2XB1A

Crystal structure of the human pygo2 phd finger in complex with the b9l hd1 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
96
Chain Sequence
LVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEGSVYVFTTHLANTAAEAVLQGRADSILAYHQQNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
publication title Allosteric Remodeling of the Histone H3 Binding Pocket in the Pygo2 Phd Finger Triggered by its Binding to the B9L/Bcl9 Co-Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 96
sequence length 104
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2xb1A00
2E6RA 5TABA 1WEWA 4AP4A 2M85A 3MHSA 5J3XA 2MD8C 2I50A 4S3OB 3SOWA 3ZVYA 2M3HA 1LDKC 1JM7B 4GNGA 4BHWA 2MNYA 4LLBA 1X4JA 5D1KB 2F6NA 3M99A 1WGMA 4CA1A 2BAYA 2H0DA 3C5KA 2JMJA 4A49A 1V87A 2MA6A 4GNFA 4LADB 1X4UA 2E6SA 5B77A 1WEEA 5DKAA 2PUYA 2ECWA 2CSZA 5G0FA 2MA5A 2ECGA 1WE9A 1F62A 1WESA 4R2YA 3KQIA 3LQIA 2MT5A 5FERA 2F42A 5LKXA 2JRJA 2H0DB 2HYED 2MUMA 2OXQC 2ECTA 2JMDA 3EB6A 3MHHA 4AVXA 4LK9A 2YYRA 1RMDA 2YQLA 1T1HA 5B8DA 1Z6UA 4TKPB 2LXHC 2YSMA 4YAXA 1VD4A 2KWKA 2L80A 2MD7B 2D8SA 1G25A 2CKLA 2Y1MA 5D1MB 4WZ2A 4AUQB 2VJFA 2KIZA 3V43A 5G05B 2C2VS 2KWNA 3LQJA 4P5OB 4I7DA 4AYCA 3KV6A 3RPGC 5B78A 4N4FA 1FBVA 4GNEA 4A4CA 2KGIA 2FUUA 4UP0A 2LDRA 3SOUA 3O35A 3HTKC 3U5PA 4ZDTA 5TDWA 4YBSA 4MVTA 4LKAA 3SHBA 2G45A 1U6GB 2L0BA 3U5MA 4WZ0A 5H9MA 3KV5A 2AN6A 3ZYQA 2ZETC 1XWHA 4WA6A 5G04B 3EB5A 2VJFB 2LGKA 4S3OC 2Y1NA 3N9PA 2JMIA 4AYCB 5D1LB 2VJEA 4QF2A 3FL2A 1WEOA 5EYAF 4YBTA 2KFTA 2VPEA 1CHCA 4L7XA 2PNXA 4UI9B 3HCUA 4XI1A 1ZBDB 3N9OA 3ZTGA 3O70A 5LKZA 2M1RA 2LGLA 3T6RA 4W4UA 5KH7A 3ZVZB 5KH9A 2YURA 2K16A 2KYUA 4FIPA 3M62A 2QIZA 1MM3A 2VJEB 4B7YC 5DINA 3GL6A 5H1VA 3NG2A 2HDPA 1MM2A 2L5UA 3ZNIA 3L11A 4IC2A 1WEVA 2K1JA 1HYIA 4A0CD 2YHOA 1VYXA 1X4IA 2G6QA 4C9ZA 4R8PK 1WEMA 2LQ6A 4YC9A 2VPGA 1JOCA 2LRIC 1WILA 2KWJA 4PPEA 2KR4A 2KWOA 3QZVA 3HCTA 3RPGB 2QICA 4A4BA 3C6WA 2KGGA 5KH3A 1JM7A 3L1XA 2VPDA 5C11A 2YHNA 4N3WA 5TDRA 5I3LA 1WEPA 1IYMA 1WEUA 2ECNA 2DX8A 5H1TA 2YW8A 2VNFA 1VFYA 2CKLB 4WZ3B 4V3KC 3U5NA 3T7LA 1Z2QA 2VPBA 5FB0A 5B75A 3N9MA 3PUQA 5B79A 2G43A 5AIUA 5TBNA 2YQMA 2FUIA 2K4DA 4I7CA 4GNDA 2KU3A 3M63A 4IC3A 4F52B 1DVPA 2YREA 3GV4A 3ZPV1 4BBQA 2UZGA 3RTRB 1BORA 5AITA 3O33A 5LKUA 5LKTA 2QJ0A 1Z60A 3PHDA 2FSAA 3O34A 4B86C 1N87A 2IDAA 2EGPA 4ZUXU 5JG6A 4YATA 1WENA 4FK5A 3LRQA 3VK6A 2LXPC 2LGGA 4YBMA 4YADA 2ECIA 3DPLR 2XB1A 1E4UA 