2XB1A

Crystal structure of the human pygo2 phd finger in complex with the b9l hd1 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
96
Chain Sequence
LVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEGSVYVFTTHLANTAAEAVLQGRADSILAYHQQNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric Remodeling of the Histone H3 Binding Pocket in the Pygo2 Phd Finger Triggered by its Binding to the B9L/Bcl9 Co-Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
total genus 29
structure length 96
sequence length 104
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2xb1A00
2F6NA 1LDKC 3O34A 4AVXA 2D8SA 4LADB 5FB0A 4B7YC 2ECGA 4QF3A 2HYED 5FB1A 2PUYA 4IC2A 3KQIA 2KGIA 2LXPC 4BBQA 2YHOA 3N9OA 1LDJB 1WILA 2NAAA 1WIMA 4X3GA 1IYMA 4A4CA 1VYXA 5FERA 1BORA 3M99A 2IDAA 2CKLB 4UI9B 2UZGA 4TKPB 4YATA 3SHBA 5KH7A 4NN2A 2I50A 2JMDA 3L1XA 2LGGA 4C9ZA 4YABA 2VPEA 1WEVA 1V87A 2LGLA 1N87A 1VD4A 3QZVA 4CA1A 2KIZA 5C13A 5J3XA 4YADA 3M62A 1WEMA 2LGVA 4IC3A 2G43A 5D1KB 5KH9A 2Y1NA 1WE9A 3ZVZB 3RPGB 3L11A 4AYCB 3ZPVE 2YHNA 1JOCA 2KU3A 4ZDTA 1WGMA 2YT5A 4FO9A 4YC9A 1WEQA 5H1TA 3HCSA 2FUUA 3O7AA 4YBTA 5TDRA 3I2DA 5LKTA 4N3WA 2JRJA 5LCWB 2ECIA 1WESA 1FP0A 4S3OC 2CKLA 3C5KA 3ZVYA 4L58A 3KV6A 5B79A 2MD7B 1E4UA 2YQMA 1JM7B 1WEEA 2MA5A 4W4UA 2JMIA 2VPBA 2ECJA 4F52B 5LKUA 2EODA 2F6JA 5I3LA 4WA6A 4A49A 2L0BA 2ECWA 4PPEA 4AP4A 3N9NA 4MSXA 2MNZA 2VP7A 3T6RA 2L80A 4XI1A 4FK5A 4A4BA 3L1ZB 2Y1MA 4GNDA 2QICA 4N4FA 4R2YA 5TBNA 4UP0A 2RSDA 3O37A 2PNXA 5KH3A 2VJFA 1MM2A 2MD8C 3N9PA 4AUQB 3LQIA 2YW8A 1Z6UA 3ZPV1 1WEWA 2H0DA 3ZYQA 4AYCA 4YAXA 2LN0A 4A0CD 3FL2A 2K4DA 3DQVR 4LLBA 2YQLA 3IHPA 2FSAA 5H1UA 2HDPA 3DPLR 2VPGA 4GNEA 5FEYA 1K2FA 2LDRA 1XWHA 5B78A 2MT5A 2H0DB 3GV4A 4GB0A 2RI7A 3O36A 2G6QA 2KWNA 3PHDA 1JM7A 5G04B 2LQ6A 2M6MA 5H9MA 1MM3A 3T7LA 2LXHC 1WENA 2YUCA 2E6RA 3HCUA 1ZBDB 1T1HA 4B86C 2K17A 3ASLA 1Z60A 2KYUA 2K16A 2VPDA 4WZ0A 2M85A 2KWJA 4CCGX 3MHSA 2YYRA 2ECNA 2KREA 4PTBA 4Q6FA 2Y43A 3VK6A 5EYAF 2C2LA 3HCTA 4GNGA 2ECVA 4P5OB 3LQJA 2LGKA 2YREA 2OXQC 5TDWA 2VJFB 3V43A 2G45A 4YBMA 2YURA 2LRIC 2EA6A 2VJEA 3SOUA 2KGGA 4LKAA 4S3OB 2KR4A 4V3LC 2KFTA 2BAYA 4WZ3B 1G25A 3RTRB 4BHWA 4R8PK 3PURA 2XB1A 3O35A 1WFKA 2QIZA 3LQHA 1DVPA 3U5PA 4FJCA 3U5OA 3ZNIA 5DKAA 5D1LB 2L43A 1HYIA 3EB6A 2XEUA 3U5MA 4O64A 2LV9A 2VJEB 5B76A 3N9QA 3LRQA 2ECTA 2QJ0A 3SOWA 2C2VS 2MIQA 3SOXA 5LKZA 1X4UA 2YSJA 4ZQLA 2JMJA 5D1MB 2L75A 1X4IA 2FUIA 