4AYCA

Rnf8 ring domain structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
136
structure length
136
Chain Sequence
LGSMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 136
sequence length 136
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aycA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycA02
1X4UA 1HYJA 5B78A 1WILA 1SLQA 4N4FA 4S3OB 3VMXA 4LJNA 3HTKA 3V43A 1YYCA 1FBVA 4UP0A 3ZNIA 2BAYA 2YW8A 3O36A 3HCUA 2LGVA 3N9PA 2ECNA 3KQIA 4XE5B 1OXZA 2JMIA 3RPGC 5AVVB 4LK9A 2YREA 2KGIA 2MNYA 2LXPC 4I7CA 5AW6B 1FOSF 2LN0A 2YURA 1WGMA 4BBQA 1X8YA 2QIZA 2G43A 3ZPV1 1FAVA 4B86A 1K2FA 5B79A 5APUA 3M06A 2FUUA 5DKAA 1MM3A 4AUWA 4LC1A 4L7XA 3KV5A 1JOCA 2KWNA 1MUUA 2XB1A 2HDPA 1RMDA 4S3OC 2P7JA 1Z60A 2IPPA 3DPLR 4V3KC 4C7NB 4LLBA 1WEOA 2ECJA 2H0DA 2CKLB 4YC9A 1GU5A 2XV5A 1JM7B 4I2LC 5AVUB 1WESA 2C9NY 2LQ6A 4GT1A 5FERA 3NXSA 3TNUB 2G6QA 4WA6A 5APQA 4QF2A 1NWQA 1WENA 3TK1A 2VJFA 4C46A 2OXQC 1WEQA 1J2JB 4M3LA 2IDAA 2XZRA 4F52B 2VJEA 2Y1MA 4AUQB 4Q6FA 5H1VA 1GTWA 2G45A 2YO2A 1WFKA 2PUYA 1G25A 3IR9A 4PPEA 5LKXA 5AVXB 5LKTA 2Q3IA 2R5DA 3ASLA 2Y43A 4CCGX 5KH7A 2WWWA 1WEPA 3L11A 4CA1A 3TYYA 3ZYQA 2XEUA 2L80A 2Q5UA 1WEEA 4R7EA 2L5UA 4XI1A 1S9KD 1WIMA 3V4WA 2VP7A 2WT7A 3HE5B 4YADA 3M9HA 2YNYA 3I2DA 5H9MA 1Z6UA 2DX8A 2QJ0A 3L1ZB 4BHWA 4C9ZA 1T2KD 3MGNA 3T6RA 2WPSA 3QZVA 2H0DB 1HYIA 4AVXA 5AITA 3EB5A 1FP0A 2LGLA 3HCSA 5LCWB 3L37A 3PHDA 1H8AA 2YQMA 1CHCA 2JJLA 4I7DA 2MUMA 2JMDA 1KQLA 3SHBA 2Z5IA 2VPDA 1A02J 4X3GA 3P7KA 5C13A 4HYTB 2KWJA 2RI7A 3ZPVE 2LDRA 2ZXEB 1X4IA 5G0FA 2AN6A 3MHSA 3N9QA 5FB0A 3A7OA 2KE1A 5AW0B 2VPGA 2QICA 2I50A 5JG6A 2QM7A 4GKGA 4PTBA 4FIPA 1T2KC 2WTYA 2R5BA 3OAKA 4JYCA 3DQVR 1NAFA 5AVZB 2E6RA 2VPEA 1E4UA 2ECVA 4A0CD 1U6GB 1WEVA 2MA5A 3LQHA 5EYAF 3LQIA 1G2CB 5APSA 4ZUXU 2D8SA 4V3LC 2KREA 3O70A 5AVTB 1X4JA 1GU4A 5C11A 5AVQB 2K4DA 4R8PK 