2C2LA 2RI7A 5FB1A 4FO9A 4FJCA 2KE1A 4YABA 4X3GA 3PURA 2L43A 4Q6FA 5TRBA 3U5OA 3ASLA 5B76A 4PTBA 2YSJA 2M6MA 2L75A 4I7BA 4MSXA 4QF3A 3O36A 3N9NA 1HYJA 5FEYA 1K2FA 2RSDA 3O37A 4NN2A 2K17A 5H1UA 2CSYA 4O64A 2LN0A 4LJNA 2Y43A 2CT2A 3DQVR 1WIMA 2ECVA 2VP7A 2ECJA 3KNVA 3ZPVE 2YT5A 1LDJB 4R7EA 4UP5A 4GB0A 2F6JA 2EA6A 3IHPA 2MIQA 3LQHA 4V3LC 3I2DA 3HCSA 2YUCA 3N9LA 2EODA 4ZQLA 2XEUA 2KREA 2NAAA 2MNZA 3O7AA 2LV9A 3SOXA 2LGVA 4CCGX 1WFKA 1FP0A 1WEQA 2YU4A 4L58A 5C13A 5LCWB 3L1ZB 3N9QA
chains in the Genus database with same CATH superfamily
2E6RA 5TABA 3H7HA 1WEWA 4AP4A 2M85A 3MHSA 2E61A 5J3XA 2MD8C 2CONA 2KKYA 2I50A 4S3OB 3SOWA 3ZVYA 2KKXA 2M3HA 2LAUA 1LDKC 1JM7B 4GNGA 4F1PA 2P57A 4BHWA 2MNYA 4LLBA 2D8UA 1X4JA 5D1KB 2F6NA 3M99A 1WGMA 4OGCA 4CA1A 2BAYA 2H0DA 3C5KA 2JMJA 4A49A 1V87A 2MA6A 4GNFA 4LADB 1X4UA 2E6SA 5B77A 2XOCA 3DDTA 1WEEA 5DKAA 2PUYA 2ECWA 2CSZA 5G0FA 2FFWA 2MA5A 2ECGA 1WE9A 3FANA 1F62A 1WESA 3O47A 4R2YA 3Q1DA 3KQIA 3LQIA 2JM3A 2MT5A 5FERA 2F42A 5LKXA 2JRJA 2H0DB 2HYED 2MUMA 2OXQC 2ECTA 2JMDA 3EB6A 3MHHA 4AVXA 4LK9A 2YYRA 1RMDA 2YQLA 1T1HA 5B8DA 1Z6UA 4TKPB 3JUEA 2LXHC 2YSMA 4YAXA 1VD4A 2KWKA 2L80A 2MD7B 2D8SA 1G25A 2CKLA 2Y1MA 5D1MB 5SVYA 4WZ2A 4AUQB 2VJFA 2KIZA 3V43A 3FM8C 2C2VS 5G05B 2KWNA 3LQJA 4P5OB 4I7DA 4AYCA 3KV6A 3RPGC 5B78A 4N4FA 1FBVA 4GNEA 4A4CA 1MBMA 2KGIA 2FUUA 3SUBA 4UP0A 2LDRA 3SOUA 3O35A 3HTKC 3U5PA 4ZDTA 5TDWA 4YBSA 4MVTA 4LKAA 3SHBA 2G45A 1U6GB 2L0BA 3DWDA 3U5MA 4WZ0A 5H9MA 3KV5A 2AN6A 3ZYQA 2ZETC 3LJUX 1XWHA 4WA6A 5G04B 3LVRE 3EB5A 2VJFB 2LGKA 4S3OC 3E2DA 2Y1NA 3N9PA 2JMIA 4AYCB 5D1LB 2VJEA 3MDBC 4QF2A 3FL2A 1WEOA 5EYAF 2L7PA 4YBTA 2KFTA 2VPEA 1CHCA 4L7XA 2PNXA 4UI9B 3FJUB 3HCUA 4XI1A 1ZBDB 3N9OA 3ZTGA 3O70A 2FD4A 5LKZA 2M1RA 2LGLA 3T6RA 2CSVA 3KDEC 4W4UA 5KH7A 3FEHA 3ZVZB 5KH9A 2YURA 2K16A 2KYUA 4FIPA 2DSMA 3M62A 3M7KA 2QIZA 1MM3A 2VJEB 4B7YC 5DINA 3GL6A 5SVIA 5H1VA 3NG2A 2HDPA 4O62A 1MM2A 2DJAA 2L5UA 3ZNIA 3L11A 4IC2A 1WEVA 2K1JA 1HYIA 4A0CD 2YHOA 1VYXA 1X4IA 2G6QA 4C9ZA 4R8PK 1WEMA 2LQ6A 4YC9A 2VPGA 1JOCA 2LRIC 1WILA 4Z0OA 2KWJA 4Z0RA 4PPEA 2KR4A 2KWOA 3QZVA 3HCTA 3RPGB 2QICA 4A4BA 3C6WA 2KGGA 5KH3A 1JM7A 2CRWA 3L1XA 2VPDA 5C11A 2YHNA 4N3WA 5TDRA 5I3LA 1WEPA 1IYMA 1WEUA 2ECNA 2DX8A 5H1TA 2YW8A 2VNFA 1VFYA 2CKLB 2JUNA 4WZ3B 4V3KC 3U5NA 3T7LA 1Z2QA 2XOZA 2VPBA 3PLWA 5FB0A 2RR4A 5B75A 3N9MA 3PUQA 5B79A 2G43A 5AIUA 5TBNA 2YQMA 2FUIA 2K4DA 4I7CA 4GNDA 2KU3A 3M63A 