1JM7A 2PNXA 2KREA 5FB0A 2YSMA 3SUBA 3KQIA 4NN2A 4P5OB 2KKYA 3EB5A 2K1JA 3LQJA 4YADA 2D8SA 4IC3A 5LCWB 4O64A 4A4BA 2VPDA 2QIZA 2PUYA 1WFKA 4F1PA 4GNGA 2VJFB 4UP5A 3FANA 3QZVA
chains in the Genus database with same CATH topology
3PHDA 2KFTA 2KWOA 2QICA 3N9PA 3T7LA 2DX8A 1XWHA 4BHWA 1E4UA 1VFYA 2E6RA 3KNVA 3U5MA 4IC2A 1V87A 1VYXA 2KGIA 2Y1MA 2FUUA 2Y1NA 4CCGX 5AITA 3RPGB 5C13A 2XEUA 1WGMA 2XB1A 1WEUA 4YBSA 1JM7B 2K16A 2LV9A 2ECVA 4QF2A 2K4DA 2Y43A 5B78A 1Z6UA 3DPLR 4MVTA 3RTRB 4YABA 3ZYQA 4V3LC 4PTBA 1WEWA 4YBMA 5JG6A 1Z2QA 4GNFA 4XI1A 5KH9A 2YREA 3C5KA 3ZVZB 2L43A 3N9MA 1MM2A 5D1MB 5G05B 3O33A 4L7XA 2IDAA 3M62A 5I3LA 3HCUA 2OXQC 5B76A 4N4FA 3FL2A 1DVPA 5G04B 3T6RA 4AYCA 2LDRA 1X4UA 3DQVR 2F42A 3IHPA 3N9QA 4LKAA 2EODA 1WEEA 4R8PK 4V3KC 3L1XA 2K17A 3LQHA 4WZ2A 1FBVA 5G0FA 2YYRA 2LGKA 2MT5A 2QJ0A 1MM3A 4AYCB 3ASLA 3SOWA 3L11A 2LGVA 5DKAA 2VPEA 5FB1A 2FSAA 2F6NA 3PUQA 4B86C 2KYUA 2KE1A 2KU3A 1FP0A 2VPGA 5H9MA 4LJNA 2JMJA 2YHOA 1F62A 3KV5A 2C2LA 2BAYA 2KIZA 3ZPVE 1RMDA 1WIMA 5TABA 5LKTA 3N9LA 4R7EA 5KH3A 4GNDA 2MNYA 2ECTA 3O37A 2LXPC 3SOXA 3LRQA 4AP4A 5B75A 5DINA 1WEMA 4FK5A 2MA6A 3ZNIA 3I2DA 2EA6A 1WILA 4ZQLA 5TDRA 1BORA 4F52B 3MHSA 2VJEA 2C2VS 4MSXA 2JRJA 2YQMA 5FERA 2LN0A 4WZ3B 2YQLA 5KH7A 4LK9A 3ZVYA 1WENA 2JMDA 5B8DA 5LKZA 1WEPA 1U6GB 2ECGA 2HDPA 2NAAA 4UI9B 2UZGA 5LKXA 3HTKC 1WEVA 4AUQB 3U5NA 3GL6A 2YURA 2RSDA 1K2FA 5LKUA 2RI7A 4WA6A 3U5OA 4YAXA 5B77A 4FJCA 5TDWA 2YHNA 2KWNA 1IYMA 3KV6A 2MNZA 2VJFA 3SOUA 4L58A 2LQ6A 2KWJA 1X4JA 2KWKA 4A4CA 4A0CD 1JOCA 2H0DA 5AIUA 4WZ0A 2I50A 2FUIA 4C9ZA 3HCTA 2YW8A 4YC9A 2HYED 2VP7A 2ECNA 2M1RA 4I7DA 3ZPV1 2ECJA 2MD8C 5H1VA 4W4UA 4B7YC 3NG2A 2JMIA 3O35A 2L5UA 3M99A 2CKLB 4A49A 4AVXA 5TBNA 4FO9A 2F6JA 5J3XA 2L75A 4GB0A 2LGLA 4UP0A 1WEOA 3SHBA 2MA5A 4QF3A 2KGGA 4X3GA 2VNFA 3U5PA 3RPGC 4TKPB 1G25A 4LADB 1LDJB 4R2YA 1T1HA 3PURA 3V43A 4N3WA 2CKLA 4I7BA 2YT5A 2LXHC 5H1UA 2EGPA 2L0BA 3O7AA 2M85A 2M6MA 2ECWA 2MD7B 5C11A 2YUCA 1Z60A 2MUMA 