3GL6A

Crystal structure of jarid1a-phd3 complexed with h3(1-9)k4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
52
structure length
52
Chain Sequence
b'SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone demethylase JARID1A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
pubmed doi rcsb
total genus 8
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3gl6A01
4GNEA 2VJEA 3L1ZB 1F62A 2VNFA 2PUYA 3LQJA 4QF2A 3MHSA 4B86C 3PHDA 5D1MB 5B8DA 5FB0A 2M3HA 2Y1MA 2YU4A 4NN2A 3NG2A 4LKAA 1Z60A 4CCGX 1WEWA 2KWJA 2YT5A 4N3WA 3HCTA 2ECJA 5H1TA 1WEUA 3C5KA 5H1VA 2LN0A 2DX8A 5FERA 3KV5A 4L58A 3N9QA 2M6MA 1WIMA 2KGIA 2ECNA 2VP7A 4WZ0A 2YHNA 4YADA 1HYIA 4S3OB 2CSZA 3HTKC 1IYMA 1MM2A 2FSAA 1U6GB 1WGMA 2M1RA 3U5NA 4AP4A 4P5OB 2ZETC 5KH9A 4YABA 2YREA 1WILA 3GL6A 3ZVYA 4YBTA 5KH7A 2KYUA 4B7YC 5LKTA 2L43A 4UP0A 4FIPA 2C2LA 4GNFA 2KWNA 2CKLA 4LK9A 4AUQB 2UZGA 1WEVA 4LLBA 2YQLA 4ZDTA 1V87A 2VJFA 3SHBA 4L7XA 2YW8A 4YC9A 5H1UA 4CA1A 3N9PA 4WA6A 1E4UA 2VPGA 2MNZA 3PURA 2EGPA 2QICA 4AYCA 4R8PK 3PUQA 3RPGB 1T1HA 4A0CD 2XB1A 5DKAA 4A4CA 2FUUA 5B79A 2ECTA 1LDKC 2MA5A 4X3GA 2KR4A 2KE1A 5G05B 4I7CA 3T7LA 5D1LB 2LGLA 3KV6A 3U5MA 5B75A 5LCWB 2KWKA 2QJ0A 1X4JA 2G45A 3IHPA 2RI7A 3DQVR 2Y43A 3U5OA 2KGGA 3N9LA 1N87A 2E6SA 4XI1A 4QF3A 3N9NA 3SOUA 5G0FA 5KH3A 1WEEA 2ECVA 2H0DA 3FL2A 4LJNA 3N9MA 1G25A 2F6NA 3RPGC 5C13A 5B77A 3RTRB 2MA6A 2MIQA 2YQMA 4YAXA 2NAAA 4BBQA 2QIZA 2OXQC 3M62A 4ZUXU 1VYXA 2KWOA 4V3LC 3O36A 1WEQA 3GV4A 4Q6FA 1XWHA 3SOWA 2M85A 3ZPV1 3O37A 2ECIA 1WFKA 2LGGA 5AIUA 1VFYA 4ZQLA 3ASLA 3L11A 2F6JA 1WE9A 5FB1A 1RMDA 1BORA 2ECWA 3KQIA 2VJEB 4WZ2A 3O70A 3LQIA 2LXHC 4FK5A 3EB6A 2VPEA 2LV9A 4I7BA 2XEUA 4UP5A 1X4UA 3DPLR 4LADB 4R7EA 2YUCA 2PNXA 2K1JA 2HYED 4O64A 3C6WA 4MVTA 3VK6A 1CHCA 2K17A 3T6RA 2D8SA 4GNDA 2LGVA 2YURA 1JM7B 2G6QA 5AITA 5TDWA 3KNVA 4IC2A 2AN6A 5DINA 2MNYA 1LDJB 3V43A 1Z2QA 2C2VS 2VPBA 2I50A 4BHWA 2CT2A 3O7AA 5D1KB 5TDRA 4YBMA 2YSMA 3O35A 4N4FA 5C11A 2JMDA 4FO9A 3ZNIA 1WEOA 2LDRA 3O34A 4PPEA 5I3LA 5J3XA 3EB5A 2ECGA 2VJFB 2L5UA 1FBVA 5H9MA 3MHHA 1MM3A 2LRIC 2FUIA 2MT5A 4S3OC 2LXPC 4AYCB 2K4DA 5LKZA 2EODA 2CKLB 3ZVZB 2L80A 1JM7A 5G04B 1WEPA 2VPDA 1X4IA 2Y1NA 2LGKA 2JMIA 3O33A 1Z6UA 2CSYA 2L75A 1DVPA 4R2YA 3ZTGA 5EYAF 2LQ6A 1JOCA 2KIZA 2YSJA 4PTBA 3ZYQA 5LKUA 3QZVA 1WESA 3LQHA 3SOXA 4V3KC 3ZPVE 2K16A 4C9ZA 2MD8C 5LKXA 2KREA 2RSDA 4GNGA 1ZBDB 2EA6A 2YYRA 4AVXA 5B76A 2H0DB 4WZ3B 4UI9B 4GB0A 4IC3A 3HCSA 5TABA 1K2FA 3N9OA 2E6RA 3M99A 2L0BA 4A49A 4A4BA 5B78A 2YHOA 2MD7B 2JMJA 2KU3A 1FP0A 2KFTA 4YATA 4F52B 1VD4A 3M63A 1WEMA 2BAYA 5FEYA 4MSXA 4YBSA 4FJCA 2JRJA 3HCUA 2MUMA 3U5PA 4I7DA 4TKPB 2HDPA 1HYJA 3LRQA 5TBNA 2F42A 5TRBA 2IDAA 4W4UA 5JG6A 1WENA 3I2DA 2G43A 3L1XA
