3GL6A

Crystal structure of jarid1a-phd3 complexed with h3(1-9)k4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
52
structure length
52
Chain Sequence
b'SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone demethylase JARID1A
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 8
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3gl6A01
4R7EA 4YBTA 5LKUA 1MM3A 2KWNA 3HCTA 3O37A 2YREA 2LRIC 2C2VS 4UP0A 1N87A 2JMJA 2LGKA 4O64A 2VPBA 2HYED 2DX8A 2ECWA 4FIPA 2VJEA 2HDPA 3FL2A 3KV5A 2KIZA 4FK5A 5J3XA 2YQMA 3M99A 3GL6A 1JM7A 2YUCA 2RSDA 1ZBDB 1WGMA 2M85A 3HCSA 5B79A 1Z60A 4B7YC 1BORA 4XI1A 2CSZA 2YHOA 2ECJA 4L58A 3L1XA 5H1TA 5DINA 1WEUA 2M6MA 4B86C 2KWKA 5KH3A 5TABA 2MD7B 4UP5A 1Z6UA 4A4CA 2JRJA 1F62A 4PTBA 4A49A 5EYAF 4YBSA 4PPEA 2KR4A 2VPEA 4GB0A 3RPGB 2QJ0A 3ZVYA 2VJFB 1WEPA 5FERA 3ZPV1 2LDRA 2G45A 2L5UA 3LQHA 3VK6A 2MD8C 4R2YA 3ASLA 1V87A 2KREA 4YATA 3LQJA 3O33A 3EB5A 3QZVA 1WENA 4Q6FA 3N9NA 4V3LC 4AP4A 3U5NA 3GV4A 2LGLA 5H9MA 3RPGC 2MIQA 2BAYA 2MNYA 2K16A 1MM2A 5D1KB 5DKAA 4I7BA 2I50A 2CSYA 2MUMA 2G43A 2VPGA 2M3HA 2YU4A 4LLBA 2YHNA 5B8DA 2ZETC 1WEEA 4CCGX 2LV9A 4S3OB 4I7DA 4BBQA 2F6NA 4F52B 4GNFA 3M62A 2L75A 4LADB 1WEMA 2EGPA 3V43A 2M1RA 3SOXA 2F6JA 2E6RA 4CA1A 5FB0A 2Y1MA 4I7CA 2YW8A 1VFYA 2QICA 2QIZA 5G0FA 5LCWB 5TDRA 4N3WA 3O70A 4GNEA 1WEVA 1WE9A 4S3OC 4QF2A 2LXHC 2ECTA 2MA5A 2L0BA 2MNZA 5G05B 1T1HA 4NN2A 3N9QA 2FSAA 3NG2A 3U5PA 2KWOA 2KGGA 2L43A 3SHBA 5D1LB 5KH9A 3N9PA 1WEQA 4ZQLA 4YC9A 3RTRB 3N9LA 5AIUA 3C6WA 2ECNA 3ZYQA 4GNDA 2NAAA 3U5OA 1WILA 3N9OA 1X4UA 1K2FA 2YSMA 5LKZA 2LGVA 3KV6A 3EB6A 4YABA 5FB1A 2CKLB 1IYMA 1LDKC 4UI9B 5B75A 3L1ZB 4YADA 2LGGA 3M63A 2KU3A 4QF3A 4X3GA 2KWJA 4LK9A 1DVPA 2K1JA 3C5KA 3O35A 4C9ZA 5I3LA 3ZNIA 5LKXA 2H0DB 3O36A 2AN6A 2LN0A 2XB1A 5H1UA 4V3KC 4AUQB 2KGIA 3SOUA 1HYIA 2VJEB 1WIMA 2D8SA 4WA6A 1WEWA 1XWHA 2UZGA 3DPLR 2CKLA 5TBNA 5G04B 4FJCA 4TKPB 3ZPVE 1JM7B 2VJFA 2YURA 1CHCA 1VYXA 3MHHA 4GNGA 1G25A 3O7AA 5C13A 4YBMA 4LKAA 2H0DA 5FEYA 2CT2A 4WZ0A 1WEOA 4BHWA 1X4JA 2Y1NA 3PUQA 2EODA 2RI7A 2MA6A 5KH7A 3KNVA 2VPDA 4L7XA 2JMDA 2ECIA 2FUUA 1FBVA 3LQIA 5C11A 5B78A 2ECGA 1WESA 1U6GB 2KFTA 2KE1A 1WFKA 2PNXA 1VD4A 3N9MA 2PUYA 4ZUXU 3SOWA 1RMDA 2VP7A 4AYCB 5JG6A 3L11A 1JOCA 2K4DA 2YQLA 2VNFA 4LJNA 2L80A 2C2LA 2JMIA 2Y43A 5LKTA 4AVXA 2G6QA 2XEUA 3T6RA 3KQIA 1Z2QA 2LQ6A 4IC3A 4YAXA 4MVTA 1X4IA 2IDAA 2FUIA 1LDJB 3O34A 4WZ2A 2KYUA 5D1MB 3ZTGA 2E6SA 4FO9A 4N4FA 5TRBA 2LXPC 4IC2A 5TDWA 3ZVZB 2OXQC 2YT5A 1FP0A 2YSJA 5B77A 4P5OB 4AYCA 3I2DA 3LRQA 5AITA 4W4UA 5B76A 2MT5A 2ECVA 3MHSA 4ZDTA 4A0CD 2EA6A 3DQVR 4R8PK 3U5MA 4WZ3B 5H1VA 1HYJA 2K17A 1E4UA 2F42A 3IHPA 4A4BA 3PURA 3T7LA 2YYRA 3HTKC 4MSXA 3HCUA 3PHDA