1WE9A 2M3HA 2MIQA 3VK6A 3L1ZB 2CSYA 5FEYA 2G43A 3O36A 3M63A 1HYIA 4BBQA 5D1LB 5EYAF 4CA1A 1CHCA 2VPBA 1VD4A 1LDKC 4YATA 2G6QA 1X4IA 3ZTGA 4S3OC 2E6SA 3EB6A 5D1KB 4YBTA 3C6WA 3MHHA 4ZUXU 2AN6A 1N87A 5TRBA 2H0DB 2CT2A 5B79A 3N9OA 5H1TA 3HCSA 2VJEB 3N9NA 2LRIC 2ZETC 4LLBA 4S3OB 4Q6FA 1HYJA 4PPEA 3O70A 2KR4A 3GV4A 2LGGA 4GNEA 2L80A 4ZDTA 1WESA 2YU4A 2ECIA 3LQIA 2YSJA 4I7CA 1WEQA 2CSZA 4FIPA 2G45A 1ZBDB 3O34A 1JM7A 2PNXA 2KREA 5FB0A 2YSMA 3KQIA 4NN2A 4P5OB 3EB5A 2K1JA 3LQJA 4YADA 2D8SA 4IC3A 5LCWB 4O64A 4A4BA 2VPDA 2QIZA 2PUYA 1WFKA 4GNGA 2VJFB 4UP5A 3QZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHD A;  2KFT A;  2KWO A;  2QIC A;  3N9P A;  3T7L A;  2DX8 A;  1XWH A;  4BHW A;  1E4U A;  1VFY A;  2E6R A;  3KNV A;  3U5M A;  4IC2 A;  1V87 A;  1VYX A;  2KGI A;  2Y1M A;  2FUU A;  2Y1N A;  4CCG X;  5AIT A;  3RPG B;  5C13 A;  2XEU A;  1WGM A;  2XB1 A;  1WEU A;  4YBS A;  1JM7 B;  2K16 A;  2LV9 A;  2ECV A;  4QF2 A;  2K4D A;  2Y43 A;  5B78 A;  1Z6U A;  3DPL R;  4MVT A;  3RTR B;  4YAB A;  3ZYQ A;  4V3L C;  4PTB A;  1WEW A;  4YBM A;  5JG6 A;  1Z2Q A;  4GNF A;  4XI1 A;  5KH9 A;  2YRE A;  3C5K A;  3ZVZ B;  2L43 A;  3N9M A;  1MM2 A;  5D1M B;  5G05 B;  3O33 A;  4L7X A;  2IDA A;  3M62 A;  5I3L A;  3HCU A;  2OXQ C;  5B76 A;  4N4F A;  3FL2 A;  1DVP A;  5G04 B;  3T6R A;  4AYC A;  2LDR A;  1X4U A;  3DQV R;  2F42 A;  3IHP A;  3N9Q A;  4LKA A;  2EOD A;  1WEE A;  4R8P K;  4V3K C;  3L1X A;  2K17 A;  3LQH A;  4WZ2 A;  1FBV A;  5G0F A;  2YYR A;  2LGK A;  2MT5 A;  2QJ0 A;  1MM3 A;  4AYC B;  3ASL A;  3SOW A;  3L11 A;  2LGV A;  5DKA A;  2VPE A;  5FB1 A;  2FSA A;  2F6N A;  3PUQ A;  4B86 C;  2KYU A;  2KE1 A;  2KU3 A;  1FP0 A;  2VPG A;  5H9M A;  4LJN A;  2JMJ A;  2YHO A;  1F62 A;  3KV5 A;  2C2L A;  2BAY A;  2KIZ A;  3ZPV E;  1RMD A;  1WIM A;  5TAB A;  5LKT A;  3N9L A;  4R7E A;  5KH3 A;  4GND A;  2MNY A;  2ECT A;  3O37 A;  2LXP C;  3SOX A;  3LRQ A;  4AP4 A;  5B75 A;  5DIN A;  1WEM A;  4FK5 A;  2MA6 