chains in the Genus database with same CATH superfamily
4GNEA 2VJEA 3L1ZB 1F62A 2VNFA 2PUYA 3MDBC 3LQJA 4OGEA 4QF2A 3MHSA 4B86C 3PHDA 5D1MB 5B8DA 5FB0A 2M3HA 2Y1MA 2YU4A 4NN2A 3NG2A 4LKAA 1Z60A 4CCGX 2MKEA 1WEWA 2M13A 2KWJA 2FD4A 3H7HA 2FFWA 2YT5A 4N3WA 3HCTA 2ECJA 5H1TA 1WEUA 3C5KA 5H1VA 2LN0A 2DX8A 5FERA 3KV5A 4L58A 3N9QA 2M6MA 1WIMA 2KGIA 2ECNA 2VP7A 4WZ0A 2YHNA 4OGCA 4YADA 1HYIA 4S3OB 2CSZA 3HTKC 1IYMA 1MM2A 2FSAA 1U6GB 2CRWA 1WGMA 4H9DA 2M1RA 3U5NA 5SVIA 4AP4A 4P5OB 2ZETC 5KH9A 4YABA 2YREA 1WILA 3GL6A 1MBMA 3ZVYA 4YBTA 5KH7A 2KYUA 4B7YC 4F1PA 5LKTA 2L43A 4UP0A 4FIPA 2C2LA 4GNFA 2KWNA 2DSMA 2CKLA 4LK9A 4AUQB 2UZGA 1WEVA 4LLBA 2YQLA 4ZDTA 3LDYA 3SUBA 1V87A 2VJFA 3SHBA 4L7XA 2YW8A 4YC9A 5H1UA 4CA1A 3N9PA 4WA6A 1E4UA 2VPGA 2MNZA 3PURA 2EGPA 2QICA 4AYCA 2L7PA 4R8PK 3PUQA 3RPGB 1T1HA 4A0CD 2XB1A 5DKAA 2FUUA 4A4CA 5B79A 2ECTA 1LDKC 2MA5A 2LAUA 4X3GA 2KR4A 2KE1A 5G05B 4I7CA 3T7LA 5D1LB 2LGLA 3KV6A 3U5MA 5B75A 5LCWB 2KWKA 2QJ0A 3E2DA 1X4JA 2G45A 2DJAA 3IHPA 2RI7A 3DQVR 2Y43A 3U5OA 2KGGA 3N9LA 1N87A 2E6SA 4XI1A 2XP0A 4QF3A 3N9NA 3SOUA 5G0FA 5KH3A 5SVIB 1WEEA 2ECVA 2H0DA 3FL2A 4LJNA 3N9MA 1G25A 2F6NA 3RPGC 5C13A 5B77A 3RTRB 2MA6A 2MIQA 2YQMA 2JUNA 4YAXA 2NAAA 4BBQA 2QIZA 2OXQC 3M62A 4ZUXU 1VYXA 2KWOA 4V3LC 3O36A 1WEQA 3GV4A 4Q6FA 1XWHA 2RR4A 3SOWA 2M85A 3ZPV1 3O37A 3FM8C 3FEHA 2ECIA 1WFKA 2LGGA 5AIUA 1VFYA 4ZQLA 3ASLA 3L11A 2F6JA 2XOCA 1WE9A 2YVRA 5FB1A 1RMDA 1BORA 2ECWA 3KQIA 2VJEB 2EGMA 4WZ2A 3O70A 3LQIA 2LXHC 4FK5A 3EB6A 2VPEA 3DWDA 2LV9A 4I7BA 2XEUA 4UP5A 1X4UA 3DPLR 4LADB 4R7EA 2KKXA 2YUCA 4Z0OA 2PNXA 2K1JA 3LJUX 2HYED 4O64A 3T9KA 1DCQA 3C6WA 3LVQE 2CSVA 2E61A 4QQ4A 4MVTA 3VK6A 3DDTA 1CHCA 2K17A 2XOYA 3T6RA 3Q1DA 2D8SA 4GNDA 2B0OE 2LGVA 2YURA 1JM7B 2G6QA 5AITA 5TDWA 3KNVA 5K3QA 4IC2A 2AN6A 5DINA 2MNYA 1LDJB 3V43A 1Z2QA 2C2VS 2VPBA 2I50A 4BHWA 2CT2A 3O7AA 5D1KB 5TDRA 4YBMA 2YSMA 3O35A 4N4FA 5C11A 2JMDA 4FO9A 3ZNIA 1WEOA 2LDRA 3O34A 4PPEA 5I3LA 5SVXA 2CRRA 5J3XA 3EB5A 5SVYA 2ECGA 2VJFB 2L5UA 1FBVA 5H9MA 3MHHA 3PLWA 1MM3A 2LRIC 2FUIA 2MT5A 3FAOA 4S3OC 2LXPC 2D8UA 