chains in the Genus database with same CATH superfamily
4R7EA 4YBTA 2KKYA 5LKUA 1MM3A 2KWNA 3HCTA 3O37A 2YREA 2LRIC 2C2VS 4UP0A 1N87A 2JMJA 2LGKA 3DDTA 4O64A 2VPBA 2HYED 2DX8A 2ECWA 4FIPA 2VJEA 2HDPA 4H9DA 3FL2A 3KV5A 1MBMA 2KIZA 4FK5A 5J3XA 2YQMA 3M99A 3GL6A 1JM7A 2YUCA 2RSDA 1ZBDB 1WGMA 2M85A 3HCSA 4F1PA 5B79A 1Z60A 3LVQE 4B7YC 1BORA 5K3QA 2CRRA 3H7HA 4XI1A 2CSZA 2YHOA 2ECJA 4L58A 3L1XA 2MKEA 5H1TA 3FJUB 5DINA 1WEUA 2M6MA 4B86C 2KWKA 3O47A 5KH3A 5TABA 2MD7B 4UP5A 1Z6UA 4A4CA 2JRJA 1F62A 4PTBA 4A49A 5EYAF 4YBSA 4PPEA 2KR4A 2VPEA 4GB0A 2CSVA 3RPGB 2QJ0A 3ZVYA 2VJFB 1WEPA 5FERA 3ZPV1 2LDRA 2KKXA 2G45A 2L5UA 5SVYA 2XOCA 3LQHA 3VK6A 3LDYA 2L7PA 2MD8C 4R2YA 3ASLA 1V87A 2KREA 4YATA 3LQJA 3O33A 3EB5A 3LVRE 3QZVA 1WENA 4Q6FA 3N9NA 4V3LC 3JUEA 3M7KA 4AP4A 3U5NA 3GV4A 3KDEC 2LGLA 5H9MA 3RPGC 2MIQA 2BAYA 2MNYA 2K16A 1MM2A 5D1KB 5DKAA 4I7BA 2DSMA 2I50A 2CSYA 2MUMA 2G43A 2VPGA 2M3HA 2YU4A 4LLBA 2YHNA 5B8DA 2ZETC 4Z0RA 1WEEA 4CCGX 2LV9A 4S3OB 4I7DA 4BBQA 2F6NA 4F52B 4GNFA 3M62A 2L75A 3FAOA 4LADB 1WEMA 2EGPA 3V43A 2M1RA 3SOXA 3T9KA 2F6JA 2E6RA 4CA1A 5FB0A 2Y1MA 4I7CA 2YW8A 1VFYA 2M13A 2QICA 2QIZA 5G0FA 5LCWB 5TDRA 4N3WA 3O70A 4GNEA 1WEVA 2FD4A 1WE9A 4S3OC 4QF2A 2LXHC 2ECTA 2MA5A 2L0BA 2MNZA 5G05B 1T1HA 2YVRA 3N9QA 4NN2A 2FSAA 3NG2A 3U5PA 3MDBC 2KWOA 2KGGA 2L43A 3SHBA 5D1LB 5KH9A 3N9PA 1WEQA 4ZQLA 2XP0A 4YC9A 3RTRB 3N9LA 3LJUX 5AIUA 3C6WA 4QQ4A 2ECNA 3ZYQA 4GNDA 2NAAA 3U5OA 3E2DA 1WILA 3N9OA 1X4UA 1K2FA 2YSMA 5LKZA 2LGVA 3KV6A 3EB6A 3DWDA 4YABA 5FB1A 2CKLB 2EGMA 1IYMA 1LDKC 4UI9B 5B75A 3L1ZB 4YADA 2LGGA 3M63A 2KU3A 2LAUA 2B0OE 4QF3A 4X3GA 2KWJA 4LK9A 1DVPA 2K1JA 3C5KA 3O35A 4C9ZA 5I3LA 3ZNIA 5LKXA 2H0DB 4OGEA 3O36A 2AN6A 2LN0A 3PLWA 2XB1A 5H1UA 4V3KC 4AUQB 2KGIA 3SOUA 1HYIA 2VJEB 1WIMA 2D8SA 4WA6A 5SVXA 2D8UA 1WEWA 1XWHA 2UZGA 3DPLR 5SVIB 2CKLA 5TBNA 2CRWA 5G04B 4FJCA 4TKPB 3ZPVE 1JM7B 2VJFA 2YURA 3FEHA 4O62A 1CHCA 1VYXA 3MHHA 4GNGA 4Z0OA 1G25A 3O7AA 5C13A 4YBMA 4LKAA 2H0DA 5FEYA 2CT2A 4WZ0A 1WEOA 4BHWA 1X4JA 2Y1NA 4OGCA 3PUQA 2EODA 2RI7A 2MA6A 5KH7A 3KNVA 2VPDA 4L7XA 2JMDA 2ECIA 2RR4A 2FUUA 