5TDWA 1DVPA 2YSJA 1FOSE 4O64A 5DINA 2ECGA 2KIZA 1H89A 4KHXA 5AW7B 4AYCA 3A5TA 4LADB 1S9KE 1ZBDB 1XWHA 2KGGA 4NN2A 2KWKA 3PUQA 2XU6A 4YATA 5D1KB 2E42A 3MHHA 3M91A 1CI6A 5AW5B 2YT5A 3L35A 2EODA 2YSMA 1BORA 2PNXA 4MVTA 4N3WA 4DZOA 3PURA 4JYBA 3NTNA 2M85A 4R2YA 4WZ0A 3EB6A 2N9BA 5B76A 4EOTA 2E43A 5FB1A 3N9MA 1CSBA 1WEUA 4YBMA 1VYXA 2ZETC 2C9LY 4A4BA 3SOWA 5AIUA 4GB0A 3LQJA 3VYIA 3C5KA 3KV6A 4QF3A 2VPBA 2LRIC 2KP8A 2QM8A 2C2LA 4GNGA 3HE4A 4MSXA 1WEWA 3HTKC 3N9NA 1GZLA 2YU4A 5KH9A 5AW1B 2EGPA 5LKUA 3SOXA 1N87A 2YUCA 2YQLA 1JUNA 5AVSB 1WE9A 3LIEA 2YHOA 4C7NA 1SP4A 5TDRA 3B8EB 5G05B 4LKAA 2C2VS 2LV9A 1JM7A 1GD2E 1T1HA 4B86C 1H88A 2Z5HA 2F42A 1LDJB 2VJFB 5FEYA 3L1XA 3V5BA 4UI9B 2WPRA 2JRJA 3UIAA 4IC3A 4GNEA 4YBTA 4FO9A 4RESB 4AP4A 1CZQA 2CSYA 2VJEB 1CI6B 3A3YB 5AW3B 3M99A 5B8DA 2MIQA 2LGGA 3O35A 5AVWB 4WZ2A 3O34A 4ZQLA 3SWFA 5AW2B 3ZTGA 5I3LA 2MT5A 3MD0A 2RSDA 2K1JA 5H1UA 5H1TA 3U5MA 5APWA 3NFQA 5G04B 2WPQA 2M3HA 5APTA 3M62A 2E6SA 1GK4A 1MM2A 1IO4A 2EA6A 1OWAA 2P67A 2F6JA 5LKZA 1MFZA 2WT7B 1Z2QA 2ZFCA 3ZVZB 2F6NA 4ZDTA 1VFYA 3HE4B 2LXHC 2R32A 3M63A 2K17A 3LRQA 2NAAA 3O33A 3V4QA 1VD4A 4TKPB 3ZVYA 3HE5A 5AVRB 1HWTC 1A02F 4WZ3B 2L75A 2FUIA 5APXA 3FL2A 2Y1NA 2M6MA 3RTRB 4FJCA 4A49A 2K16A 2UZGA 4AQRD 3KNVA 1DH3A 5TRBA 3A2AA 2L43A 2ECTA 5TBNA 2YO3A 2W27A 5B77A 3VK6A 5AW8B 5APVA 2R3CA 1HJBA 2KYUA 3U5NA 1JNMA 3O7AA 4P5OB 2MA6A 2JMJA 1MV8A 3NMDA 5J3XA 2KR4A 3NG2A 3C6WA 2FSAA 5AVYB 3GL6A 5D1MB 3M9BA 1IYMA 2MNZA 4FK5A 2CT2A 2KFTA 2L0BA 2BASA 2P2UA 4GNDA 3P32A 3T97A 2MD8C 3KQGA 5AW9B 4YAXA 2KWOA 4UP5A 2M1RA 3LIDA 3O8ZA 2KU3A 4YBSA 5AW4B 5TABA 2Q7CA 3P8MC 3T7LA 4IC2A 2YHNA 5B75A 2HYED 4W4UA 4I7BA 1HUCA 3SOUA 3N9OA 1F62A 3I5CA 3IHPA 2MD7B 5APYA 2VNFA 5D1LB 2LGKA 1GK6A 3RPGB 3VMYA 4I6MC 3KDPB 2H7HA 2W6AA 2ECIA 2CKLA 2CSZA 3N9LA 4L58A 1LDKC 1V87A 2YYRA 4AYCB 1WEMA 3HCTA 3O37A 4B7YC 3VTPC 3M0AA 3M0DA 2ECWA 3VMZA 3U5PA 3L36A 3TNUA 2VRSA 4GNFA 3U5OA 3GV4A 1HBWA 5CMZA 5KH3A 4YABA 3VN0A 4A4CA