4AYCB 4O62A 2K4DA 5LKZA 2EODA 2P57A 2CKLB 3ZVZB 2L80A 1JM7A 5G04B 1WEPA 2XOZA 2VPDA 1X4IA 2Y1NA 2LGKA 2JMIA 3O33A 1Z6UA 2CSYA 2L75A 1DVPA 4R2YA 3ZTGA 5EYAF 2LQ6A 1JOCA 2KIZA 2YSJA 4PTBA 3ZYQA 5LKUA 3O47A 3QZVA 1WESA 3LQHA 3SOXA 4V3KC 2IQJA 3ZPVE 3M7KA 3LVRE 2K16A 4C9ZA 2MD8C 5LKXA 2KREA 2EXUA 2RSDA 4GNGA 1ZBDB 2EA6A 2YYRA 4AVXA 5B76A 2H0DB 4WZ3B 3FANA 4UI9B 4GB0A 4IC3A 3HCSA 5TABA 1K2FA 3N9OA 2JM3A 2E6RA 3M99A 2KKYA 2L0BA 4A49A 4A4BA 5B78A 2YHOA 2MD7B 2JMJA 2KU3A 3JUEA 1FP0A 2KFTA 4YATA 4F52B 1VD4A 3M63A 1WEMA 2BAYA 5FEYA 4MSXA 4YBSA 4FJCA 4Z0RA 2JRJA 3HCUA 2MUMA 2CONA 3U5PA 3KDEC 4I7DA 4TKPB 2HDPA 1HYJA 3LRQA 5TBNA 2F42A 5TRBA 3FJUB 2IDAA 4W4UA 5JG6A 1WENA 3I2DA 2G43A 3L1XA 2OWAA
chains in the Genus database with same CATH topology
4GNEA 2VJEA 3L1ZB 1F62A 2VNFA 2PUYA 3LQJA 4QF2A 3MHSA 4B86C 3PHDA 5D1MB 5B8DA 5FB0A 2M3HA 2Y1MA 2YU4A 4NN2A 3NG2A 4LKAA 1Z60A 4CCGX 1WEWA 2KWJA 2YT5A 4N3WA 3HCTA 2ECJA 5H1TA 1WEUA 3C5KA 5H1VA 2LN0A 2DX8A 5FERA 3KV5A 4L58A 3N9QA 2M6MA 1WIMA 2KGIA 2ECNA 2VP7A 4WZ0A 2YHNA 4YADA 1HYIA 4S3OB 2CSZA 3HTKC 1IYMA 1MM2A 2FSAA 1U6GB 1WGMA 2M1RA 3U5NA 4AP4A 4P5OB 2ZETC 5KH9A 4YABA 2YREA 1WILA 3GL6A 3ZVYA 4YBTA 5KH7A 2KYUA 4B7YC 5LKTA 2L43A 4UP0A 4FIPA 2C2LA 4GNFA 2KWNA 2CKLA 4LK9A 4AUQB 2UZGA 1WEVA 4LLBA 2YQLA 4ZDTA 1V87A 2VJFA 3SHBA 4L7XA 2YW8A 4YC9A 5H1UA 4CA1A 3N9PA 4WA6A 1E4UA 2VPGA 2MNZA 3PURA 2EGPA 2QICA 4AYCA 4R8PK 3PUQA 3RPGB 1T1HA 4A0CD 2XB1A 5DKAA 4A4CA 2FUUA 5B79A 2ECTA 1LDKC 2MA5A 4X3GA 2KR4A 2KE1A 5G05B 4I7CA 3T7LA 5D1LB 2LGLA 3KV6A 3U5MA 5B75A 5LCWB 2KWKA 2QJ0A 1X4JA 2G45A 3IHPA 2RI7A 3DQVR 2Y43A 3U5OA 2KGGA 3N9LA 1N87A 2E6SA 4XI1A 4QF3A 3N9NA 3SOUA 5G0FA 5KH3A 1WEEA 2ECVA 2H0DA 3FL2A 4LJNA 3N9MA 1G25A 2F6NA 3RPGC 5C13A 5B77A 3RTRB 2MA6A 2MIQA 2YQMA 4YAXA 2NAAA 4BBQA 2QIZA 2OXQC 3M62A 4ZUXU 1VYXA 2KWOA 4V3LC 3O36A 1WEQA 3GV4A 4Q6FA 1XWHA 3SOWA 2M85A 3ZPV1 3O37A 2ECIA 1WFKA 2LGGA 5AIUA 1VFYA 4ZQLA 3ASLA 3L11A 2F6JA 1WE9A 5FB1A 1RMDA 1BORA 2ECWA 3KQIA 2VJEB 4WZ2A 3O70A 3LQIA 2LXHC 4FK5A 3EB6A 2VPEA 2LV9A 4I7BA 2XEUA 4UP5A 1X4UA 3DPLR 4LADB 4R7EA 2YUCA 2PNXA 2K1JA 2HYED 4O64A 3C6WA 4MVTA 3VK6A 1CHCA 2K17A 3T6RA 2D8SA 4GNDA 2LGVA 2YURA 1JM7B 2G6QA 5AITA 5TDWA 3KNVA 4IC2A 2AN6A 5DINA 2MNYA 1LDJB 3V43A 1Z2QA 2C2VS 2VPBA 2I50A 4BHWA 2CT2A 3O7AA 5D1KB 5TDRA 4YBMA 2YSMA 3O35A 4N4FA 5C11A 2JMDA 4FO9A 3ZNIA 1WEOA 2LDRA 3O34A 4PPEA 5I3LA 