1FBVA 2DJAA 3LQIA 5C11A 5SVIA 3SUBA 5B78A 2ECGA 1WESA 1U6GB 2KFTA 2KE1A 1WFKA 2PNXA 1VD4A 3N9MA 2PUYA 4ZUXU 3SOWA 1RMDA 2VP7A 4AYCB 5JG6A 3L11A 1JOCA 3Q1DA 2K4DA 2XOYA 2YQLA 2VNFA 4LJNA 2L80A 2C2LA 2JMIA 2Y43A 5LKTA 4AVXA 2G6QA 2XEUA 3T6RA 3KQIA 1Z2QA 2LQ6A 4IC3A 4YAXA 4MVTA 1X4IA 2IDAA 2FUIA 1LDJB 3O34A 4WZ2A 2KYUA 5D1MB 3ZTGA 2IQJA 2E6SA 4FO9A 4N4FA 5TRBA 2LXPC 3FANA 4IC2A 5TDWA 3FM8C 3ZVZB 2FFWA 2OXQC 2YT5A 1FP0A 2YSJA 5B77A 4P5OB 4AYCA 3I2DA 3LRQA 2P57A 5AITA 4W4UA 5B76A 2MT5A 2ECVA 3MHSA 4ZDTA 4A0CD 2EA6A 2JM3A 3DQVR 4R8PK 3U5MA 2OWAA 2JUNA 4WZ3B 5H1VA 1HYJA 2K17A 2XOZA 1E4UA 1DCQA 2F42A 3IHPA 2CONA 4A4BA 2E61A 2EXUA 3PURA 3T7LA 2YYRA 3HTKC 4MSXA 3HCUA 3PHDA
chains in the Genus database with same CATH topology
4R7EA 4YBTA 5LKUA 1MM3A 2KWNA 3HCTA 3O37A 2YREA 2LRIC 2C2VS 4UP0A 1N87A 2JMJA 2LGKA 4O64A 2VPBA 2HYED 2DX8A 2ECWA 4FIPA 2VJEA 2HDPA 3FL2A 3KV5A 2KIZA 4FK5A 5J3XA 2YQMA 3M99A 3GL6A 1JM7A 2YUCA 2RSDA 1ZBDB 1WGMA 2M85A 3HCSA 5B79A 1Z60A 4B7YC 1BORA 4XI1A 2CSZA 2YHOA 2ECJA 4L58A 3L1XA 5H1TA 5DINA 1WEUA 2M6MA 4B86C 2KWKA 5KH3A 5TABA 2MD7B 4UP5A 1Z6UA 4A4CA 2JRJA 1F62A 4PTBA 4A49A 5EYAF 4YBSA 4PPEA 2KR4A 2VPEA 4GB0A 3RPGB 2QJ0A 3ZVYA 2VJFB 1WEPA 5FERA 3ZPV1 2LDRA 2G45A 2L5UA 3LQHA 3VK6A 2MD8C 4R2YA 3ASLA 1V87A 2KREA 4YATA 3LQJA 3O33A 3EB5A 3QZVA 1WENA 4Q6FA 3N9NA 4V3LC 4AP4A 3U5NA 3GV4A 2LGLA 5H9MA 3RPGC 2MIQA 2BAYA 2MNYA 2K16A 1MM2A 5D1KB 5DKAA 4I7BA 2I50A 2CSYA 2MUMA 2G43A 2VPGA 2M3HA 2YU4A 4LLBA 2YHNA 5B8DA 2ZETC 1WEEA 4CCGX 2LV9A 4S3OB 4I7DA 4BBQA 2F6NA 4F52B 4GNFA 3M62A 2L75A 4LADB 1WEMA 2EGPA 3V43A 2M1RA 3SOXA 2F6JA 2E6RA 4CA1A 5FB0A 2Y1MA 4I7CA 2YW8A 1VFYA 2QICA 2QIZA 5G0FA 5LCWB 5TDRA 4N3WA 3O70A 4GNEA 1WEVA 1WE9A 4S3OC 4QF2A 2LXHC 2ECTA 2MA5A 2L0BA 2MNZA 5G05B 1T1HA 4NN2A 3N9QA 2FSAA 3NG2A 3U5PA 2KWOA 2KGGA 2L43A 3SHBA 5D1LB 5KH9A 3N9PA 1WEQA 4ZQLA 4YC9A 3RTRB 3N9LA 5AIUA 3C6WA 2ECNA 3ZYQA 4GNDA 2NAAA 3U5OA 1WILA 3N9OA 1X4UA 1K2FA 2YSMA 5LKZA 2LGVA 3KV6A 3EB6A 4YABA 5FB1A 2CKLB 1IYMA 1LDKC 4UI9B 5B75A 3L1ZB 4YADA 2LGGA 3M63A 2KU3A 4QF3A 4X3GA 2KWJA 4LK9A 1DVPA 2K1JA 3C5KA 3O35A 4C9ZA 5I3LA 3ZNIA 5LKXA 2H0DB 3O36A 2AN6A 2LN0A 2XB1A 5H1UA 4V3KC 4AUQB 2KGIA 3SOUA 1HYIA 2VJEB 1WIMA 2D8SA 4WA6A 1WEWA 1XWHA 2UZGA 3DPLR 2CKLA 5TBNA 5G04B 4FJCA 4TKPB 3ZPVE 1JM7B 2VJFA 2YURA 1CHCA 1VYXA 3MHHA 4GNGA 1G25A 3O7AA 5C13A 4YBMA 4LKAA 2H0DA 5FEYA 2CT2A 4WZ0A 