3KV5A 3KNVA 4MVTA 2AN6A 4I7CA 5G0FA 3N9LA 3GL6A 2E6SA 3MHHA 2L5UA 3NG2A 5LKXA 3O33A 5B8DA 4ZUXU 4GNFA 2F42A 3EB5A 5TRBA 3U5NA 1HYJA 5JG6A 2M1RA 1U6GB 2MA6A 5TABA 1F62A 1RMDA 5AITA 1WEUA 2CT2A 2DX8A 5DINA 4WZ2A 2YSMA 4I7DA 4L7XA 4YBSA 1CHCA 4I7BA 2ZETC 2VNFA 4UP5A 2KWKA 2MUMA 3O70A 2KWOA 4QF2A 5H1VA 3PUQA 4R7EA 2YU4A 2M3HA 3M63A 3N9MA 2EGPA 1Z2QA 4FIPA 3C6WA 4V3KC 1X4JA 2MNYA 1WEOA 3ZTGA 5B75A 5B77A 4LK9A 1VFYA 3HTKC 1WEPA 3RPGC 4LJNA 2CSYA 2K1JA 2KE1A 2CSZA 5AIUA 5C11A 5G05B 1FBVA
chains in the Genus database with same CATH superfamily
2F6NA 1LDKC 3O34A 4AVXA 2D8SA 4LADB 5FB0A 4B7YC 2ECGA 4QF3A 3KDEC 2HYED 2XOYA 5FB1A 2PUYA 4IC2A 3KQIA 2CRRA 2KGIA 2LXPC 2YVRA 4BBQA 2YHOA 3N9OA 1LDJB 1WILA 2NAAA 3JUEA 1WIMA 4X3GA 1IYMA 4A4CA 1VYXA 5FERA 1BORA 3M99A 2IDAA 3DDTA 2CKLB 2JUNA 4OGEA 4UI9B 2UZGA 4TKPB 4YATA 3SHBA 5KH7A 1MBMA 2DSMA 4NN2A 2I50A 2JMDA 3H7HA 3L1XA 2LGGA 4C9ZA 2KKYA 4QQ4A 4YABA 2VPEA 1WEVA 2DJAA 1V87A 2LGLA 2XOCA 1N87A 1VD4A 3QZVA 4CA1A 2KIZA 5C13A 5J3XA 4YADA 3M62A 1WEMA 2IQJA 3FM8C 2LGVA 4Z0OA 4IC3A 2G43A 5D1KB 5SVXA 4Z0RA 5KH9A 2Y1NA 2RR4A 1WE9A 3ZVZB 5SVYA 3RPGB 3L11A 4AYCB 3ZPVE 2E61A 2YHNA 1JOCA 2KU3A 4ZDTA 3DWDA 1WGMA 2YT5A 4FO9A 4YC9A 1WEQA 5H1TA 3HCSA 2FUUA 3O7AA 4YBTA 5TDRA 3I2DA 5LKTA 4N3WA 2JRJA 5LCWB 2ECIA 1WESA 1FP0A 3LDYA 4S3OC 2CKLA 3C5KA 3ZVYA 4L58A 3KV6A 2D8UA 3FEHA 5B79A 2MD7B 2KKXA 1E4UA 2YQMA 1JM7B 1WEEA 2MA5A 4W4UA 2CSVA 2JMIA 2VPBA 5K3QA 2ECJA 4F52B 5LKUA 2EODA 2F6JA 5I3LA 4WA6A 4A49A 2L0BA 2ECWA 4PPEA 4AP4A 3N9NA 2OWAA 4MSXA 2MKEA 2MNZA 4F1PA 2VP7A 3T6RA 2L80A 4O62A 3M7KA 4XI1A 4FK5A 4A4BA 2B0OE 3L1ZB 2Y1MA 4GNDA 2JM3A 2QICA 4N4FA 4R2YA 5TBNA 4UP0A 2RSDA 3O37A 2PNXA 5KH3A 2VJFA 1MM2A 2MD8C 3N9PA 4AUQB 3LQIA 2YW8A 2XP0A 1Z6UA 3ZPV1 1WEWA 2H0DA 3ZYQA 4AYCA 4YAXA 2LN0A 3LJUX 3FL2A 4A0CD 2K4DA 3DQVR 4LLBA 2YQLA 3IHPA 2FSAA 5H1UA 2HDPA 3DPLR 2VPGA 4GNEA 5FEYA 2CRWA 1K2FA 2LDRA 1XWHA 5B78A 2MT5A 2H0DB 3GV4A 2EXUA 4GB0A 2RI7A 3O36A 2G6QA 2KWNA 3PHDA 1JM7A 5G04B 2LQ6A 2M6MA 3FAOA 5H9MA 1MM3A 3T7LA 2LXHC 1WENA 2YUCA 2E6RA 3HCUA 1ZBDB 1T1HA 4B86C 2K17A 3ASLA 1Z60A 2KYUA 2P57A 2K16A 2VPDA 4WZ0A 2M85A 3FJUB 2KWJA 4CCGX 3MHSA 2YYRA 2ECNA 2KREA 4PTBA 4Q6FA 2Y43A 3VK6A 5EYAF 2C2LA 3HCTA 4GNGA 2ECVA 4P5OB 3LQJA 2LGKA 2YREA 2OXQC 3LVRE 2VJFB 5TDWA 3V43A 2G45A 4YBMA 2YURA 2LRIC 2EA6A 5SVIB 2VJEA 3SOUA 2KGGA 4LKAA 4S3OB 2KR4A 4V3LC 2KFTA 2BAYA 4WZ3B 1G25A 3RTRB 4BHWA 4R8PK 