A;  3ZNI A;  3I2D A;  2EA6 A;  1WIL A;  4ZQL A;  5TDR A;  1BOR A;  4F52 B;  3MHS A;  2VJE A;  2C2V S;  4MSX A;  2JRJ A;  2YQM A;  5FER A;  2LN0 A;  4WZ3 B;  2YQL A;  5KH7 A;  4LK9 A;  3ZVY A;  1WEN A;  2JMD A;  5B8D A;  5LKZ A;  1WEP A;  1U6G B;  2ECG A;  2HDP A;  2NAA A;  4UI9 B;  2UZG A;  5LKX A;  3HTK C;  1WEV A;  4AUQ B;  3U5N A;  3GL6 A;  2YUR A;  2RSD A;  1K2F A;  5LKU A;  2RI7 A;  4WA6 A;  3U5O A;  4YAX A;  5B77 A;  4FJC A;  5TDW A;  2YHN A;  2KWN A;  1IYM A;  3KV6 A;  2MNZ A;  2VJF A;  3SOU A;  4L58 A;  2LQ6 A;  2KWJ A;  1X4J A;  2KWK A;  4A4C A;  4A0C D;  1JOC A;  2H0D A;  5AIU A;  4WZ0 A;  2I50 A;  2FUI A;  4C9Z A;  3HCT A;  2YW8 A;  4YC9 A;  2HYE D;  2VP7 A;  2ECN A;  2M1R A;  4I7D A;  3ZPV 1;  2ECJ A;  2MD8 C;  5H1V A;  4W4U A;  4B7Y C;  3NG2 A;  2JMI A;  3O35 A;  2L5U A;  3M99 A;  2CKL B;  4A49 A;  4AVX A;  5TBN A;  4FO9 A;  2F6J A;  5J3X A;  2L75 A;  4GB0 A;  2LGL A;  4UP0 A;  1WEO A;  3SHB A;  2MA5 A;  4QF3 A;  2KGG A;  4X3G A;  2VNF A;  3U5P A;  3RPG C;  4TKP B;  1G25 A;  4LAD B;  1LDJ B;  4R2Y A;  1T1H A;  3PUR A;  3V43 A;  4N3W A;  2CKL A;  4I7B A;  2YT5 A;  2LXH C;  5H1U A;  2EGP A;  2L0B A;  3O7A A;  2M85 A;  2M6M A;  2ECW A;  2MD7 B;  5C11 A;  2YUC A;  1Z60 A;  2MUM A;  1WE9 A;  2M3H A;  2MIQ A;  3VK6 A;  3L1Z B;  2CSY A;  5FEY A;  2G43 A;  3O36 A;  3M63 A;  1HYI A;  4BBQ A;  5D1L B;  5EYA F;  4CA1 A;  1CHC A;  2VPB A;  1VD4 A;  1LDK C;  4YAT A;  2G6Q A;  1X4I A;  3ZTG A;  4S3O C;  2E6S A;  3EB6 A;  5D1K B;  4YBT A;  3C6W A;  3MHH A;  4ZUX U;  2AN6 A;  1N87 A;  5TRB A;  2H0D B;  2CT2 A;  5B79 A;  3N9O A;  5H1T A;  3HCS A;  2VJE B;  3N9N A;  2LRI C;  2ZET C;  4LLB A;  4S3O B;  4Q6F A;  1HYJ A;  4PPE A;  3O70 A;  2KR4 A;  3GV4 A;  2LGG A;  4GNE A;  2L80 A;  4ZDT A;  1WES A;  2YU4 A;  2ECI A;  3LQI A;  2YSJ A;  4I7C A;  1WEQ A;  2CSZ A;  4FIP A;  2G45 A;  1ZBD B;  3O34 A;  1JM7 A;  2PNX A;  2KRE A;  5FB0 A;  2YSM A;  3KQI A;  4NN2 A;  4P5O B;  3EB5 A;  2K1J A;  3LQJ A;  4YAD A;  2D8S A;  4IC3 A;  5LCW B;  4O64 A;  4A4B A;  2VPD A;  2QIZ A;  2PUY A;  1WFK A;  4GNG A;  2VJF B;  4UP5 A;  3QZV A; 