5J3XA 3EB5A 2ECGA 2VJFB 2L5UA 1FBVA 5H9MA 3MHHA 1MM3A 2LRIC 2FUIA 2MT5A 4S3OC 2LXPC 4AYCB 2K4DA 5LKZA 2EODA 2CKLB 3ZVZB 2L80A 1JM7A 5G04B 1WEPA 2VPDA 1X4IA 2Y1NA 2LGKA 2JMIA 3O33A 1Z6UA 2CSYA 2L75A 1DVPA 4R2YA 3ZTGA 5EYAF 2LQ6A 1JOCA 2KIZA 2YSJA 4PTBA 3ZYQA 5LKUA 3QZVA 1WESA 3LQHA 3SOXA 4V3KC 3ZPVE 2K16A 4C9ZA 2MD8C 5LKXA 2KREA 2RSDA 4GNGA 1ZBDB 2EA6A 2YYRA 4AVXA 5B76A 2H0DB 4WZ3B 4UI9B 4GB0A 4IC3A 3HCSA 5TABA 1K2FA 3N9OA 2E6RA 3M99A 2L0BA 4A49A 4A4BA 5B78A 2YHOA 2MD7B 2JMJA 2KU3A 1FP0A 2KFTA 4YATA 4F52B 1VD4A 3M63A 1WEMA 2BAYA 5FEYA 4MSXA 4YBSA 4FJCA 2JRJA 3HCUA 2MUMA 3U5PA 4I7DA 4TKPB 2HDPA 1HYJA 3LRQA 5TBNA 2F42A 5TRBA 2IDAA 4W4UA 5JG6A 1WENA 3I2DA 2G43A 3L1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNE A;  2VJE A;  3L1Z B;  1F62 A;  2VNF A;  2PUY A;  3LQJ A;  4QF2 A;  3MHS A;  4B86 C;  3PHD A;  5D1M B;  5B8D A;  5FB0 A;  2M3H A;  2Y1M A;  2YU4 A;  4NN2 A;  3NG2 A;  4LKA A;  1Z60 A;  4CCG X;  1WEW A;  2KWJ A;  2YT5 A;  4N3W A;  3HCT A;  2ECJ A;  5H1T A;  1WEU A;  3C5K A;  5H1V A;  2LN0 A;  2DX8 A;  5FER A;  3KV5 A;  4L58 A;  3N9Q A;  2M6M A;  1WIM A;  2KGI A;  2ECN A;  2VP7 A;  4WZ0 A;  2YHN A;  4YAD A;  1HYI A;  4S3O B;  2CSZ A;  3HTK C;  1IYM A;  1MM2 A;  2FSA A;  1U6G B;  1WGM A;  2M1R A;  3U5N A;  4AP4 A;  4P5O B;  2ZET C;  5KH9 A;  4YAB A;  2YRE A;  1WIL A;  3GL6 A;  3ZVY A;  4YBT A;  5KH7 A;  2KYU A;  4B7Y C;  5LKT A;  2L43 A;  4UP0 A;  4FIP A;  2C2L A;  4GNF A;  2KWN A;  2CKL A;  4LK9 A;  4AUQ B;  2UZG A;  1WEV A;  4LLB A;  2YQL A;  4ZDT A;  1V87 A;  2VJF A;  3SHB A;  4L7X A;  2YW8 A;  4YC9 A;  5H1U A;  4CA1 A;  3N9P A;  4WA6 A;  1E4U A;  2VPG A;  2MNZ A;  3PUR A;  2EGP A;  2QIC A;  4AYC A;  4R8P K;  3PUQ A;  3RPG B;  1T1H A;  4A0C D;  2XB1 A;  5DKA A;  4A4C A;  2FUU A;  5B79 A;  2ECT A;  1LDK C;  2MA5 A;  4X3G A;  2KR4 A;  2KE1 A;  5G05 B;  4I7C A;  3T7L A;  5D1L B;  2LGL A;  3KV6 A;  3U5M A;  5B75 A;  5LCW B;  2KWK A;  2QJ0 A;  1X4J A;  2G45 A;  3IHP A;  2RI7 A;  3DQV R;  2Y43 A;  3U5O A;  2KGG A;  3N9L A;  1N87 A;  2E6S A;  4XI1 A;  4QF3 A;  3N9N A;  3SOU A;  5G0F A;  5KH3 A;  1WEE A;  2ECV A;  2H0D A;  3FL2 A;  4LJN A;  3N9M A;  1G25 A;  2F6N A;  3RPG C;  5C13 A;  5B77 A;  3RTR B;  2MA6 A;  2MIQ A;  2YQM A;  4YAX A;  2NAA A;  4BBQ A;  2QIZ A;  2OXQ C;  3M62 A;  4ZUX U;  1VYX A;  2KWO A;  4V3L C;  3O36 A;  1WEQ A;  3GV4 A;  4Q6F A;  1XWH