3PURA 2XB1A 3PLWA 3O35A 1WFKA 2QIZA 3LQHA 1DVPA 3U5PA 4FJCA 3U5OA 3ZNIA 5DKAA 4H9DA 5D1LB 2L43A 1HYIA 3EB6A 2XEUA 3Q1DA 3U5MA 4O64A 2LV9A 2VJEB 5B76A 3N9QA 3LRQA 2ECTA 2QJ0A 3SOWA 3O47A 2FFWA 2C2VS 2MIQA 3SOXA 2L7PA 2CONA 5LKZA 1X4UA 2YSJA 4ZQLA 2JMJA 5D1MB 2L75A 1X4IA 2FUIA 3T9KA 3KV5A 3KNVA 4MVTA 2AN6A 2XOZA 4I7CA 5G0FA 3N9LA 3GL6A 2E6SA 3MHHA 2L5UA 3NG2A 3E2DA 2EGMA 1DCQA 5LKXA 3O33A 5B8DA 4ZUXU 4GNFA 2F42A 3EB5A 5TRBA 3U5NA 1HYJA 5JG6A 3MDBC 2M1RA 1U6GB 2MA6A 5TABA 1F62A 1RMDA 5AITA 1WEUA 2CT2A 2DX8A 3FANA 5DINA 4WZ2A 5SVIA 2YSMA 4I7DA 4L7XA 2FD4A 2LAUA 4YBSA 4OGCA 1CHCA 3LVQE 4I7BA 2ZETC 2VNFA 2M13A 4UP5A 2KWKA 2MUMA 3O70A 2KWOA 4QF2A 5H1VA 3PUQA 4R7EA 2YU4A 2M3HA 3M63A 3N9MA 2EGPA 1Z2QA 4FIPA 3C6WA 4V3KC 1X4JA 2MNYA 1WEOA 3ZTGA 5B75A 5B77A 4LK9A 1VFYA 3HTKC 1WEPA 3RPGC 4LJNA 2CSYA 2K1JA 3SUBA 2KE1A 2CSZA 5AIUA 5C11A 5G05B 1FBVA
chains in the Genus database with same CATH topology
2F6NA 1LDKC 3O34A 4AVXA 2D8SA 4LADB 5FB0A 4B7YC 2ECGA 4QF3A 2HYED 5FB1A 2PUYA 4IC2A 3KQIA 2KGIA 2LXPC 4BBQA 2YHOA 3N9OA 1LDJB 1WILA 2NAAA 1WIMA 4X3GA 1IYMA 4A4CA 1VYXA 5FERA 1BORA 3M99A 2IDAA 2CKLB 4UI9B 2UZGA 4TKPB 4YATA 3SHBA 5KH7A 4NN2A 2I50A 2JMDA 3L1XA 2LGGA 4C9ZA 4YABA 2VPEA 1WEVA 1V87A 2LGLA 1N87A 1VD4A 3QZVA 4CA1A 2KIZA 5C13A 5J3XA 4YADA 3M62A 1WEMA 2LGVA 4IC3A 2G43A 5D1KB 5KH9A 2Y1NA 1WE9A 3ZVZB 3RPGB 3L11A 4AYCB 3ZPVE 2YHNA 1JOCA 2KU3A 4ZDTA 1WGMA 2YT5A 4FO9A 4YC9A 1WEQA 5H1TA 3HCSA 2FUUA 3O7AA 4YBTA 5TDRA 3I2DA 5LKTA 4N3WA 2JRJA 5LCWB 2ECIA 1WESA 1FP0A 4S3OC 2CKLA 3C5KA 3ZVYA 4L58A 3KV6A 5B79A 2MD7B 1E4UA 2YQMA 1JM7B 1WEEA 2MA5A 4W4UA 2JMIA 2VPBA 2ECJA 4F52B 5LKUA 2EODA 2F6JA 5I3LA 4WA6A 4A49A 2L0BA 2ECWA 4PPEA 4AP4A 3N9NA 4MSXA 2MNZA 2VP7A 3T6RA 2L80A 4XI1A 4FK5A 4A4BA 3L1ZB 2Y1MA 4GNDA 2QICA 4N4FA 4R2YA 5TBNA 4UP0A 2RSDA 3O37A 2PNXA 5KH3A 2VJFA 1MM2A 2MD8C 3N9PA 4AUQB 3LQIA 2YW8A 1Z6UA 3ZPV1 1WEWA 2H0DA 3ZYQA 4AYCA 4YAXA 2LN0A 4A0CD 3FL2A 2K4DA 3DQVR 4LLBA 2YQLA 3IHPA 2FSAA 5H1UA 2HDPA 3DPLR 2VPGA 4GNEA 5FEYA 1K2FA 2LDRA 1XWHA 5B78A 2MT5A 2H0DB 3GV4A 4GB0A 2RI7A 3O36A 2G6QA 2KWNA 3PHDA 1JM7A 5G04B 2LQ6A 2M6MA 5H9MA 1MM3A 3T7LA 2LXHC 1WENA 2YUCA 2E6RA 3HCUA 1ZBDB 1T1HA 4B86C 2K17A 3ASLA 1Z60A 2KYUA 2K16A 2VPDA 4WZ0A 2M85A 2KWJA 4CCGX 3MHSA 2YYRA 2ECNA 2KREA 4PTBA 4Q6FA 2Y43A 3VK6A 5EYAF 2C2LA 3HCTA 4GNGA 2ECVA 4P5OB 3LQJA 2LGKA 2YREA 2OXQC 5TDWA 2VJFB 3V43A 2G45A 4YBMA 2YURA 2LRIC 2EA6A 2VJEA 