#chains in the Genus database with same CATH topology
 3PHD A;  2KFT A;  3Q1D A;  2FD4 A;  2KWO A;  2QIC A;  3N9P A;  3LVQ E;  3T7L A;  3LVR E;  2DX8 A;  3PLW A;  1XWH A;  4BHW A;  4OGE A;  1E4U A;  1VFY A;  4OGC A;  2E6R A;  3KNV A;  3U5M A;  4IC2 A;  1V87 A;  1VYX A;  2KGI A;  2Y1M A;  2FUU A;  2Y1N A;  4CCG X;  5AIT A;  2OWA A;  3RPG B;  5C13 A;  2XEU A;  1WGM A;  2XB1 A;  1WEU A;  4YBS A;  1JM7 B;  2K16 A;  2LV9 A;  2ECV A;  4QF2 A;  2K4D A;  2Y43 A;  2XOC A;  5B78 A;  1Z6U A;  3DPL R;  3JUE A;  4MVT A;  3RTR B;  4YAB A;  3ZYQ A;  4V3L C;  4PTB A;  1WEW A;  4YBM A;  5JG6 A;  1Z2Q A;  4GNF A;  4XI1 A;  5KH9 A;  2MKE A;  2YRE A;  3C5K A;  3ZVZ B;  2L43 A;  3N9M A;  1MM2 A;  5D1M B;  5G05 B;  3O33 A;  4L7X A;  2IDA A;  3M62 A;  5I3L A;  3HCU A;  2OXQ C;  5B76 A;  4N4F A;  3FL2 A;  1DVP A;  5G04 B;  3T6R A;  3E2D A;  4AYC A;  2LDR A;  2JM3 A;  1X4U A;  3DQV R;  5SVI B;  2F42 A;  3IHP A;  3N9Q A;  4LKA A;  2EOD A;  1WEE A;  4R8P K;  4V3K C;  3DDT A;  3L1X A;  2K17 A;  3LJU X;  3LQH A;  4WZ2 A;  1FBV A;  5G0F A;  2YYR A;  2LGK A;  2MT5 A;  2QJ0 A;  3T9K A;  2CRW A;  1MM3 A;  4AYC B;  3ASL A;  3SOW A;  3L11 A;  2LGV A;  5DKA A;  2VPE A;  5FB1 A;  2FSA A;  2F6N A;  3PUQ A;  4B86 C;  2CRR A;  2KYU A;  2KE1 A;  2KU3 A;  1FP0 A;  2VPG A;  3FM8 C;  2RR4 A;  5H9M A;  4LJN A;  3M7K A;  2JMJ A;  2YHO A;  1F62 A;  3KV5 A;  2C2L A;  2BAY A;  2KIZ A;  3ZPV E;  1RMD A;  1WIM A;  5TAB A;  5LKT A;  3N9L A;  4R7E A;  5KH3 A;  2P57 A;  4GND A;  2MNY A;  2ECT A;  3O37 A;  2LXP C;  2L7P A;  3SOX A;  3LRQ A;  4AP4 A;  5B75 A;  5DIN A;  1WEM A;  4FK5 A;  2MA6 A;  2B0O E;  3ZNI A;  3I2D A;  2EA6 A;  1WIL A;  4ZQL A;  5TDR A;  1BOR A;  4F52 B;  3MHS A;  2VJE A;  3FAO A;  2C2V S;  4MSX A;  2JRJ A;  2YQM A;  5FER A;  2LN0 A;  4WZ3 B;  2YQL A;  