4IC3A 2CRRA 4F52B 4OGEA 1DVPA 2YREA 2OWAA 3GV4A 3ZPV1 4BBQA 2UZGA 3RTRB 1BORA 5AITA 3O33A 5LKUA 5LKTA 2EGMA 2QJ0A 1Z60A 3PHDA 2FSAA 3O34A 4B86C 4H9DA 1N87A 2IQJA 2M13A 2IDAA 2EGPA 4ZUXU 5JG6A 4YATA 1WENA 4FK5A 3LRQA 3VK6A 2YVRA 2LXPC 3T9KA 2LGGA 4YBMA 2B0OE 4YADA 2ECIA 4QQ4A 3DPLR 2XB1A 1E4UA 2C2LA 3LVQE 2RI7A 5FB1A 4FO9A 4FJCA 2KE1A 4YABA 4X3GA 3PURA 2L43A 4Q6FA 5TRBA 3U5OA 3ASLA 5B76A 4PTBA 2YSJA 2M6MA 5K3QA 2L75A 4I7BA 4MSXA 4QF3A 3O36A 3N9NA 1HYJA 5FEYA 1K2FA 2RSDA 3O37A 4NN2A 2K17A 5H1UA 2CSYA 4O64A 2MKEA 2LN0A 4LJNA 2Y43A 2CT2A 3DQVR 1WIMA 2ECVA 2VP7A 2ECJA 3KNVA 3FAOA 3ZPVE 2XP0A 1LDJB 2YT5A 4R7EA 4UP5A 4GB0A 2F6JA 2EA6A 3IHPA 2MIQA 3LQHA 1DCQA 4V3LC 3I2DA 3HCSA 2EXUA 2YUCA 3N9LA 2EODA 4ZQLA 5SVXA 3LDYA 2XEUA 2KREA 2NAAA 2MNZA 5SVIB 3O7AA 2LV9A 3SOXA 2LGVA 4CCGX 1WFKA 1FP0A 1WEQA 2YU4A 4L58A 5C13A 5LCWB 3L1ZB 2XOYA 3N9QA
chains in the Genus database with same CATH topology
2E6RA 5TABA 1WEWA 4AP4A 2M85A 3MHSA 5J3XA 2MD8C 2I50A 4S3OB 3SOWA 3ZVYA 2M3HA 1LDKC 1JM7B 4GNGA 4BHWA 2MNYA 4LLBA 1X4JA 5D1KB 2F6NA 3M99A 1WGMA 4CA1A 2BAYA 2H0DA 3C5KA 2JMJA 4A49A 1V87A 2MA6A 4GNFA 4LADB 1X4UA 2E6SA 5B77A 1WEEA 5DKAA 2PUYA 2ECWA 2CSZA 5G0FA 2MA5A 2ECGA 1WE9A 1F62A 1WESA 4R2YA 3KQIA 3LQIA 2MT5A 5FERA 2F42A 5LKXA 2JRJA 2H0DB 2HYED 2MUMA 2OXQC 2ECTA 2JMDA 3EB6A 3MHHA 4AVXA 4LK9A 2YYRA 1RMDA 2YQLA 1T1HA 5B8DA 1Z6UA 4TKPB 2LXHC 2YSMA 4YAXA 1VD4A 2KWKA 2L80A 2MD7B 2D8SA 1G25A 2CKLA 2Y1MA 5D1MB 4WZ2A 4AUQB 2VJFA 2KIZA 3V43A 5G05B 2C2VS 2KWNA 3LQJA 4P5OB 4I7DA 4AYCA 3KV6A 3RPGC 5B78A 4N4FA 1FBVA 4GNEA 4A4CA 2KGIA 2FUUA 4UP0A 2LDRA 3SOUA 3O35A 3HTKC 3U5PA 4ZDTA 5TDWA 4YBSA 4MVTA 4LKAA 3SHBA 2G45A 1U6GB 2L0BA 3U5MA 4WZ0A 5H9MA 3KV5A 2AN6A 3ZYQA 2ZETC 1XWHA 4WA6A 5G04B 3EB5A 2VJFB 2LGKA 4S3OC 2Y1NA 3N9PA 2JMIA 4AYCB 5D1LB 2VJEA 4QF2A 3FL2A 1WEOA 5EYAF 4YBTA 2KFTA 2VPEA 1CHCA 4L7XA 2PNXA 4UI9B 3HCUA 4XI1A 1ZBDB 3N9OA 3ZTGA 3O70A 5LKZA 2M1RA 2LGLA 3T6RA 4W4UA 5KH7A 3ZVZB 5KH9A 2YURA 2K16A 2KYUA 4FIPA 3M62A 2QIZA 1MM3A 2VJEB 4B7YC 5DINA 3GL6A 5H1VA 3NG2A 2HDPA 1MM2A 2L5UA 3ZNIA 3L11A 4IC2A 1WEVA 2K1JA 1HYIA 4A0CD 2YHOA 1VYXA 1X4IA 2G6QA 4C9ZA 4R8PK 1WEMA 2LQ6A 4YC9A 2VPGA 1JOCA 2LRIC 1WILA 2KWJA 4PPEA 2KR4A 2KWOA 3QZVA 3HCTA 3RPGB 2QICA 4A4BA 3C6WA 2KGGA 5KH3A 1JM7A 3L1XA 2VPDA 5C11A 2YHNA 4N3WA 5TDRA 5I3LA 1WEPA 1IYMA 1WEUA 2ECNA 2DX8A 5H1TA 2YW8A 2VNFA 1VFYA 2CKLB 4WZ3B 4V3KC 3U5NA 3T7LA 1Z2QA 2VPBA 5FB0A 