3SOUA 2KGGA 4LKAA 4S3OB 2KR4A 4V3LC 2KFTA 2BAYA 4WZ3B 1G25A 3RTRB 4BHWA 4R8PK 3PURA 2XB1A 3O35A 1WFKA 2QIZA 3LQHA 1DVPA 3U5PA 4FJCA 3U5OA 3ZNIA 5DKAA 5D1LB 2L43A 1HYIA 3EB6A 2XEUA 3U5MA 4O64A 2LV9A 2VJEB 5B76A 3N9QA 3LRQA 2ECTA 2QJ0A 3SOWA 2C2VS 2MIQA 3SOXA 5LKZA 1X4UA 2YSJA 4ZQLA 2JMJA 5D1MB 2L75A 1X4IA 2FUIA 3KV5A 3KNVA 4MVTA 2AN6A 4I7CA 5G0FA 3N9LA 3GL6A 2E6SA 3MHHA 2L5UA 3NG2A 5LKXA 3O33A 5B8DA 4ZUXU 4GNFA 2F42A 3EB5A 5TRBA 3U5NA 1HYJA 5JG6A 2M1RA 1U6GB 2MA6A 5TABA 1F62A 1RMDA 5AITA 1WEUA 2CT2A 2DX8A 5DINA 4WZ2A 2YSMA 4I7DA 4L7XA 4YBSA 1CHCA 4I7BA 2ZETC 2VNFA 4UP5A 2KWKA 2MUMA 3O70A 2KWOA 4QF2A 5H1VA 3PUQA 4R7EA 2YU4A 2M3HA 3M63A 3N9MA 2EGPA 1Z2QA 4FIPA 3C6WA 4V3KC 1X4JA 2MNYA 1WEOA 3ZTGA 5B75A 5B77A 4LK9A 1VFYA 3HTKC 1WEPA 3RPGC 4LJNA 2CSYA 2K1JA 2KE1A 2CSZA 5AIUA 5C11A 5G05B 1FBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6N A;  1LDK C;  3O34 A;  4AVX A;  2D8S A;  4LAD B;  5FB0 A;  4B7Y C;  2ECG A;  4QF3 A;  2HYE D;  5FB1 A;  2PUY A;  4IC2 A;  3KQI A;  2KGI A;  2LXP C;  4BBQ A;  2YHO A;  3N9O A;  1LDJ B;  1WIL A;  2NAA A;  1WIM A;  4X3G A;  1IYM A;  4A4C A;  1VYX A;  5FER A;  1BOR A;  3M99 A;  2IDA A;  2CKL B;  4UI9 B;  2UZG A;  4TKP B;  4YAT A;  3SHB A;  5KH7 A;  4NN2 A;  2I50 A;  2JMD A;  3L1X A;  2LGG A;  4C9Z A;  4YAB A;  2VPE A;  1WEV A;  1V87 A;  2LGL A;  1N87 A;  1VD4 A;  3QZV A;  4CA1 A;  2KIZ A;  5C13 A;  5J3X A;  4YAD A;  3M62 A;  1WEM A;  2LGV A;  4IC3 A;  2G43 A;  5D1K B;  5KH9 A;  2Y1N A;  1WE9 A;  3ZVZ B;  3RPG B;  3L11 A;  4AYC B;  3ZPV E;  2YHN A;  1JOC A;  2KU3 A;  4ZDT A;  1WGM A;  2YT5 A;  4FO9 A;  4YC9 A;  1WEQ A;  5H1T A;  3HCS A;  2FUU A;  3O7A A;  4YBT A;  5TDR A;  3I2D A;  5LKT A;  4N3W A;  2JRJ A;  5LCW B;  2ECI A;  1WES A;  1FP0 A;  4S3O C;  2CKL A;  3C5K A;  3ZVY A;  4L58 A;  3KV6 A;  5B79 A;  2MD7 B;  1E4U A;  2YQM A;  1JM7 B;  1WEE A;  2MA5 A;  4W4U A;  2JMI A;  2VPB A;  2ECJ A;  4F52 B;  5LKU A;  2EOD A;  2F6J A;  5I3L A;  4WA6 A;  4A49 A;  2L0B A;  2ECW A;  4PPE A;  4AP4 A;  3N9N A;  4MSX A;  2MNZ A;  2VP7 A;  3T6R A;  2L80 A;  4XI1 A;  4FK5 A;  4A4B A;  3L1Z B;  2Y1M A;  4GND A;  2QIC A;  4N4F A;  4R2Y A;  5TBN A;  4UP0 A;  2RSD A;  3O37 A;  2PNX A;  5KH3 A;  2VJF A;  1MM2 A;  2MD8 C;  3N9P A;  4AUQ B;  3LQI A;  2YW8 A;  1Z6U A;  3ZPV 1;  1WEW A;  2H0D A;  3ZYQ A;  4AYC A;  4YAX A;  2LN0 A;  4A0C D;  3FL2 A;  2K4D A;  3DQV R;  4LLB A;  2YQL A;  3IHP A;  2FSA A;  5H1U A;  2HDP A;  3DPL R;  2VPG A;  4GNE A;  5FEY A;  1K2F A;  2LDR A;  1XWH A;  5B78 A;  2MT5 A;  2H0D B;  3GV4 A;  4GB0 A;  2RI7 A;  3O36 A;  2G6Q A;  2KWN A;  3PHD A;  1JM7 A;  5G04 B;  2LQ6 A;  2M6M A;  5H9M A;  1MM3 A;  3T7L A;  2LXH C;  1WEN A;  2YUC A;  2E6R A;  3HCU A;  1ZBD B;  1T1H A;  4B86 C;  2K17 A;  3ASL A;  1Z60 A;  2KYU A;  2K16 A;  2VPD A;  4WZ0 A;  2M85 A;  2KWJ A;  4CCG X;  3MHS A;  2YYR A;  2ECN A;  2KRE A;  4PTB A;  4Q6F A;  2Y43 A;  3VK6 A;  5EYA F;  2C2L A;  3HCT A;  4GNG A;  2ECV A;  4P5O B;  3LQJ A;  2LGK A;  2YRE A;  2OXQ C;  5TDW A;  2VJF B;  3V43 A;  2G45 A;  4YBM A;  2YUR A;  2LRI C;  2EA6 A;  2VJE A;  3SOU A;  2KGG A;  4LKA A;  4S3O B;  2KR4 A;  4V3L C;  2KFT A;  2BAY A;  4WZ3 B;  1G25 A;  3RTR B;  4BHW A;  4R8P K;  3PUR A;  2XB1 A;  3O35 A;  1WFK A;  2QIZ A;  3LQH A;  1DVP A;  3U5P A;  4FJC A;  3U5O A;  3ZNI A;  5DKA A;  5D1L B;  2L43 A;  1HYI A;  3EB6 A;  2XEU A;  3U5M A;  4O64 A;  2LV9 A;  2VJE B;  5B76 A;  3N9Q A;  3LRQ A;  2ECT A;  2QJ0 A;  3SOW A;  2C2V S;  2MIQ A;  3SOX A;  5LKZ A;  1X4U A;  2YSJ A;  4ZQL A;  2JMJ A;  5D1M B;  2L75 A;  1X4I A;  2FUI A;  3KV5 A;  3KNV A;  4MVT A;  2AN6 A;  4I7C A;  5G0F A;  3N9L A;  3GL6 A;  2E6S A;  3MHH A;  2L5U A;  3NG2 A;  5LKX A;  3O33 A;  5B8D A;  4ZUX U;  4GNF A;  2F42 A;  3EB5 A;  5TRB A;  3U5N A;  1HYJ A;  5JG6 A;  2M1R A;  1U6G B;  2MA6 A;  5TAB A;  1F62 A;  1RMD A;  5AIT A;  1WEU A;  2CT2 A;  2DX8 A;  5DIN A;  4WZ2 A;  2YSM A;  4I7D A;  4L7X A;  4YBS A;  1CHC A;  4I7B A;  2ZET C;  2VNF A;  4UP5 A;  2KWK A;  2MUM A;  3O70 A;  2KWO A;  4QF2 A;  5H1V A;  3PUQ A;  4R7E A;  2YU4 A;  2M3H A;  3M63 A;  3N9M A;  2EGP A;  1Z2Q A;  4FIP A;  3C6W A;  4V3K C;  1X4J A;  2MNY A;  1WEO A;  3ZTG A;  5B75 A;  5B77 A;  4LK9 A;  1VFY A;  3HTK C;  1WEP A;  3RPG C;  4LJN A;  2CSY A;  2K1J A;  2KE1 A;  2CSZ A;  5AIU A;  5C11 A;  5G05 B;  1FBV A; 
#chains in the Genus database with same CATH topology
 2F6N A;  1LDK C;  3O34 A;  4AVX A;  2D8S A;  4LAD B;  5FB0 A;  4B7Y C;  2ECG A;  4QF3 A;  3KDE C;  2HYE D;  2XOY A;  5FB1 A;  2PUY A;  4IC2 A;  3KQI A;  2CRR A;  2KGI A;  2LXP C;  2YVR A;  4BBQ A;  2YHO A;  3N9O A;  1LDJ B;  1WIL A;  2NAA A;  3JUE A;  1WIM A;  4X3G A;  1IYM A;  4A4C A;  1VYX A;  5FER A;  1BOR A;  3M99 A;  2IDA A;  3DDT A;  2CKL B;  2JUN A;  4OGE A;  4UI9 B;  2UZG A;  4TKP B;  4YAT A;  3SHB