A;  3SOW A;  2M85 A;  3ZPV 1;  3O37 A;  2ECI A;  1WFK A;  2LGG A;  5AIU A;  1VFY A;  4ZQL A;  3ASL A;  3L11 A;  2F6J A;  1WE9 A;  5FB1 A;  1RMD A;  1BOR A;  2ECW A;  3KQI A;  2VJE B;  4WZ2 A;  3O70 A;  3LQI A;  2LXH C;  4FK5 A;  3EB6 A;  2VPE A;  2LV9 A;  4I7B A;  2XEU A;  4UP5 A;  1X4U A;  3DPL R;  4LAD B;  4R7E A;  2YUC A;  2PNX A;  2K1J A;  2HYE D;  4O64 A;  3C6W A;  4MVT A;  3VK6 A;  1CHC A;  2K17 A;  3T6R A;  2D8S A;  4GND A;  2LGV A;  2YUR A;  1JM7 B;  2G6Q A;  5AIT A;  5TDW A;  3KNV A;  4IC2 A;  2AN6 A;  5DIN A;  2MNY A;  1LDJ B;  3V43 A;  1Z2Q A;  2C2V S;  2VPB A;  2I50 A;  4BHW A;  2CT2 A;  3O7A A;  5D1K B;  5TDR A;  4YBM A;  2YSM A;  3O35 A;  4N4F A;  5C11 A;  2JMD A;  4FO9 A;  3ZNI A;  1WEO A;  2LDR A;  3O34 A;  4PPE A;  5I3L A;  5J3X A;  3EB5 A;  2ECG A;  2VJF B;  2L5U A;  1FBV A;  5H9M A;  3MHH A;  1MM3 A;  2LRI C;  2FUI A;  2MT5 A;  4S3O C;  2LXP C;  4AYC B;  2K4D A;  5LKZ A;  2EOD A;  2CKL B;  3ZVZ B;  2L80 A;  1JM7 A;  5G04 B;  1WEP A;  2VPD A;  1X4I A;  2Y1N A;  2LGK A;  2JMI A;  3O33 A;  1Z6U A;  2CSY A;  2L75 A;  1DVP A;  4R2Y A;  3ZTG A;  5EYA F;  2LQ6 A;  1JOC A;  2KIZ A;  2YSJ A;  4PTB A;  3ZYQ A;  5LKU A;  3QZV A;  1WES A;  3LQH A;  3SOX A;  4V3K C;  3ZPV E;  2K16 A;  4C9Z A;  2MD8 C;  5LKX A;  2KRE A;  2RSD A;  4GNG A;  1ZBD B;  2EA6 A;  2YYR A;  4AVX A;  5B76 A;  2H0D B;  4WZ3 B;  4UI9 B;  4GB0 A;  4IC3 A;  3HCS A;  5TAB A;  1K2F A;  3N9O A;  2E6R A;  3M99 A;  2L0B A;  4A49 A;  4A4B A;  5B78 A;  2YHO A;  2MD7 B;  2JMJ A;  2KU3 A;  1FP0 A;  2KFT A;  4YAT A;  4F52 B;  1VD4 A;  3M63 A;  1WEM A;  2BAY A;  5FEY A;  4MSX A;  4YBS A;  4FJC A;  2JRJ A;  3HCU A;  2MUM A;  3U5P A;  4I7D A;  4TKP B;  2HDP A;  1HYJ A;  3LRQ A;  5TBN A;  2F42 A;  5TRB A;  2IDA A;  4W4U A;  5JG6 A;  1WEN A;  3I2D A;  2G43 A;  3L1X A; 
#chains in the Genus database with same CATH topology
 4GNE A;  2VJE A;  3L1Z B;  1F62 A;  2VNF A;  2PUY A;  3MDB C;  3LQJ A;  4OGE A;  4QF2 A;  3MHS A;  4B86 C;  3PHD A;  5D1M B;  5B8D A;  5FB0 A;  2M3H A;  2Y1M A;  2YU4 A;  4NN2 A;  3NG2 A;  4LKA A;  1Z60 A;  4CCG X;  2MKE A;  1WEW A;  2M13 A;  2KWJ A;  2FD4 A;  3H7H A;  2FFW A;  2YT5 A;  4N3W A;  3HCT A;  2ECJ A;  5H1T A;  1WEU A;  3C5K A;  5H1V A;  2LN0 A;  2DX8 A;  5FER A;  3KV5 A;  4L58 A;  3N9Q A;  2M6M A;  1WIM A;  2KGI A;  2ECN A;  2VP7 A;  4WZ0 A;  2YHN A;  4OGC A;  4YAD A;  