1WEOA 4BHWA 1X4JA 2Y1NA 3PUQA 2EODA 2RI7A 2MA6A 5KH7A 3KNVA 2VPDA 4L7XA 2JMDA 2ECIA 2FUUA 1FBVA 3LQIA 5C11A 5B78A 2ECGA 1WESA 1U6GB 2KFTA 2KE1A 1WFKA 2PNXA 1VD4A 3N9MA 2PUYA 4ZUXU 3SOWA 1RMDA 2VP7A 4AYCB 5JG6A 3L11A 1JOCA 2K4DA 2YQLA 2VNFA 4LJNA 2L80A 2C2LA 2JMIA 2Y43A 5LKTA 4AVXA 2G6QA 2XEUA 3T6RA 3KQIA 1Z2QA 2LQ6A 4IC3A 4YAXA 4MVTA 1X4IA 2IDAA 2FUIA 1LDJB 3O34A 4WZ2A 2KYUA 5D1MB 3ZTGA 2E6SA 4FO9A 4N4FA 5TRBA 2LXPC 4IC2A 5TDWA 3ZVZB 2OXQC 2YT5A 1FP0A 2YSJA 5B77A 4P5OB 4AYCA 3I2DA 3LRQA 5AITA 4W4UA 5B76A 2MT5A 2ECVA 3MHSA 4ZDTA 4A0CD 2EA6A 3DQVR 4R8PK 3U5MA 4WZ3B 5H1VA 1HYJA 2K17A 1E4UA 2F42A 3IHPA 4A4BA 3PURA 3T7LA 2YYRA 3HTKC 4MSXA 3HCUA 3PHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7E A;  4YBT A;  5LKU A;  1MM3 A;  2KWN A;  3HCT A;  3O37 A;  2YRE A;  2LRI C;  2C2V S;  4UP0 A;  1N87 A;  2JMJ A;  2LGK A;  4O64 A;  2VPB A;  2HYE D;  2DX8 A;  2ECW A;  4FIP A;  2VJE A;  2HDP A;  3FL2 A;  3KV5 A;  2KIZ A;  4FK5 A;  5J3X A;  2YQM A;  3M99 A;  3GL6 A;  1JM7 A;  2YUC A;  2RSD A;  1ZBD B;  1WGM A;  2M85 A;  3HCS A;  5B79 A;  1Z60 A;  4B7Y C;  1BOR A;  4XI1 A;  2CSZ A;  2YHO A;  2ECJ A;  4L58 A;  3L1X A;  5H1T A;  5DIN A;  1WEU A;  2M6M A;  4B86 C;  2KWK A;  5KH3 A;  5TAB A;  2MD7 B;  4UP5 A;  1Z6U A;  4A4C A;  2JRJ A;  1F62 A;  4PTB A;  4A49 A;  5EYA F;  4YBS A;  4PPE A;  2KR4 A;  2VPE A;  4GB0 A;  3RPG B;  2QJ0 A;  3ZVY A;  2VJF B;  1WEP A;  5FER A;  3ZPV 1;  2LDR A;  2G45 A;  2L5U A;  3LQH A;  3VK6 A;  2MD8 C;  4R2Y A;  3ASL A;  1V87 A;  2KRE A;  4YAT A;  3LQJ A;  3O33 A;  3EB5 A;  3QZV A;  1WEN A;  4Q6F A;  3N9N A;  4V3L C;  4AP4 A;  3U5N A;  3GV4 A;  2LGL A;  5H9M A;  3RPG C;  2MIQ A;  2BAY A;  2MNY A;  2K16 A;  1MM2 A;  5D1K B;  5DKA A;  4I7B A;  2I50 A;  2CSY A;  2MUM A;  2G43 A;  2VPG A;  2M3H A;  2YU4 A;  4LLB A;  2YHN A;  5B8D A;  2ZET C;  1WEE A;  4CCG X;  2LV9 A;  4S3O B;  4I7D A;  4BBQ A;  2F6N A;  4F52 B;  4GNF A;  3M62 A;  2L75 A;  4LAD B;  1WEM A;  2EGP A;  3V43 A;  2M1R A;  3SOX A;  2F6J A;  2E6R A;  4CA1 A;  5FB0 A;  2Y1M A;  4I7C A;  2YW8 A;  1VFY A;  2QIC A;  2QIZ A;  5G0F A;  5LCW B;  5TDR A;  4N3W A;  3O70 A;  4GNE A;  1WEV A;  1WE9 A;  4S3O C;  4QF2 A;  2LXH C;  2ECT A;  2MA5 A;  2L0B A;  2MNZ A;  5G05 B;  1T1H A;  4NN2 A;  3N9Q A;  2FSA A;  3NG2 A;  3U5P A;  2KWO A;  2KGG A;  2L43 A;  3SHB A;  5D1L B;  5KH9 A;  3N9P A;  1WEQ A;  