A;  5KH7 A;  1MBM A;  2DSM A;  4NN2 A;  2I50 A;  2JMD A;  3H7H A;  3L1X A;  2LGG A;  4C9Z A;  2KKY A;  4QQ4 A;  4YAB A;  2VPE A;  1WEV A;  2DJA A;  1V87 A;  2LGL A;  2XOC A;  1N87 A;  1VD4 A;  3QZV A;  4CA1 A;  2KIZ A;  5C13 A;  5J3X A;  4YAD A;  3M62 A;  1WEM A;  2IQJ A;  3FM8 C;  2LGV A;  4Z0O A;  4IC3 A;  2G43 A;  5D1K B;  5SVX A;  4Z0R A;  5KH9 A;  2Y1N A;  2RR4 A;  1WE9 A;  3ZVZ B;  5SVY A;  3RPG B;  3L11 A;  4AYC B;  3ZPV E;  2E61 A;  2YHN A;  1JOC A;  2KU3 A;  4ZDT A;  3DWD A;  1WGM A;  2YT5 A;  4FO9 A;  4YC9 A;  1WEQ A;  5H1T A;  3HCS A;  2FUU A;  3O7A A;  4YBT A;  5TDR A;  3I2D A;  5LKT A;  4N3W A;  2JRJ A;  5LCW B;  2ECI A;  1WES A;  1FP0 A;  3LDY A;  4S3O C;  2CKL A;  3C5K A;  3ZVY A;  4L58 A;  3KV6 A;  2D8U A;  3FEH A;  5B79 A;  2MD7 B;  2KKX A;  1E4U A;  2YQM A;  1JM7 B;  1WEE A;  2MA5 A;  4W4U A;  2CSV A;  2JMI A;  2VPB A;  5K3Q A;  2ECJ A;  4F52 B;  5LKU A;  2EOD A;  2F6J A;  5I3L A;  4WA6 A;  4A49 A;  2L0B A;  2ECW A;  4PPE A;  4AP4 A;  3N9N A;  2OWA A;  4MSX A;  2MKE A;  2MNZ A;  4F1P A;  2VP7 A;  3T6R A;  2L80 A;  4O62 A;  3M7K A;  4XI1 A;  4FK5 A;  4A4B A;  2B0O E;  3L1Z B;  2Y1M A;  4GND A;  2JM3 A;  2QIC A;  4N4F A;  4R2Y A;  5TBN A;  4UP0 A;  2RSD A;  3O37 A;  2PNX A;  5KH3 A;  2VJF A;  1MM2 A;  2MD8 C;  3N9P A;  4AUQ B;  3LQI A;  2YW8 A;  2XP0 A;  1Z6U A;  3ZPV 1;  1WEW A;  2H0D A;  3ZYQ A;  4AYC A;  4YAX A;  2LN0 A;  3LJU X;  3FL2 A;  4A0C D;  2K4D A;  3DQV R;  4LLB A;  2YQL A;  3IHP A;  2FSA A;  5H1U A;  2HDP A;  3DPL R;  2VPG A;  4GNE A;  5FEY A;  2CRW A;  1K2F A;  2LDR A;  1XWH A;  5B78 A;  2MT5 A;  2H0D B;  3GV4 A;  2EXU A;  4GB0 A;  2RI7 A;  3O36 A;  2G6Q A;  2KWN A;  3PHD A;  1JM7 A;  5G04 B;  2LQ6 A;  2M6M A;  3FAO A;  5H9M A;  1MM3 A;  3T7L A;  2LXH C;  1WEN A;  2YUC A;  2E6R A;  3HCU A;  1ZBD B;  1T1H A;  4B86 C;  2K17 A;  3ASL A;  1Z60 A;  2KYU A;  2P57 A;  2K16 A;  2VPD A;  4WZ0 A;  2M85 A;  3FJU B;  2KWJ A;  4CCG X;  3MHS A;  2YYR A;  2ECN A;  2KRE A;  4PTB A;  4Q6F A;  2Y43 A;  3VK6 A;  5EYA F;  2C2L A;  3HCT A;  4GNG A;  2ECV A;  4P5O B;  3LQJ A;  2LGK A;  2YRE A;  2OXQ C;  3LVR E;  2VJF B;  5TDW A;  3V43 A;  2G45 A;  4YBM A;  2YUR A;  2LRI C;  2EA6 A;  5SVI B;  2VJE A;  3SOU A;  2KGG A;  4LKA A;  4S3O B;  2KR4 A;  4V3L C;  2KFT A;  2BAY A;  4WZ3 B;  1G25 A;  3RTR B;  4BHW A;  4R8P K;  3PUR A;  2XB1 A;  3PLW A;  3O35 A;  1WFK A;  2QIZ A;  3LQH A;  