5B75A 3N9MA 3PUQA 5B79A 2G43A 5AIUA 5TBNA 2YQMA 2FUIA 2K4DA 4I7CA 4GNDA 2KU3A 3M63A 4IC3A 4F52B 1DVPA 2YREA 3GV4A 3ZPV1 4BBQA 2UZGA 3RTRB 1BORA 5AITA 3O33A 5LKUA 5LKTA 2QJ0A 1Z60A 3PHDA 2FSAA 3O34A 4B86C 1N87A 2IDAA 2EGPA 4ZUXU 5JG6A 4YATA 1WENA 4FK5A 3LRQA 3VK6A 2LXPC 2LGGA 4YBMA 4YADA 2ECIA 3DPLR 2XB1A 1E4UA 2C2LA 2RI7A 5FB1A 4FO9A 4FJCA 2KE1A 4YABA 4X3GA 3PURA 2L43A 4Q6FA 5TRBA 3U5OA 3ASLA 5B76A 4PTBA 2YSJA 2M6MA 2L75A 4I7BA 4MSXA 4QF3A 3O36A 3N9NA 1HYJA 5FEYA 1K2FA 2RSDA 3O37A 4NN2A 2K17A 5H1UA 2CSYA 4O64A 2LN0A 4LJNA 2Y43A 2CT2A 3DQVR 1WIMA 2ECVA 2VP7A 2ECJA 3KNVA 3ZPVE 2YT5A 1LDJB 4R7EA 4UP5A 4GB0A 2F6JA 2EA6A 3IHPA 2MIQA 3LQHA 4V3LC 3I2DA 3HCSA 2YUCA 3N9LA 2EODA 4ZQLA 2XEUA 2KREA 2NAAA 2MNZA 3O7AA 2LV9A 3SOXA 2LGVA 4CCGX 1WFKA 1FP0A 1WEQA 2YU4A 4L58A 5C13A 5LCWB 3L1ZB 3N9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6R A;  5TAB A;  1WEW A;  4AP4 A;  2M85 A;  3MHS A;  5J3X A;  2MD8 C;  2I50 A;  4S3O B;  3SOW A;  3ZVY A;  2M3H A;  1LDK C;  1JM7 B;  4GNG A;  4BHW A;  2MNY A;  4LLB A;  1X4J A;  5D1K B;  2F6N A;  3M99 A;  1WGM A;  4CA1 A;  2BAY A;  2H0D A;  3C5K A;  2JMJ A;  4A49 A;  1V87 A;  2MA6 A;  4GNF A;  4LAD B;  1X4U A;  2E6S A;  5B77 A;  1WEE A;  5DKA A;  2PUY A;  2ECW A;  2CSZ A;  5G0F A;  2MA5 A;  2ECG A;  1WE9 A;  1F62 A;  1WES A;  4R2Y A;  3KQI A;  3LQI A;  2MT5 A;  5FER A;  2F42 A;  5LKX A;  2JRJ A;  2H0D B;  2HYE D;  2MUM A;  2OXQ C;  2ECT A;  2JMD A;  3EB6 A;  3MHH A;  4AVX A;  4LK9 A;  2YYR A;  1RMD A;  2YQL A;  1T1H A;  5B8D A;  1Z6U A;  4TKP B;  2LXH C;  2YSM A;  4YAX A;  1VD4 A;  2KWK A;  2L80 A;  2MD7 B;  2D8S A;  1G25 A;  2CKL A;  2Y1M A;  5D1M B;  4WZ2 A;  4AUQ B;  2VJF A;  2KIZ A;  3V43 A;  5G05 B;  2C2V S;  2KWN A;  3LQJ A;  4P5O B;  4I7D A;  4AYC A;  3KV6 A;  3RPG C;  5B78 A;  4N4F A;  1FBV A;  4GNE A;  4A4C A;  2KGI A;  2FUU A;  4UP0 A;  2LDR A;  3SOU A;  3O35 A;  3HTK C;  3U5P A;  4ZDT A;  5TDW A;  4YBS A;  4MVT A;  4LKA A;  3SHB A;  2G45 A;  1U6G B;  2L0B A;  3U5M A;  4WZ0 A;  5H9M A;  3KV5 A;  2AN6 A;  3ZYQ A;  2ZET C;  1XWH A;  4WA6 A;  5G04 B;  3EB5 A;  2VJF B;  2LGK A;  4S3O C;  2Y1N A;  3N9P A;  2JMI A;  4AYC B;  5D1L B;  2VJE A;  4QF2 A;  3FL2 A;  1WEO A;  5EYA F;  4YBT A;  2KFT A;  2VPE A;  1CHC A;  4L7X A;  2PNX A;  4UI9 B;  3HCU A;  4XI1 A;  1ZBD B;  3N9O A;  3ZTG A;  3O70 A;  5LKZ A;  2M1R A;  2LGL A;  3T6R A;  4W4U A;  5KH7 A;  3ZVZ B;  5KH9 A;  2YUR A;  2K16 A;  2KYU A;  4FIP A;  3M62 A;  2QIZ A;  1MM3 A;  2VJE B;  4B7Y C;  5DIN A;  3GL6 A;  5H1V A;  3NG2 A;  2HDP A;  1MM2 A;  2L5U A;  3ZNI A;  3L11 A;  4IC2 A;  1WEV A;  2K1J A;  1HYI A;  4A0C D;  2YHO A;  1VYX A;  1X4I A;  2G6Q A;  4C9Z A;  4R8P K;  1WEM A;  2LQ6 A;  4YC9 A;  2VPG A;  1JOC A;  2LRI C;  1WIL A;  2KWJ A;  4PPE A;  2KR4 A;  2KWO A;  3QZV A;  3HCT A;  3RPG B;  2QIC A;  4A4B A;  3C6W A;  2KGG A;  5KH3 A;  1JM7 A;  3L1X A;  2VPD A;  5C11 A;  2YHN A;  4N3W A;  5TDR A;  5I3L A;  1WEP A;  1IYM A;  1WEU A;  2ECN A;  2DX8 A;  5H1T A;  2YW8 A;  2VNF A;  1VFY A;  2CKL B;  4WZ3 B;  4V3K C;  3U5N A;  3T7L A;  1Z2Q A;  2VPB A;  5FB0 A;  5B75 A;  3N9M A;  3PUQ A;  5B79 A;  2G43 A;  5AIU A;  5TBN A;  2YQM A;  2FUI A;  2K4D A;  4I7C A;  4GND A;  2KU3 A;  3M63 A;  4IC3 A;  4F52 B;  1DVP A;  2YRE A;  3GV4 A;  3ZPV 1;  4BBQ A;  2UZG A;  3RTR B;  1BOR A;  5AIT A;  3O33 A;  5LKU A;  5LKT A;  2QJ0 A;  1Z60 A;  3PHD A;  2FSA A;  3O34 A;  4B86 C;  1N87 A;  2IDA A;  2EGP A;  4ZUX U;  5JG6 A;  4YAT A;  1WEN A;  4FK5 A;  3LRQ A;  3VK6 A;  2LXP C;  2LGG A;  4YBM A;  4YAD A;  2ECI A;  3DPL R;  2XB1 A;  1E4U A;  2C2L A;  2RI7 A;  5FB1 A;  4FO9 A;  4FJC A;  2KE1 A;  4YAB A;  4X3G A;  3PUR A;  2L43 A;  4Q6F A;  5TRB A;  3U5O A;  3ASL A;  5B76 A;  4PTB A;  2YSJ A;  2M6M A;  2L75 A;  4I7B A;  4MSX A;  4QF3 A;  3O36 A;  3N9N A;  1HYJ A;  5FEY A;  1K2F A;  2RSD A;  3O37 A;  4NN2 A;  2K17 A;  5H1U A;  2CSY A;  4O64 A;  2LN0 A;  4LJN A;  2Y43 A;  2CT2 A;  3DQV R;  1WIM A;  2ECV A;  2VP7 A;  2ECJ A;  3KNV A;  3ZPV E;  2YT5 A;  1LDJ B;  4R7E A;  4UP5 A;  4GB0 A;  2F6J A;  2EA6 A;  3IHP A;  2MIQ A;  3LQH A;  4V3L C;  3I2D A;  3HCS A;  2YUC A;  3N9L A;  2EOD A;  4ZQL A;  2XEU A;  2KRE A;  2NAA A;  2MNZ A;  3O7A A;  2LV9 A;  3SOX A;  2LGV A;  4CCG X;  1WFK A;  1FP0 A;  1WEQ A;  2YU4 A;  4L58 A;  5C13 A;  5LCW B;  3L1Z B;  3N9Q A; 
#chains in the Genus database with same CATH topology
 2E6R A;  5TAB A;  3H7H A;  1WEW A;  4AP4 A;  2M85 A;  3MHS A;  2E61 A;  5J3X A;  2MD8 C;  2CON A;  2KKY A;  2I50 A;  4S3O B;  3SOW A;  3ZVY A;  2KKX A;  2M3H A;  2LAU A;  1LDK C;  1JM7 B;  4GNG A;  4F1P A;  2P57 A;  4BHW A;  2MNY A;  4LLB A;  2D8U A;  1X4J A;  5D1K B;  2F6N A;  3M99 A;  1WGM A;  4OGC A;  4CA1 A;  2BAY A;  2H0D A;  3C5K A;  2JMJ A;  4A49 A;  1V87 A;  2MA6 A;  4GNF A;  4LAD B;  1X4U A;  2E6S A;  