5KH7 A;  4LK9 A;  5SVI A;  2DJA A;  2EXU A;  3ZVY A;  1WEN A;  2JMD A;  5B8D A;  5LKZ A;  1WEP A;  4Z0O A;  1U6G B;  2ECG A;  2HDP A;  2NAA A;  4UI9 B;  2UZG A;  5LKX A;  3HTK C;  1WEV A;  4AUQ B;  3U5N A;  3GL6 A;  2YUR A;  2CSV A;  2RSD A;  1K2F A;  5LKU A;  2RI7 A;  4WA6 A;  3U5O A;  2XOZ A;  4YAX A;  5B77 A;  4FJC A;  5TDW A;  2YHN A;  2KWN A;  1IYM A;  3KV6 A;  2MNZ A;  2VJF A;  4H9D A;  3SOU A;  4L58 A;  2LQ6 A;  2KWJ A;  1X4J A;  2KWK A;  4A4C A;  4A0C D;  1JOC A;  2H0D A;  5AIU A;  4WZ0 A;  2I50 A;  2D8U A;  2FUI A;  4C9Z A;  3HCT A;  2YW8 A;  4YC9 A;  2HYE D;  2VP7 A;  2ECN A;  3DWD A;  2M1R A;  4I7D A;  3ZPV 1;  2ECJ A;  2MD8 C;  1DCQ A;  5H1V A;  4W4U A;  4B7Y C;  3NG2 A;  3O47 A;  2JMI A;  3O35 A;  2L5U A;  3M99 A;  2CKL B;  4A49 A;  4AVX A;  5TBN A;  4FO9 A;  2F6J A;  5J3X A;  2L75 A;  4GB0 A;  2LGL A;  4UP0 A;  1WEO A;  3SHB A;  2MA5 A;  3LDY A;  3MDB C;  4QF3 A;  2KGG A;  4X3G A;  2VNF A;  3FEH A;  3U5P A;  3RPG C;  5SVY A;  1MBM A;  4TKP B;  1G25 A;  4LAD B;  4QQ4 A;  1LDJ B;  4R2Y A;  1T1H A;  3PUR A;  3V43 A;  2FFW A;  4N3W A;  3KDE C;  2CKL A;  4I7B A;  3H7H A;  2YT5 A;  5K3Q A;  2LXH C;  5H1U A;  2EGP A;  2L0B A;  3O7A A;  2XOY A;  2M85 A;  2M6M A;  2ECW A;  2MD7 B;  5C11 A;  2LAU A;  2YUC A;  1Z60 A;  2MUM A;  1WE9 A;  2M3H A;  2MIQ A;  2EGM A;  2YVR A;  3VK6 A;  3L1Z B;  2XP0 A;  2KKX A;  2CSY A;  5FEY A;  2CON A;  2M13 A;  2E61 A;  2G43 A;  3O36 A;  3M63 A;  1HYI A;  4BBQ A;  4Z0R A;  5D1L B;  5EYA F;  2JUN A;  4CA1 A;  1CHC A;  2VPB A;  1VD4 A;  1LDK C;  4YAT A;  2G6Q A;  1X4I A;  3ZTG A;  4S3O C;  2E6S A;  3EB6 A;  5D1K B;  4YBT A;  3C6W A;  3MHH A;  4ZUX U;  2AN6 A;  1N87 A;  5TRB A;  2H0D B;  2CT2 A;  5B79 A;  2IQJ A;  3N9O A;  5H1T A;  3HCS A;  2VJE B;  3N9N A;  2LRI C;  2ZET C;  4LLB A;  4S3O B;  4Q6F A;  1HYJ A;  5SVX A;  4PPE A;  4O62 A;  3O70 A;  2DSM A;  2KR4 A;  3GV4 A;  2LGG A;  4GNE A;  2L80 A;  4ZDT A;  1WES A;  2YU4 A;  2ECI A;  