1DVP A;  3U5P A;  4FJC A;  3U5O A;  3ZNI A;  5DKA A;  4H9D A;  5D1L B;  2L43 A;  1HYI A;  3EB6 A;  2XEU A;  3Q1D A;  3U5M A;  4O64 A;  2LV9 A;  2VJE B;  5B76 A;  3N9Q A;  3LRQ A;  2ECT A;  2QJ0 A;  3SOW A;  3O47 A;  2FFW A;  2C2V S;  2MIQ A;  3SOX A;  2L7P A;  2CON A;  5LKZ A;  1X4U A;  2YSJ A;  4ZQL A;  2JMJ A;  5D1M B;  2L75 A;  1X4I A;  2FUI A;  3T9K A;  3KV5 A;  3KNV A;  4MVT A;  2AN6 A;  2XOZ A;  4I7C A;  5G0F A;  3N9L A;  3GL6 A;  2E6S A;  3MHH A;  2L5U A;  3NG2 A;  3E2D A;  2EGM A;  1DCQ A;  5LKX A;  3O33 A;  5B8D A;  4ZUX U;  4GNF A;  2F42 A;  3EB5 A;  5TRB A;  3U5N A;  1HYJ A;  5JG6 A;  3MDB C;  2M1R A;  1U6G B;  2MA6 A;  5TAB A;  1F62 A;  1RMD A;  5AIT A;  1WEU A;  2CT2 A;  2DX8 A;  3FAN A;  5DIN A;  4WZ2 A;  5SVI A;  2YSM A;  4I7D A;  4L7X A;  2FD4 A;  2LAU A;  4YBS A;  4OGC A;  1CHC A;  3LVQ E;  4I7B A;  2ZET C;  2VNF A;  2M13 A;  4UP5 A;  2KWK A;  2MUM A;  3O70 A;  2KWO A;  4QF2 A;  5H1V A;  3PUQ A;  4R7E A;  2YU4 A;  2M3H A;  3M63 A;  3N9M A;  2EGP A;  1Z2Q A;  4FIP A;  3C6W A;  4V3K C;  1X4J A;  2MNY A;  1WEO A;  3ZTG A;  5B75 A;  5B77 A;  4LK9 A;  1VFY A;  3HTK C;  1WEP A;  3RPG C;  4LJN A;  2CSY A;  2K1J A;  3SUB A;  2KE1 A;  2CSZ A;  5AIU A;  5C11 A;  5G05 B;  1FBV A; 
#chains in the Genus database with same CATH homology
 2F6N A;  1LDK C;  3O34 A;  4AVX A;  2D8S A;  4LAD B;  5FB0 A;  4B7Y C;  2ECG A;  4QF3 A;  2HYE D;  5FB1 A;  2PUY A;  4IC2 A;  3KQI A;  2KGI A;  2LXP C;  4BBQ A;  2YHO A;  3N9O A;  1LDJ B;  1WIL A;  2NAA A;  1WIM A;  4X3G A;  1IYM A;  4A4C A;  1VYX A;  5FER A;  1BOR A;  3M99 A;  2IDA A;  2CKL B;  4UI9 B;  2UZG A;  4TKP B;  4YAT A;  3SHB A;  5KH7 A;  4NN2 A;  2I50 A;  2JMD A;  3L1X A;  2LGG A;  4C9Z A;  4YAB A;  2VPE A;  1WEV A;  1V87 A;  2LGL A;  1N87 A;  1VD4 A;  3QZV A;  4CA1 A;  2KIZ A;  5C13 A;  5J3X A;  4YAD A;  3M62 A;  1WEM A;  2LGV A;  4IC3 A;  2G43 A;  5D1K B;  5KH9 A;  2Y1N A;  1WE9 A;  3ZVZ B;  3RPG B;  3L11 A;  4AYC B;  3ZPV E;  2YHN A;  1JOC A;  2KU3 A;  4ZDT A;  1WGM A;  2YT5 A;  4FO9 A;  4YC9 A;  1WEQ A;  5H1T A;  3HCS A;  2FUU A;  3O7A A;  4YBT A;  5TDR A;  3I2D A;  5LKT A;  4N3W A;  2JRJ A;  5LCW B;  2ECI A;  1WES A;  1FP0 A;  4S3O C;  2CKL A;  3C5K A;  3ZVY A;  4L58 A;  3KV6 A;  5B79 A;  2MD7 B;  1E4U A;  2YQM A;  1JM7 B;  1WEE A;  2MA5 A;  4W4U A;  2JMI A;  2VPB A;  2ECJ A;  4F52 B;  5LKU A;  2EOD A;  2F6J A;  5I3L A;  4WA6 A;  