4ZQL A;  4YC9 A;  3RTR B;  3N9L A;  5AIU A;  3C6W A;  2ECN A;  3ZYQ A;  4GND A;  2NAA A;  3U5O A;  1WIL A;  3N9O A;  1X4U A;  1K2F A;  2YSM A;  5LKZ A;  2LGV A;  3KV6 A;  3EB6 A;  4YAB A;  5FB1 A;  2CKL B;  1IYM A;  1LDK C;  4UI9 B;  5B75 A;  3L1Z B;  4YAD A;  2LGG A;  3M63 A;  2KU3 A;  4QF3 A;  4X3G A;  2KWJ A;  4LK9 A;  1DVP A;  2K1J A;  3C5K A;  3O35 A;  4C9Z A;  5I3L A;  3ZNI A;  5LKX A;  2H0D B;  3O36 A;  2AN6 A;  2LN0 A;  2XB1 A;  5H1U A;  4V3K C;  4AUQ B;  2KGI A;  3SOU A;  1HYI A;  2VJE B;  1WIM A;  2D8S A;  4WA6 A;  1WEW A;  1XWH A;  2UZG A;  3DPL R;  2CKL A;  5TBN A;  5G04 B;  4FJC A;  4TKP B;  3ZPV E;  1JM7 B;  2VJF A;  2YUR A;  1CHC A;  1VYX A;  3MHH A;  4GNG A;  1G25 A;  3O7A A;  5C13 A;  4YBM A;  4LKA A;  2H0D A;  5FEY A;  2CT2 A;  4WZ0 A;  1WEO A;  4BHW A;  1X4J A;  2Y1N A;  3PUQ A;  2EOD A;  2RI7 A;  2MA6 A;  5KH7 A;  3KNV A;  2VPD A;  4L7X A;  2JMD A;  2ECI A;  2FUU A;  1FBV A;  3LQI A;  5C11 A;  5B78 A;  2ECG A;  1WES A;  1U6G B;  2KFT A;  2KE1 A;  1WFK A;  2PNX A;  1VD4 A;  3N9M A;  2PUY A;  4ZUX U;  3SOW A;  1RMD A;  2VP7 A;  4AYC B;  5JG6 A;  3L11 A;  1JOC A;  2K4D A;  2YQL A;  2VNF A;  4LJN A;  2L80 A;  2C2L A;  2JMI A;  2Y43 A;  5LKT A;  4AVX A;  2G6Q A;  2XEU A;  3T6R A;  3KQI A;  1Z2Q A;  2LQ6 A;  4IC3 A;  4YAX A;  4MVT A;  1X4I A;  2IDA A;  2FUI A;  1LDJ B;  3O34 A;  4WZ2 A;  2KYU A;  5D1M B;  3ZTG A;  2E6S A;  4FO9 A;  4N4F A;  5TRB A;  2LXP C;  4IC2 A;  5TDW A;  3ZVZ B;  2OXQ C;  2YT5 A;  1FP0 A;  2YSJ A;  5B77 A;  4P5O B;  4AYC A;  3I2D A;  3LRQ A;  5AIT A;  4W4U A;  5B76 A;  2MT5 A;  2ECV A;  3MHS A;  4ZDT A;  4A0C D;  2EA6 A;  3DQV R;  4R8P K;  3U5M A;  4WZ3 B;  5H1V A;  1HYJ A;  2K17 A;  1E4U A;  2F42 A;  3IHP A;  4A4B A;  3PUR A;  3T7L A;  2YYR A;  3HTK C;  4MSX A;  3HCU A;  3PHD A; 
#chains in the Genus database with same CATH topology
 4R7E A;  4YBT A;  2KKY A;  5LKU A;  1MM3 A;  2KWN A;  3HCT A;  3O37 A;  2YRE A;  2LRI C;  2C2V S;  4UP0 A;  1N87 A;  2JMJ A;  2LGK A;  3DDT A;  4O64 A;  2VPB A;  2HYE D;  2DX8 A;  2ECW A;  4FIP A;  2VJE A;  2HDP A;  4H9D A;  3FL2 A;  3KV5 A;  1MBM A;  2KIZ A;  4FK5 A;  5J3X A;  2YQM A;  3M99 A;  3GL6 A;  1JM7 A;  2YUC A;  2RSD A;  1ZBD B;  1WGM A;  2M85 A;  3HCS A;  4F1P A;  5B79 A;  1Z60 A;  3LVQ E;  4B7Y C;  1BOR A;  5K3Q A;  2CRR A;  3H7H A;  4XI1 A;  2CSZ A;  2YHO A;  2ECJ A;  4L58 A;  