5B77 A;  2XOC A;  3DDT A;  1WEE A;  5DKA A;  2PUY A;  2ECW A;  2CSZ A;  5G0F A;  2FFW A;  2MA5 A;  2ECG A;  1WE9 A;  3FAN A;  1F62 A;  1WES A;  3O47 A;  4R2Y A;  3Q1D A;  3KQI A;  3LQI A;  2JM3 A;  2MT5 A;  5FER A;  2F42 A;  5LKX A;  2JRJ A;  2H0D B;  2HYE D;  2MUM A;  2OXQ C;  2ECT A;  2JMD A;  3EB6 A;  3MHH A;  4AVX A;  4LK9 A;  2YYR A;  1RMD A;  2YQL A;  1T1H A;  5B8D A;  1Z6U A;  4TKP B;  3JUE A;  2LXH C;  2YSM A;  4YAX A;  1VD4 A;  2KWK A;  2L80 A;  2MD7 B;  2D8S A;  1G25 A;  2CKL A;  2Y1M A;  5D1M B;  5SVY A;  4WZ2 A;  4AUQ B;  2VJF A;  2KIZ A;  3V43 A;  3FM8 C;  2C2V S;  5G05 B;  2KWN A;  3LQJ A;  4P5O B;  4I7D A;  4AYC A;  3KV6 A;  3RPG C;  5B78 A;  4N4F A;  1FBV A;  4GNE A;  4A4C A;  1MBM A;  2KGI A;  2FUU A;  3SUB A;  4UP0 A;  2LDR A;  3SOU A;  3O35 A;  3HTK C;  3U5P A;  4ZDT A;  5TDW A;  4YBS A;  4MVT A;  4LKA A;  3SHB A;  2G45 A;  1U6G B;  2L0B A;  3DWD A;  3U5M A;  4WZ0 A;  5H9M A;  3KV5 A;  2AN6 A;  3ZYQ A;  2ZET C;  3LJU X;  1XWH A;  4WA6 A;  5G04 B;  3LVR E;  3EB5 A;  2VJF B;  2LGK A;  4S3O C;  3E2D A;  2Y1N A;  3N9P A;  2JMI A;  4AYC B;  5D1L B;  2VJE A;  3MDB C;  4QF2 A;  3FL2 A;  1WEO A;  5EYA F;  2L7P A;  4YBT A;  2KFT A;  2VPE A;  1CHC A;  4L7X A;  2PNX A;  4UI9 B;  3FJU B;  3HCU A;  4XI1 A;  1ZBD B;  3N9O A;  3ZTG A;  3O70 A;  2FD4 A;  5LKZ A;  2M1R A;  2LGL A;  3T6R A;  2CSV A;  3KDE C;  4W4U A;  5KH7 A;  3FEH A;  3ZVZ B;  5KH9 A;  2YUR A;  2K16 A;  2KYU A;  4FIP A;  2DSM A;  3M62 A;  3M7K A;  2QIZ A;  1MM3 A;  2VJE B;  4B7Y C;  5DIN A;  3GL6 A;  5SVI A;  5H1V A;  3NG2 A;  2HDP A;  4O62 A;  1MM2 A;  2DJA A;  2L5U A;  3ZNI A;  3L11 A;  4IC2 A;  1WEV A;  2K1J A;  1HYI A;  4A0C D;  2YHO A;  1VYX A;  1X4I A;  2G6Q A;  4C9Z A;  4R8P K;  1WEM A;  2LQ6 A;  4YC9 A;  2VPG A;  1JOC A;  2LRI C;  1WIL A;  4Z0O A;  2KWJ A;  4Z0R A;  4PPE A;  2KR4 A;  2KWO A;  3QZV A;  3HCT A;  3RPG B;  2QIC A;  4A4B A;  3C6W A;  2KGG A;  5KH3 A;  1JM7 A;  2CRW A;  3L1X A;  2VPD A;  5C11 A;  2YHN A;  4N3W A;  5TDR A;  5I3L A;  1WEP A;  1IYM A;  1WEU A;  2ECN A;  2DX8 A;  5H1T A;  2YW8 A;  2VNF A;  1VFY A;  2CKL B;  2JUN A;  4WZ3 B;  4V3K C;  3U5N A;  3T7L A;  1Z2Q A;  2XOZ A;  2VPB A;  3PLW A;  5FB0 A;  2RR4 A;  5B75 A;  3N9M A;  3PUQ A;  5B79 A;  2G43 A;  5AIU A;  5TBN A;  2YQM A;  2FUI A;  2K4D A;  4I7C A;  4GND A;  2KU3 A;  3M63 A;  4IC3 A;  2CRR A;  4F52 B;  4OGE A;  1DVP A;  2YRE A;  