4A49 A;  2L0B A;  2ECW A;  4PPE A;  4AP4 A;  3N9N A;  4MSX A;  2MNZ A;  2VP7 A;  3T6R A;  2L80 A;  4XI1 A;  4FK5 A;  4A4B A;  3L1Z B;  2Y1M A;  4GND A;  2QIC A;  4N4F A;  4R2Y A;  5TBN A;  4UP0 A;  2RSD A;  3O37 A;  2PNX A;  5KH3 A;  2VJF A;  1MM2 A;  2MD8 C;  3N9P A;  4AUQ B;  3LQI A;  2YW8 A;  1Z6U A;  3ZPV 1;  1WEW A;  2H0D A;  3ZYQ A;  4AYC A;  4YAX A;  2LN0 A;  4A0C D;  3FL2 A;  2K4D A;  3DQV R;  4LLB A;  2YQL A;  3IHP A;  2FSA A;  5H1U A;  2HDP A;  3DPL R;  2VPG A;  4GNE A;  5FEY A;  1K2F A;  2LDR A;  1XWH A;  5B78 A;  2MT5 A;  2H0D B;  3GV4 A;  4GB0 A;  2RI7 A;  3O36 A;  2G6Q A;  2KWN A;  3PHD A;  1JM7 A;  5G04 B;  2LQ6 A;  2M6M A;  5H9M A;  1MM3 A;  3T7L A;  2LXH C;  1WEN A;  2YUC A;  2E6R A;  3HCU A;  1ZBD B;  1T1H A;  4B86 C;  2K17 A;  3ASL A;  1Z60 A;  2KYU A;  2K16 A;  2VPD A;  4WZ0 A;  2M85 A;  2KWJ A;  4CCG X;  3MHS A;  2YYR A;  2ECN A;  2KRE A;  4PTB A;  4Q6F A;  2Y43 A;  3VK6 A;  5EYA F;  2C2L A;  3HCT A;  4GNG A;  2ECV A;  4P5O B;  3LQJ A;  2LGK A;  2YRE A;  2OXQ C;  5TDW A;  2VJF B;  3V43 A;  2G45 A;  4YBM A;  2YUR A;  2LRI C;  2EA6 A;  2VJE A;  3SOU A;  2KGG A;  4LKA A;  4S3O B;  2KR4 A;  4V3L C;  2KFT A;  2BAY A;  4WZ3 B;  1G25 A;  3RTR B;  4BHW A;  4R8P K;  3PUR A;  2XB1 A;  3O35 A;  1WFK A;  2QIZ A;  3LQH A;  1DVP A;  3U5P A;  4FJC A;  3U5O A;  3ZNI A;  5DKA A;  5D1L B;  2L43 A;  1HYI A;  3EB6 A;  2XEU A;  3U5M A;  4O64 A;  2LV9 A;  2VJE B;  5B76 A;  3N9Q A;  3LRQ A;  2ECT A;  2QJ0 A;  3SOW A;  2C2V S;  2MIQ A;  3SOX A;  5LKZ A;  1X4U A;  2YSJ A;  4ZQL A;  2JMJ A;  5D1M B;  2L75 A;  1X4I A;  2FUI A;  3KV5 A;  3KNV A;  4MVT A;  2AN6 A;  4I7C A;  5G0F A;  3N9L A;  3GL6 A;  2E6S A;  3MHH A;  2L5U A;  3NG2 A;  5LKX A;  3O33 A;  5B8D A;  4ZUX U;  4GNF A;  2F42 A;  3EB5 A;  5TRB A;  3U5N A;  1HYJ A;  5JG6 A;  2M1R A;  1U6G B;  2MA6 A;  5TAB A;  1F62 A;  1RMD A;  5AIT A;  1WEU A;  2CT2 A;  2DX8 A;  5DIN A;  4WZ2 A;  2YSM A;  4I7D A;  4L7X A;  4YBS A;  1CHC A;  4I7B A;  2ZET C;  2VNF A;  4UP5 A;  2KWK A;  2MUM A;  3O70 A;  2KWO A;  4QF2 A;  5H1V A;  3PUQ A;  4R7E A;  2YU4 A;  2M3H A;  3M63 A;  3N9M A;  2EGP A;  1Z2Q A;  4FIP A;  3C6W A;  4V3K C;  1X4J A;  2MNY A;  1WEO A;  3ZTG A;  5B75 A;  5B77 A;  4LK9 A;  1VFY A;  3HTK C;  1WEP A;  3RPG C;  4LJN A;  2CSY A;  2K1J A;  2KE1 A;  2CSZ A;  5AIU A;  5C11 A;  5G05 B;  1FBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...