3L1X A;  2MKE A;  5H1T A;  3FJU B;  5DIN A;  1WEU A;  2M6M A;  4B86 C;  2KWK A;  3O47 A;  5KH3 A;  5TAB A;  2MD7 B;  4UP5 A;  1Z6U A;  4A4C A;  2JRJ A;  1F62 A;  4PTB A;  4A49 A;  5EYA F;  4YBS A;  4PPE A;  2KR4 A;  2VPE A;  4GB0 A;  2CSV A;  3RPG B;  2QJ0 A;  3ZVY A;  2VJF B;  1WEP A;  5FER A;  3ZPV 1;  2LDR A;  2KKX A;  2G45 A;  2L5U A;  5SVY A;  2XOC A;  3LQH A;  3VK6 A;  3LDY A;  2L7P A;  2MD8 C;  4R2Y A;  3ASL A;  1V87 A;  2KRE A;  4YAT A;  3LQJ A;  3O33 A;  3EB5 A;  3LVR E;  3QZV A;  1WEN A;  4Q6F A;  3N9N A;  4V3L C;  3JUE A;  3M7K A;  4AP4 A;  3U5N A;  3GV4 A;  3KDE C;  2LGL A;  5H9M A;  3RPG C;  2MIQ A;  2BAY A;  2MNY A;  2K16 A;  1MM2 A;  5D1K B;  5DKA A;  4I7B A;  2DSM A;  2I50 A;  2CSY A;  2MUM A;  2G43 A;  2VPG A;  2M3H A;  2YU4 A;  4LLB A;  2YHN A;  5B8D A;  2ZET C;  4Z0R A;  1WEE A;  4CCG X;  2LV9 A;  4S3O B;  4I7D A;  4BBQ A;  2F6N A;  4F52 B;  4GNF A;  3M62 A;  2L75 A;  3FAO A;  4LAD B;  1WEM A;  2EGP A;  3V43 A;  2M1R A;  3SOX A;  3T9K A;  2F6J A;  2E6R A;  4CA1 A;  5FB0 A;  2Y1M A;  4I7C A;  2YW8 A;  1VFY A;  2M13 A;  2QIC A;  2QIZ A;  5G0F A;  5LCW B;  5TDR A;  4N3W A;  3O70 A;  4GNE A;  1WEV A;  2FD4 A;  1WE9 A;  4S3O C;  4QF2 A;  2LXH C;  2ECT A;  2MA5 A;  2L0B A;  2MNZ A;  5G05 B;  1T1H A;  2YVR A;  3N9Q A;  4NN2 A;  2FSA A;  3NG2 A;  3U5P A;  3MDB C;  2KWO A;  2KGG A;  2L43 A;  3SHB A;  5D1L B;  5KH9 A;  3N9P A;  1WEQ A;  4ZQL A;  2XP0 A;  4YC9 A;  3RTR B;  3N9L A;  3LJU X;  5AIU A;  3C6W A;  4QQ4 A;  2ECN A;  3ZYQ A;  4GND A;  2NAA A;  3U5O A;  3E2D A;  1WIL A;  3N9O A;  1X4U A;  1K2F A;  2YSM A;  5LKZ A;  2LGV A;  3KV6 A;  3EB6 A;  3DWD A;  4YAB A;  5FB1 A;  2CKL B;  2EGM A;  1IYM A;  1LDK C;  4UI9 B;  5B75 A;  3L1Z B;  4YAD A;  2LGG A;  3M63 A;  2KU3 A;  2LAU A;  2B0O E;  4QF3 A;  4X3G A;  2KWJ A;  4LK9 A;  1DVP A;  2K1J A;  3C5K A;  3O35 A;  4C9Z A;  5I3L A;  3ZNI A;  5LKX A;  2H0D B;  4OGE A;  3O36 A;  2AN6 A;  2LN0 A;  3PLW A;  2XB1 A;  5H1U A;  4V3K C;  4AUQ B;  2KGI A;  3SOU A;  1HYI A;  2VJE B;  1WIM A;  2D8S A;  4WA6 A;  5SVX A;  2D8U A;  1WEW A;  1XWH A;  2UZG A;  3DPL R;  5SVI B;  2CKL A;  5TBN A;  2CRW A;  5G04 B;  4FJC A;  4TKP B;  3ZPV E;  1JM7 B;  2VJF A;  2YUR A;  3FEH A;  4O62 A;  1CHC A;  1VYX A;  3MHH A;  4GNG A;  4Z0O A;  1G25 A;  3O7A A;  5C13 A;  4YBM A;  4LKA A;  2H0D A;  5FEY A;  2CT2 A;  4WZ0 A;  1WEO A;  4BHW