2OWA A;  3GV4 A;  3ZPV 1;  4BBQ A;  2UZG A;  3RTR B;  1BOR A;  5AIT A;  3O33 A;  5LKU A;  5LKT A;  2EGM A;  2QJ0 A;  1Z60 A;  3PHD A;  2FSA A;  3O34 A;  4B86 C;  4H9D A;  1N87 A;  2IQJ A;  2M13 A;  2IDA A;  2EGP A;  4ZUX U;  5JG6 A;  4YAT A;  1WEN A;  4FK5 A;  3LRQ A;  3VK6 A;  2YVR A;  2LXP C;  3T9K A;  2LGG A;  4YBM A;  2B0O E;  4YAD A;  2ECI A;  4QQ4 A;  3DPL R;  2XB1 A;  1E4U A;  2C2L A;  3LVQ E;  2RI7 A;  5FB1 A;  4FO9 A;  4FJC A;  2KE1 A;  4YAB A;  4X3G A;  3PUR A;  2L43 A;  4Q6F A;  5TRB A;  3U5O A;  3ASL A;  5B76 A;  4PTB A;  2YSJ A;  2M6M A;  5K3Q A;  2L75 A;  4I7B A;  4MSX A;  4QF3 A;  3O36 A;  3N9N A;  1HYJ A;  5FEY A;  1K2F A;  2RSD A;  3O37 A;  4NN2 A;  2K17 A;  5H1U A;  2CSY A;  4O64 A;  2MKE A;  2LN0 A;  4LJN A;  2Y43 A;  2CT2 A;  3DQV R;  1WIM A;  2ECV A;  2VP7 A;  2ECJ A;  3KNV A;  3FAO A;  3ZPV E;  2XP0 A;  1LDJ B;  2YT5 A;  4R7E A;  4UP5 A;  4GB0 A;  2F6J A;  2EA6 A;  3IHP A;  2MIQ A;  3LQH A;  1DCQ A;  4V3L C;  3I2D A;  3HCS A;  2EXU A;  2YUC A;  3N9L A;  2EOD A;  4ZQL A;  5SVX A;  3LDY A;  2XEU A;  2KRE A;  2NAA A;  2MNZ A;  5SVI B;  3O7A A;  2LV9 A;  3SOX A;  2LGV A;  4CCG X;  1WFK A;  1FP0 A;  1WEQ A;  2YU4 A;  4L58 A;  5C13 A;  5LCW B;  3L1Z B;  2XOY A;  3N9Q A; 
#chains in the Genus database with same CATH homology
 2E6R A;  5TAB A;  1WEW A;  4AP4 A;  2M85 A;  3MHS A;  5J3X A;  2MD8 C;  2I50 A;  4S3O B;  3SOW A;  3ZVY A;  2M3H A;  1LDK C;  1JM7 B;  4GNG A;  4BHW A;  2MNY A;  4LLB A;  1X4J A;  5D1K B;  2F6N A;  3M99 A;  1WGM A;  4CA1 A;  2BAY A;  2H0D A;  3C5K A;  2JMJ A;  4A49 A;  1V87 A;  2MA6 A;  4GNF A;  4LAD B;  1X4U A;  2E6S A;  5B77 A;  1WEE A;  5DKA A;  2PUY A;  2ECW A;  2CSZ A;  5G0F A;  2MA5 A;  2ECG A;  1WE9 A;  1F62 A;  1WES A;  4R2Y A;  3KQI A;  3LQI A;  2MT5 A;  5FER A;  2F42 A;  5LKX A;  2JRJ A;  2H0D B;  2HYE D;  2MUM A;  2OXQ C;  2ECT A;  2JMD A;  3EB6 A;  3MHH A;  4AVX A;  4LK9 A;  2YYR A;  1RMD A;  2YQL A;  1T1H A;  5B8D A;  1Z6U A;  4TKP B;  2LXH C;  2YSM A;  4YAX A;  1VD4 A;  2KWK A;  2L80 A;  2MD7 B;  2D8S A;  1G25 A;  2CKL A;  2Y1M A;  5D1M B;  4WZ2 A;  4AUQ B;  2VJF A;  2KIZ A;  3V43 A;  5G05 B;  2C2V S;  2KWN A;  3LQJ A;  4P5O B;  4I7D A;  4AYC A;  3KV6 A;  3RPG C;  5B78 A;  4N4F A;  1FBV A;  4GNE A;  4A4C A;  2KGI A;  2FUU A;  4UP0 A;  2LDR A;  3SOU A;  3O35 A;  3HTK C;  3U5P A;  4ZDT A;  5TDW A;  4YBS A;  4MVT A;  4LKA A;  3SHB A;  2G45 