chains in the Genus database with same CATH superfamily
5B78A 1SFCA 1SLQA 1FBVA 2LGVA 5B66H 3CX5I 4H0LB 3RK3D 2YURA 1WGMA 4L73A 1L2PA 2V7QJ 3AEEC 3KXDA 1JY3P 3TSIA 1LTJB 1LWUA 3H1LG 2HDPA 4I7ZB 4S3OC 4GOFA 1KQGB 2KZJA 2C0XA 2ZXXA 3B5NA 2ECJA 3G3ZA 2QEXP 4YC9A 2QIWA 2N1TB 3H1KJ 4I2LC 2Q6QA 3CCVP 3CWBJ 1VQNP 1DEEG 2D2CC 3KYQA 4C46A 2B0OE 4F52B 4AUQB 1ZMEC 5H1VA 3RK2C 2YO2A 3IR9A 2ZYAA 4PPEA 1NKNA 1PPJD 1VF5C 1JMBA 1KB9I 1RQVA 2R5DA 3ASLA 5SVXA 2KK7A 3TYYA 2XEUA 2L80A 1ZRTD 1YIJP 2Q5UA 1WEEA 4R7EA 1P84I 3FAOA 4H44B 5CJ4A 2GUSA 3AE6C 2FXMA 2WT7A 3HE5B 1DIPA 5BVZA 1IFMA 4U3FE 2YNYA 2QJ0A 3L4FA 1KILD 4O62A 3T6RA 2IYPA 3IAOA 2NRGA 2H0DB 4EIJA 2QJYC 1N7SD 4UB6H 2DW3A 3MP7B 3L71J 1NH4A 3E2DA 5TISE 2LGLA 1KYOE 3MZWB 2AXCA 5KJ7D 3HCSA 3TDKA 4OVNF 1LT9C 4Y99C 3CMAP 2MUMA 2K9JA 2Y0DA 1U7JA 4Z1MH 3L74E 2LR2A 2PGDA 1KN7A 3H1HE 4IFMA 2RI7A 3V2NA 2Q9IA 1AV1A 1HF9A 1RHZB 5FB0A 3A7OA 2I50A 5JG6A 1URQC 3T97B 4FIPA 1KILC 4PD4I 2FY8A 1NAFA 2VPEA 2M3BA 1N7SC 1LTIC 1WEVA 3LQHA 1L0LJ 3HD7B 3D71A 3LQIA 4ZUXU 1IZNB 3V6IA 2UWJE 2L7PA 5H2FH 5KKZC 2KREA 2QSIA 2FFDC 3O70A 2FYUD 1DD4A 2RKLA 5C39A 1X4JA 3H6PA 3L75D 5C11A 3FXEA 1NOHA 2KSEA 3GHGB 1J1DB 5TDWA 1PIXA 2YSJA 1OW8A 1FOSE 1KMIZ 3W67A 3WU2E 3V2QA 2V7QH 3CX5D 4Y28J 4IFDK 1H89A 1QGKB 4NN2A 1XTGB 1SQPE 2QRXA 1SFCB 3MHHA 3M91A 3SWYA 2MJZA 3HRNA 2IZ1A 2YSMA 3L73D 5CHXA 4DZOA 2NPSD 4JYBA 4R2YA 5KLVE 2I8DA 3JC22 1X0TA 1YHQP 4U3FG 2FKWB 5B76A 4RKUJ 2E43A 3BCCE 4H13B 1KQSO 1QL2A 1SQQE 1FZAA 2R44A 3SOWA 3EFFK 4GB0A 3LQJA 1LWUB 1XTCC 2KOGA 2VPBA 3C9IA 2C2LA 4JQ0D 3L74G 2Y9YA 3C8VA 1GZLA 5KH9A 5LKUA 3H1HG 2KZIA 3B5NB 1OW6A 1S2EA 2HR3A 3EFGA 1WE9A 4C7NA 1SQXJ 1KB9D 3U59A 2C2VS 3CCUP 4K3AA 2FFWA 3H1JJ 2F42A 2OTJP 3L1XA 4UI9B 1NU1E 