A;  1X4J A;  2Y1N A;  4OGC A;  3PUQ A;  2EOD A;  2RI7 A;  2MA6 A;  5KH7 A;  3KNV A;  2VPD A;  4L7X A;  2JMD A;  2ECI A;  2RR4 A;  2FUU A;  1FBV A;  2DJA A;  3LQI A;  5C11 A;  5SVI A;  3SUB A;  5B78 A;  2ECG A;  1WES A;  1U6G B;  2KFT A;  2KE1 A;  1WFK A;  2PNX A;  1VD4 A;  3N9M A;  2PUY A;  4ZUX U;  3SOW A;  1RMD A;  2VP7 A;  4AYC B;  5JG6 A;  3L11 A;  1JOC A;  3Q1D A;  2K4D A;  2XOY A;  2YQL A;  2VNF A;  4LJN A;  2L80 A;  2C2L A;  2JMI A;  2Y43 A;  5LKT A;  4AVX A;  2G6Q A;  2XEU A;  3T6R A;  3KQI A;  1Z2Q A;  2LQ6 A;  4IC3 A;  4YAX A;  4MVT A;  1X4I A;  2IDA A;  2FUI A;  1LDJ B;  3O34 A;  4WZ2 A;  2KYU A;  5D1M B;  3ZTG A;  2IQJ A;  2E6S A;  4FO9 A;  4N4F A;  5TRB A;  2LXP C;  3FAN A;  4IC2 A;  5TDW A;  3FM8 C;  3ZVZ B;  2FFW A;  2OXQ C;  2YT5 A;  1FP0 A;  2YSJ A;  5B77 A;  4P5O B;  4AYC A;  3I2D A;  3LRQ A;  2P57 A;  5AIT A;  4W4U A;  5B76 A;  2MT5 A;  2ECV A;  3MHS A;  4ZDT A;  4A0C D;  2EA6 A;  2JM3 A;  3DQV R;  4R8P K;  3U5M A;  2OWA A;  2JUN A;  4WZ3 B;  5H1V A;  1HYJ A;  2K17 A;  2XOZ A;  1E4U A;  1DCQ A;  2F42 A;  3IHP A;  2CON A;  4A4B A;  2E61 A;  2EXU A;  3PUR A;  3T7L A;  2YYR A;  3HTK C;  4MSX A;  3HCU A;  3PHD A; 
#chains in the Genus database with same CATH homology
 4R7E A;  4YBT A;  5LKU A;  1MM3 A;  2KWN A;  3HCT A;  3O37 A;  2YRE A;  2LRI C;  2C2V S;  4UP0 A;  1N87 A;  2JMJ A;  2LGK A;  4O64 A;  2VPB A;  2HYE D;  2DX8 A;  2ECW A;  4FIP A;  2VJE A;  2HDP A;  3FL2 A;  3KV5 A;  2KIZ A;  4FK5 A;  5J3X A;  2YQM A;  3M99 A;  3GL6 A;  1JM7 A;  2YUC A;  2RSD A;  1ZBD B;  1WGM A;  2M85 A;  3HCS A;  5B79 A;  1Z60 A;  4B7Y C;  1BOR A;  4XI1 A;  2CSZ A;  2YHO A;  2ECJ A;  4L58 A;  3L1X A;  5H1T A;  5DIN A;  1WEU A;  2M6M A;  4B86 C;  2KWK A;  5KH3 A;  5TAB A;  2MD7 B;  4UP5 A;  1Z6U A;  4A4C A;  2JRJ A;  1F62 A;  4PTB A;  4A49 A;  5EYA F;  4YBS A;  4PPE A;  2KR4 A;  2VPE A;  4GB0 A;  3RPG B;  2QJ0 A;  3ZVY A;  2VJF B;  1WEP A;  5FER A;  3ZPV 1;  2LDR A;  2G45 A;  2L5U A;  3LQH A;  3VK6 A;  2MD8 C;  4R2Y A;  3ASL A;  1V87 A;  2KRE A;  4YAT A;  3LQJ A;  3O33 A;  3EB5 A;  3QZV A;  1WEN A;  4Q6F A;  3N9N A;  4V3L C;  4AP4 A;  3U5N A;  3GV4 A;  2LGL A;  5H9M A;  3RPG C;  2MIQ A;  2BAY A;  2MNY A;  2K16 A;  1MM2 A;  5D1K B;  5DKA A;  4I7B A;  2I50 A;  2CSY A;  2MUM A;  2G43 A;  2VPG A;  2M3H A;  2YU4 A;  4LLB A;  2YHN A;  5B8D A;  2ZET C;  1WEE A;  4CCG