A;  1U6G B;  2L0B A;  3U5M A;  4WZ0 A;  5H9M A;  3KV5 A;  2AN6 A;  3ZYQ A;  2ZET C;  1XWH A;  4WA6 A;  5G04 B;  3EB5 A;  2VJF B;  2LGK A;  4S3O C;  2Y1N A;  3N9P A;  2JMI A;  4AYC B;  5D1L B;  2VJE A;  4QF2 A;  3FL2 A;  1WEO A;  5EYA F;  4YBT A;  2KFT A;  2VPE A;  1CHC A;  4L7X A;  2PNX A;  4UI9 B;  3HCU A;  4XI1 A;  1ZBD B;  3N9O A;  3ZTG A;  3O70 A;  5LKZ A;  2M1R A;  2LGL A;  3T6R A;  4W4U A;  5KH7 A;  3ZVZ B;  5KH9 A;  2YUR A;  2K16 A;  2KYU A;  4FIP A;  3M62 A;  2QIZ A;  1MM3 A;  2VJE B;  4B7Y C;  5DIN A;  3GL6 A;  5H1V A;  3NG2 A;  2HDP A;  1MM2 A;  2L5U A;  3ZNI A;  3L11 A;  4IC2 A;  1WEV A;  2K1J A;  1HYI A;  4A0C D;  2YHO A;  1VYX A;  1X4I A;  2G6Q A;  4C9Z A;  4R8P K;  1WEM A;  2LQ6 A;  4YC9 A;  2VPG A;  1JOC A;  2LRI C;  1WIL A;  2KWJ A;  4PPE A;  2KR4 A;  2KWO A;  3QZV A;  3HCT A;  3RPG B;  2QIC A;  4A4B A;  3C6W A;  2KGG A;  5KH3 A;  1JM7 A;  3L1X A;  2VPD A;  5C11 A;  2YHN A;  4N3W A;  5TDR A;  5I3L A;  1WEP A;  1IYM A;  1WEU A;  2ECN A;  2DX8 A;  5H1T A;  2YW8 A;  2VNF A;  1VFY A;  2CKL B;  4WZ3 B;  4V3K C;  3U5N A;  3T7L A;  1Z2Q A;  2VPB A;  5FB0 A;  5B75 A;  3N9M A;  3PUQ A;  5B79 A;  2G43 A;  5AIU A;  5TBN A;  2YQM A;  2FUI A;  2K4D A;  4I7C A;  4GND A;  2KU3 A;  3M63 A;  4IC3 A;  4F52 B;  1DVP A;  2YRE A;  3GV4 A;  3ZPV 1;  4BBQ A;  2UZG A;  3RTR B;  1BOR A;  5AIT A;  3O33 A;  5LKU A;  5LKT A;  2QJ0 A;  1Z60 A;  3PHD A;  2FSA A;  3O34 A;  4B86 C;  1N87 A;  2IDA A;  2EGP A;  4ZUX U;  5JG6 A;  4YAT A;  1WEN A;  4FK5 A;  3LRQ A;  3VK6 A;  2LXP C;  2LGG A;  4YBM A;  4YAD A;  2ECI A;  3DPL R;  2XB1 A;  1E4U A;  2C2L A;  2RI7 A;  5FB1 A;  4FO9 A;  4FJC A;  2KE1 A;  4YAB A;  4X3G A;  3PUR A;  2L43 A;  4Q6F A;  5TRB A;  3U5O A;  3ASL A;  5B76 A;  4PTB A;  2YSJ A;  2M6M A;  2L75 A;  4I7B A;  4MSX A;  4QF3 A;  3O36 A;  3N9N A;  1HYJ A;  5FEY A;  1K2F A;  2RSD A;  3O37 A;  4NN2 A;  2K17 A;  5H1U A;  2CSY A;  4O64 A;  2LN0 A;  4LJN A;  2Y43 A;  2CT2 A;  3DQV R;  1WIM A;  2ECV A;  2VP7 A;  2ECJ A;  3KNV A;  3ZPV E;  2YT5 A;  1LDJ B;  4R7E A;  4UP5 A;  4GB0 A;  2F6J A;  2EA6 A;  3IHP A;  2MIQ A;  3LQH A;  4V3L C;  3I2D A;  3HCS A;  2YUC A;  3N9L A;  2EOD A;  4ZQL A;  2XEU A;  2KRE A;  2NAA A;  2MNZ A;  3O7A A;  2LV9 A;  3SOX A;  2LGV A;  4CCG X;  1WFK A;  1FP0 A;  1WEQ A;  2YU4 A;  4L58 A;  5C13 A;  5LCW B;  3L1Z B;  3N9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...