1HYI A;  4S3O B;  2CSZ A;  3HTK C;  1IYM A;  1MM2 A;  2FSA A;  1U6G B;  2CRW A;  1WGM A;  4H9D A;  2M1R A;  3U5N A;  5SVI A;  4AP4 A;  4P5O B;  2ZET C;  5KH9 A;  4YAB A;  2YRE A;  1WIL A;  3GL6 A;  1MBM A;  3ZVY A;  4YBT A;  5KH7 A;  2KYU A;  4B7Y C;  4F1P A;  5LKT A;  2L43 A;  4UP0 A;  4FIP A;  2C2L A;  4GNF A;  2KWN A;  2DSM A;  2CKL A;  4LK9 A;  4AUQ B;  2UZG A;  1WEV A;  4LLB A;  2YQL A;  4ZDT A;  3LDY A;  3SUB A;  1V87 A;  2VJF A;  3SHB A;  4L7X A;  2YW8 A;  4YC9 A;  5H1U A;  4CA1 A;  3N9P A;  4WA6 A;  1E4U A;  2VPG A;  2MNZ A;  3PUR A;  2EGP A;  2QIC A;  4AYC A;  2L7P A;  4R8P K;  3PUQ A;  3RPG B;  1T1H A;  4A0C D;  2XB1 A;  5DKA A;  2FUU A;  4A4C A;  5B79 A;  2ECT A;  1LDK C;  2MA5 A;  2LAU A;  4X3G A;  2KR4 A;  2KE1 A;  5G05 B;  4I7C A;  3T7L A;  5D1L B;  2LGL A;  3KV6 A;  3U5M A;  5B75 A;  5LCW B;  2KWK A;  2QJ0 A;  3E2D A;  1X4J A;  2G45 A;  2DJA A;  3IHP A;  2RI7 A;  3DQV R;  2Y43 A;  3U5O A;  2KGG A;  3N9L A;  1N87 A;  2E6S A;  4XI1 A;  2XP0 A;  4QF3 A;  3N9N A;  3SOU A;  5G0F A;  5KH3 A;  5SVI B;  1WEE A;  2ECV A;  2H0D A;  3FL2 A;  4LJN A;  3N9M A;  1G25 A;  2F6N A;  3RPG C;  5C13 A;  5B77 A;  3RTR B;  2MA6 A;  2MIQ A;  2YQM A;  2JUN A;  4YAX A;  2NAA A;  4BBQ A;  2QIZ A;  2OXQ C;  3M62 A;  4ZUX U;  1VYX A;  2KWO A;  4V3L C;  3O36 A;  1WEQ A;  3GV4 A;  4Q6F A;  1XWH A;  2RR4 A;  3SOW A;  2M85 A;  3ZPV 1;  3O37 A;  3FM8 C;  3FEH A;  2ECI A;  1WFK A;  2LGG A;  5AIU A;  1VFY A;  4ZQL A;  3ASL A;  3L11 A;  2F6J A;  2XOC A;  1WE9 A;  2YVR A;  5FB1 A;  1RMD A;  1BOR A;  2ECW A;  3KQI A;  2VJE B;  2EGM A;  4WZ2 A;  3O70 A;  3LQI A;  2LXH C;  4FK5 A;  3EB6 A;  2VPE A;  3DWD A;  2LV9 A;  4I7B A;  2XEU A;  4UP5 A;  1X4U A;  3DPL R;  4LAD B;  4R7E A;  2KKX A;  2YUC A;  4Z0O A;  2PNX A;  2K1J A;  3LJU X;  2HYE D;  4O64 A;  3T9K A;  1DCQ A;  3C6W A;  3LVQ E;  2CSV A;  2E61 A;  4QQ4 A;  4MVT A;  3VK6 A;  3DDT A;  1CHC A;  2K17 A;  2XOY A;  3T6R A;  3Q1D A;  2D8S A;  4GND A;  2B0O E;  2LGV A;  2YUR A;  1JM7 B;  2G6Q A;  5AIT A;  5TDW A;  3KNV A;  5K3Q A;  4IC2 A;  2AN6 A;  5DIN A;  2MNY A;  1LDJ B;  3V43 A;  1Z2Q A;  2C2V S;  2VPB A;  2I50 A;  4BHW A;  2CT2 A;  3O7A A;  5D1K B;  5TDR A;  4YBM A;  2YSM A;  3O35 A;  4N4F A;  5C11 A;  2JMD A;  4FO9 A;  3ZNI A;  1WEO A;  2LDR A;  3O34 A;  4PPE A;  5I3L A;  5SVX A;  2CRR A;  5J3X A;  3EB5 A;  5SVY A;  2ECG A;  2VJF