3LQI A;  2YSJ A;  4I7C A;  1WEQ A;  2CSZ A;  4FIP A;  2G45 A;  1ZBD B;  3FJU B;  3O34 A;  1JM7 A;  2PNX A;  2KRE A;  5FB0 A;  2YSM A;  3SUB A;  3KQI A;  4NN2 A;  4P5O B;  2KKY A;  3EB5 A;  2K1J A;  3LQJ A;  4YAD A;  2D8S A;  4IC3 A;  5LCW B;  4O64 A;  4A4B A;  2VPD A;  2QIZ A;  2PUY A;  1WFK A;  4F1P A;  4GNG A;  2VJF B;  4UP5 A;  3FAN A;  3QZV A; 
#chains in the Genus database with same CATH homology
 3PHD A;  2KFT A;  2KWO A;  2QIC A;  3N9P A;  3T7L A;  2DX8 A;  1XWH A;  4BHW A;  1E4U A;  1VFY A;  2E6R A;  3KNV A;  3U5M A;  4IC2 A;  1V87 A;  1VYX A;  2KGI A;  2Y1M A;  2FUU A;  2Y1N A;  4CCG X;  5AIT A;  3RPG B;  5C13 A;  2XEU A;  1WGM A;  2XB1 A;  1WEU A;  4YBS A;  1JM7 B;  2K16 A;  2LV9 A;  2ECV A;  4QF2 A;  2K4D A;  2Y43 A;  5B78 A;  1Z6U A;  3DPL R;  4MVT A;  3RTR B;  4YAB A;  3ZYQ A;  4V3L C;  4PTB A;  1WEW A;  4YBM A;  5JG6 A;  1Z2Q A;  4GNF A;  4XI1 A;  5KH9 A;  2YRE A;  3C5K A;  3ZVZ B;  2L43 A;  3N9M A;  1MM2 A;  5D1M B;  5G05 B;  3O33 A;  4L7X A;  2IDA A;  3M62 A;  5I3L A;  3HCU A;  2OXQ C;  5B76 A;  4N4F A;  3FL2 A;  1DVP A;  5G04 B;  3T6R A;  4AYC A;  2LDR A;  1X4U A;  3DQV R;  2F42 A;  3IHP A;  3N9Q A;  4LKA A;  2EOD A;  1WEE A;  4R8P K;  4V3K C;  3L1X A;  2K17 A;  3LQH A;  4WZ2 A;  1FBV A;  5G0F A;  2YYR A;  2LGK A;  2MT5 A;  2QJ0 A;  1MM3 A;  4AYC B;  3ASL A;  3SOW A;  3L11 A;  2LGV A;  5DKA A;  2VPE A;  5FB1 A;  2FSA A;  2F6N A;  3PUQ A;  4B86 C;  2KYU A;  2KE1 A;  2KU3 A;  1FP0 A;  2VPG A;  5H9M A;  4LJN A;  2JMJ A;  2YHO A;  1F62 A;  3KV5 A;  2C2L A;  2BAY A;  2KIZ A;  3ZPV E;  1RMD A;  1WIM A;  5TAB A;  5LKT A;  3N9L A;  4R7E A;  5KH3 A;  4GND A;  2MNY A;  2ECT A;  3O37 A;  2LXP C;  3SOX A;  3LRQ A;  4AP4 A;  5B75 A;  5DIN A;  1WEM A;  4FK5 A;  2MA6 A;  3ZNI A;  3I2D A;  2EA6 A;  1WIL A;  4ZQL A;  5TDR A;  1BOR A;  4F52 B;  3MHS A;  2VJE A;  2C2V S;  4MSX A;  2JRJ A;  2YQM A;  5FER A;  2LN0 A;  4WZ3 B;  2YQL A;  5KH7 A;  4LK9 A;  3ZVY A;  1WEN