X;  2LV9 A;  4S3O B;  4I7D A;  4BBQ A;  2F6N A;  4F52 B;  4GNF A;  3M62 A;  2L75 A;  4LAD B;  1WEM A;  2EGP A;  3V43 A;  2M1R A;  3SOX A;  2F6J A;  2E6R A;  4CA1 A;  5FB0 A;  2Y1M A;  4I7C A;  2YW8 A;  1VFY A;  2QIC A;  2QIZ A;  5G0F A;  5LCW B;  5TDR A;  4N3W A;  3O70 A;  4GNE A;  1WEV A;  1WE9 A;  4S3O C;  4QF2 A;  2LXH C;  2ECT A;  2MA5 A;  2L0B A;  2MNZ A;  5G05 B;  1T1H A;  4NN2 A;  3N9Q A;  2FSA A;  3NG2 A;  3U5P A;  2KWO A;  2KGG A;  2L43 A;  3SHB A;  5D1L B;  5KH9 A;  3N9P A;  1WEQ A;  4ZQL A;  4YC9 A;  3RTR B;  3N9L A;  5AIU A;  3C6W A;  2ECN A;  3ZYQ A;  4GND A;  2NAA A;  3U5O A;  1WIL A;  3N9O A;  1X4U A;  1K2F A;  2YSM A;  5LKZ A;  2LGV A;  3KV6 A;  3EB6 A;  4YAB A;  5FB1 A;  2CKL B;  1IYM A;  1LDK C;  4UI9 B;  5B75 A;  3L1Z B;  4YAD A;  2LGG A;  3M63 A;  2KU3 A;  4QF3 A;  4X3G A;  2KWJ A;  4LK9 A;  1DVP A;  2K1J A;  3C5K A;  3O35 A;  4C9Z A;  5I3L A;  3ZNI A;  5LKX A;  2H0D B;  3O36 A;  2AN6 A;  2LN0 A;  2XB1 A;  5H1U A;  4V3K C;  4AUQ B;  2KGI A;  3SOU A;  1HYI A;  2VJE B;  1WIM A;  2D8S A;  4WA6 A;  1WEW A;  1XWH A;  2UZG A;  3DPL R;  2CKL A;  5TBN A;  5G04 B;  4FJC A;  4TKP B;  3ZPV E;  1JM7 B;  2VJF A;  2YUR A;  1CHC A;  1VYX A;  3MHH A;  4GNG A;  1G25 A;  3O7A A;  5C13 A;  4YBM A;  4LKA A;  2H0D A;  5FEY A;  2CT2 A;  4WZ0 A;  1WEO A;  4BHW A;  1X4J A;  2Y1N A;  3PUQ A;  2EOD A;  2RI7 A;  2MA6 A;  5KH7 A;  3KNV A;  2VPD A;  4L7X A;  2JMD A;  2ECI A;  2FUU A;  1FBV A;  3LQI A;  5C11 A;  5B78 A;  2ECG A;  1WES A;  1U6G B;  2KFT A;  2KE1 A;  1WFK A;  2PNX A;  1VD4 A;  3N9M A;  2PUY A;  4ZUX U;  3SOW A;  1RMD A;  2VP7 A;  4AYC B;  5JG6 A;  3L11 A;  1JOC A;  2K4D A;  2YQL A;  2VNF A;  4LJN A;  2L80 A;  2C2L A;  2JMI A;  2Y43 A;  5LKT A;  4AVX A;  2G6Q A;  2XEU A;  3T6R A;  3KQI A;  1Z2Q A;  2LQ6 A;  4IC3 A;  4YAX A;  4MVT A;  1X4I A;  2IDA A;  2FUI A;  1LDJ B;  3O34 A;  4WZ2 A;  2KYU A;  5D1M B;  3ZTG A;  2E6S A;  4FO9 A;  4N4F A;  5TRB A;  2LXP C;  4IC2 A;  5TDW A;  3ZVZ B;  2OXQ C;  2YT5 A;  1FP0 A;  2YSJ A;  5B77 A;  4P5O B;  4AYC A;  3I2D A;  3LRQ A;  5AIT A;  4W4U A;  5B76 A;  2MT5 A;  2ECV A;  3MHS A;  4ZDT A;  4A0C D;  2EA6 A;  3DQV R;  4R8P K;  3U5M A;  4WZ3 B;  5H1V A;  1HYJ A;  2K17 A;  1E4U A;  2F42 A;  3IHP A;  4A4B A;  3PUR A;  3T7L A;  2YYR A;  3HTK C;  4MSX A;  3HCU A;  3PHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...