B;  2L5U A;  1FBV A;  5H9M A;  3MHH A;  3PLW A;  1MM3 A;  2LRI C;  2FUI A;  2MT5 A;  3FAO A;  4S3O C;  2LXP C;  2D8U A;  4AYC B;  4O62 A;  2K4D A;  5LKZ A;  2EOD A;  2P57 A;  2CKL B;  3ZVZ B;  2L80 A;  1JM7 A;  5G04 B;  1WEP A;  2XOZ A;  2VPD A;  1X4I A;  2Y1N A;  2LGK A;  2JMI A;  3O33 A;  1Z6U A;  2CSY A;  2L75 A;  1DVP A;  4R2Y A;  3ZTG A;  5EYA F;  2LQ6 A;  1JOC A;  2KIZ A;  2YSJ A;  4PTB A;  3ZYQ A;  5LKU A;  3O47 A;  3QZV A;  1WES A;  3LQH A;  3SOX A;  4V3K C;  2IQJ A;  3ZPV E;  3M7K A;  3LVR E;  2K16 A;  4C9Z A;  2MD8 C;  5LKX A;  2KRE A;  2EXU A;  2RSD A;  4GNG A;  1ZBD B;  2EA6 A;  2YYR A;  4AVX A;  5B76 A;  2H0D B;  4WZ3 B;  3FAN A;  4UI9 B;  4GB0 A;  4IC3 A;  3HCS A;  5TAB A;  1K2F A;  3N9O A;  2JM3 A;  2E6R A;  3M99 A;  2KKY A;  2L0B A;  4A49 A;  4A4B A;  5B78 A;  2YHO A;  2MD7 B;  2JMJ A;  2KU3 A;  3JUE A;  1FP0 A;  2KFT A;  4YAT A;  4F52 B;  1VD4 A;  3M63 A;  1WEM A;  2BAY A;  5FEY A;  4MSX A;  4YBS A;  4FJC A;  4Z0R A;  2JRJ A;  3HCU A;  2MUM A;  2CON A;  3U5P A;  3KDE C;  4I7D A;  4TKP B;  2HDP A;  1HYJ A;  3LRQ A;  5TBN A;  2F42 A;  5TRB A;  3FJU B;  2IDA A;  4W4U A;  5JG6 A;  1WEN A;  3I2D A;  2G43 A;  3L1X A;  2OWA A; 
#chains in the Genus database with same CATH homology
 4GNE A;  2VJE A;  3L1Z B;  1F62 A;  2VNF A;  2PUY A;  3LQJ A;  4QF2 A;  3MHS A;  4B86 C;  3PHD A;  5D1M B;  5B8D A;  5FB0 A;  2M3H A;  2Y1M A;  2YU4 A;  4NN2 A;  3NG2 A;  4LKA A;  1Z60 A;  4CCG X;  1WEW A;  2KWJ A;  2YT5 A;  4N3W A;  3HCT A;  2ECJ A;  5H1T A;  1WEU A;  3C5K A;  5H1V A;  2LN0 A;  2DX8 A;  5FER A;  3KV5 A;  4L58 A;  3N9Q A;  2M6M A;  1WIM A;  2KGI A;  2ECN A;  2VP7 A;  4WZ0 A;  2YHN A;  4YAD A;  1HYI A;  4S3O B;  2CSZ A;  3HTK C;  1IYM A;  1MM2 A;  2FSA A;  1U6G B;  1WGM A;  2M1R A;  3U5N A;  4AP4 A;  4P5O B;  2ZET C;  5KH9 A;  4YAB A;  2YRE A;  1WIL A;  3GL6 A;  3ZVY A;  4YBT A;  5KH7 A;  2KYU A;  4B7Y C;  5LKT A;  2L43 A;  4UP0 A;  4FIP A;  2C2L A;  4GNF A;  2KWN A;  2CKL A;  4LK9 A;  4AUQ B;  2UZG A;  1WEV A;  4LLB A;  2YQL A;  4ZDT A;  1V87 A;  2VJF A;  3SHB A;  4L7X A;  2YW8 A;  4YC9 A;  5H1U A;  4CA1 A;  3N9P A;  4WA6 A;  1E4U A;  2VPG A;  2MNZ A;  3PUR A;  2EGP A;  2QIC A;  4AYC A;  4R8P K;  3PUQ A;  3RPG B;  1T1H A;  4A0C D;  2XB1 A;  5DKA A;  4A4C A;  2FUU A;  5B79 A;  2ECT A;  1LDK C;  2MA5 A;  4X3G A;  2KR4 A;  2KE1 A;  5G05 B;  4I7C A;  3T7L A;  