A;  2JMD A;  5B8D A;  5LKZ A;  1WEP A;  1U6G B;  2ECG A;  2HDP A;  2NAA A;  4UI9 B;  2UZG A;  5LKX A;  3HTK C;  1WEV A;  4AUQ B;  3U5N A;  3GL6 A;  2YUR A;  2RSD A;  1K2F A;  5LKU A;  2RI7 A;  4WA6 A;  3U5O A;  4YAX A;  5B77 A;  4FJC A;  5TDW A;  2YHN A;  2KWN A;  1IYM A;  3KV6 A;  2MNZ A;  2VJF A;  3SOU A;  4L58 A;  2LQ6 A;  2KWJ A;  1X4J A;  2KWK A;  4A4C A;  4A0C D;  1JOC A;  2H0D A;  5AIU A;  4WZ0 A;  2I50 A;  2FUI A;  4C9Z A;  3HCT A;  2YW8 A;  4YC9 A;  2HYE D;  2VP7 A;  2ECN A;  2M1R A;  4I7D A;  3ZPV 1;  2ECJ A;  2MD8 C;  5H1V A;  4W4U A;  4B7Y C;  3NG2 A;  2JMI A;  3O35 A;  2L5U A;  3M99 A;  2CKL B;  4A49 A;  4AVX A;  5TBN A;  4FO9 A;  2F6J A;  5J3X A;  2L75 A;  4GB0 A;  2LGL A;  4UP0 A;  1WEO A;  3SHB A;  2MA5 A;  4QF3 A;  2KGG A;  4X3G A;  2VNF A;  3U5P A;  3RPG C;  4TKP B;  1G25 A;  4LAD B;  1LDJ B;  4R2Y A;  1T1H A;  3PUR A;  3V43 A;  4N3W A;  2CKL A;  4I7B A;  2YT5 A;  2LXH C;  5H1U A;  2EGP A;  2L0B A;  3O7A A;  2M85 A;  2M6M A;  2ECW A;  2MD7 B;  5C11 A;  2YUC A;  1Z60 A;  2MUM A;  1WE9 A;  2M3H A;  2MIQ A;  3VK6 A;  3L1Z B;  2CSY A;  5FEY A;  2G43 A;  3O36 A;  3M63 A;  1HYI A;  4BBQ A;  5D1L B;  5EYA F;  4CA1 A;  1CHC A;  2VPB A;  1VD4 A;  1LDK C;  4YAT A;  2G6Q A;  1X4I A;  3ZTG A;  4S3O C;  2E6S A;  3EB6 A;  5D1K B;  4YBT A;  3C6W A;  3MHH A;  4ZUX U;  2AN6 A;  1N87 A;  5TRB A;  2H0D B;  2CT2 A;  5B79 A;  3N9O A;  5H1T A;  3HCS A;  2VJE B;  3N9N A;  2LRI C;  2ZET C;  4LLB A;  4S3O B;  4Q6F A;  1HYJ A;  4PPE A;  3O70 A;  2KR4 A;  3GV4 A;  2LGG A;  4GNE A;  2L80 A;  4ZDT A;  1WES A;  2YU4 A;  2ECI A;  3LQI A;  2YSJ A;  4I7C A;  1WEQ A;  2CSZ A;  4FIP A;  2G45 A;  1ZBD B;  3O34 A;  1JM7 A;  2PNX A;  2KRE A;  5FB0 A;  2YSM A;  3KQI A;  4NN2 A;  4P5O B;  3EB5 A;  2K1J A;  3LQJ A;  4YAD A;  2D8S A;  4IC3 A;  5LCW B;  4O64 A;  4A4B A;  2VPD A;  2QIZ A;  2PUY A;  1WFK A;  4GNG A;  2VJF B;  4UP5 A;  3QZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...