5D1L B;  2LGL A;  3KV6 A;  3U5M A;  5B75 A;  5LCW B;  2KWK A;  2QJ0 A;  1X4J A;  2G45 A;  3IHP A;  2RI7 A;  3DQV R;  2Y43 A;  3U5O A;  2KGG A;  3N9L A;  1N87 A;  2E6S A;  4XI1 A;  4QF3 A;  3N9N A;  3SOU A;  5G0F A;  5KH3 A;  1WEE A;  2ECV A;  2H0D A;  3FL2 A;  4LJN A;  3N9M A;  1G25 A;  2F6N A;  3RPG C;  5C13 A;  5B77 A;  3RTR B;  2MA6 A;  2MIQ A;  2YQM A;  4YAX A;  2NAA A;  4BBQ A;  2QIZ A;  2OXQ C;  3M62 A;  4ZUX U;  1VYX A;  2KWO A;  4V3L C;  3O36 A;  1WEQ A;  3GV4 A;  4Q6F A;  1XWH A;  3SOW A;  2M85 A;  3ZPV 1;  3O37 A;  2ECI A;  1WFK A;  2LGG A;  5AIU A;  1VFY A;  4ZQL A;  3ASL A;  3L11 A;  2F6J A;  1WE9 A;  5FB1 A;  1RMD A;  1BOR A;  2ECW A;  3KQI A;  2VJE B;  4WZ2 A;  3O70 A;  3LQI A;  2LXH C;  4FK5 A;  3EB6 A;  2VPE A;  2LV9 A;  4I7B A;  2XEU A;  4UP5 A;  1X4U A;  3DPL R;  4LAD B;  4R7E A;  2YUC A;  2PNX A;  2K1J A;  2HYE D;  4O64 A;  3C6W A;  4MVT A;  3VK6 A;  1CHC A;  2K17 A;  3T6R A;  2D8S A;  4GND A;  2LGV A;  2YUR A;  1JM7 B;  2G6Q A;  5AIT A;  5TDW A;  3KNV A;  4IC2 A;  2AN6 A;  5DIN A;  2MNY A;  1LDJ B;  3V43 A;  1Z2Q A;  2C2V S;  2VPB A;  2I50 A;  4BHW A;  2CT2 A;  3O7A A;  5D1K B;  5TDR A;  4YBM A;  2YSM A;  3O35 A;  4N4F A;  5C11 A;  2JMD A;  4FO9 A;  3ZNI A;  1WEO A;  2LDR A;  3O34 A;  4PPE A;  5I3L A;  5J3X A;  3EB5 A;  2ECG A;  2VJF B;  2L5U A;  1FBV A;  5H9M A;  3MHH A;  1MM3 A;  2LRI C;  2FUI A;  2MT5 A;  4S3O C;  2LXP C;  4AYC B;  2K4D A;  5LKZ A;  2EOD A;  2CKL B;  3ZVZ B;  2L80 A;  1JM7 A;  5G04 B;  1WEP A;  2VPD A;  1X4I A;  2Y1N A;  2LGK A;  2JMI A;  3O33 A;  1Z6U A;  2CSY A;  2L75 A;  1DVP A;  4R2Y A;  3ZTG A;  5EYA F;  2LQ6 A;  1JOC A;  2KIZ A;  2YSJ A;  4PTB A;  3ZYQ A;  5LKU A;  3QZV A;  1WES A;  3LQH A;  3SOX A;  4V3K C;  3ZPV E;  2K16 A;  4C9Z A;  2MD8 C;  5LKX A;  2KRE A;  2RSD A;  4GNG A;  1ZBD B;  2EA6 A;  2YYR A;  4AVX A;  5B76 A;  2H0D B;  4WZ3 B;  4UI9 B;  4GB0 A;  4IC3 A;  3HCS A;  5TAB A;  1K2F A;  3N9O A;  2E6R A;  3M99 A;  2L0B A;  4A49 A;  4A4B A;  5B78 A;  2YHO A;  2MD7 B;  2JMJ A;  2KU3 A;  1FP0 A;  2KFT A;  4YAT A;  4F52 B;  1VD4 A;  3M63 A;  1WEM A;  2BAY A;  5FEY A;  4MSX A;  4YBS A;  4FJC A;  2JRJ A;  3HCU A;  2MUM A;  3U5P A;  4I7D A;  4TKP B;  2HDP A;  1HYJ A;  3LRQ A;  5TBN A;  2F42 A;  5TRB A;  2IDA A;  4W4U A;  5JG6 A;  1WEN A;  3I2D A;  2G43 A;  3L1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...