3P8CE 4YBTA 1P84D 5M1BA 4D6TE 4AP4A 1CZQA 3TGUJ 1CI6B 5B8DA 3RBZA 2KSJA 4WZ2A 3D6YA 2MT5A 3MD0A 1ZR2A 5APWA 3NFQA 3Q1DA 2OTKE 5CBNA 2W8ZA 2FXOA 5DJUB 4N6JA 2HODB 2JWAA 1R5SA 5LKZA 2WT7B 2ZFCA 2F6NA 4ZDTA 1L4AD 3JCUE 4JBZA 1SQPG 3HE4B 1SQVE 2R32A 3H32A 3M63A 3R2PA 3RK2B 1Q2NA 5KLVG 4OWFA 4PV1C 1T3UA 4PD4D 1VF5B 5E79H 2K16A 4K35A 1M90Q 5B66E 2UZGA 2K9JB 4AQRD 3BCCG 1LT1A 5TBNA 2YO3A 3FWLA 3CC4P 1SQQG 4WY4A 1S1CX 2I1KA 3L70J 2OYIA 5APVA 2R3CA 2KYUA 1RQUA 3E1IA 2FSAA 2YKOA 3M9BA 1IYMA 2MNZA 2CT2A 2A06E 2KFTA 2L0BA 2QJPB 2QJYB 2OYHC 4PJ0H 2P2UA 1M1KQ 4GNDA 4IOIH 5AW9B 4YAXA 4R4LA 3LIDA 3CLQA 1K04A 2E75C 1OX3A 5GTIH 3T7LA 3VP9A 4IC2A 1RE3C 1M7LA 2PFXA 2KKXA 2ZT9C 1NU1G 3SOUA 1IFIA 2FYZA 4D6TG 1EDIA 3ITKA 3I5CA 2MD7B 5KLIB 3FM8C 1MZ9A 1HJ0A 4OGEA 1GK6A 3CXHH 3IN6A 2H7HA 2W6AA 3JSVC 1S4XA 1BGYD 1IC2A 4LGDE 3O37A 2M3EA 3VTPC 2DSMA 1R5LA 2VRSA 4GNFA 1GMJA 2DJAA 2JR8A 1L0ND 5KH3A 4OH8B 3AE5C 2FFDB 3H1ID 2E5YA 1X4UA 1HYJA 3GG2A 3VMXA 3HTKA 3S1KA 3ZNIA 2YW8A 3G6EP 1SQVG 3O36A 3RL0C 3N9PA 1PP9J 3RPGC 2LXPC 1ZV8A 2AEJA 1N7LA 4NPDA 1X8YA 4UB6E 3ZPV1 3L72E 5APUA 1JY3N 1L0NK 3F89A 3HD7D 2FUUA 4RJTA 4LC1A 1IK9A 1VQLP 1HVVA 2GA1A 2V4HA 1BSNA 1VQ7P 3RL0g 1QVGO 4C7NB 3FXDA 1AVOA 3AEFC 2H0DA 2BCCE 1AQ5A 2XV5A 2A06G 1NTMD 5AVUB 1WESA 2C9NY 2AXTH 2IFNA 4WA6A 5APQA 3EQ2A 2IBZI 1YQ3C 1FE6A 4OGCA 1WENA 3QWOC 1QX8A 5GTHH 3TK1A 2FYUJ 1WEQA 1SFCD 2IDAA 5H2FE 3CMEP 2Y9ZA 4Z0OA 1KORA 2G45A 4GODA 2ZYGA 3PLNA 2A45H 2E76D 3LW5H 5AVXB 5KH7A 2Y43A 1VQPP 1N73C 4CA1A 1VQ4P 2IQJA 4OGQB 1FZEA 2YMYA 2H88C 1K9MQ 1ZP0C 3L73J 1NHLA 2M5AA 5H9MA 1NTKD 1SQXK 3HUSC 3L1ZB 2PRRA 1FZBA 1OW7A 1EC5A 1VDFA 3B5ND 3H1KE 3QZVA 3CWBE 2L5GB 1RH5B 3O6QA 5AITA 3MTUE 4WY4B 1YI2P 3SWKA 1H8AA 2AEMA 2YQMA 1CHCA 1X22A 2B9BA 4N3YB 3E1RA 3L72G 3Q1MA 2VPDA 4X3GA 1NKZB 1FZCC 2AN6A 3MHSA 3N9QA 2KE1A 2VPGA 5AW0B 2MKEA 1M1JA 1FDMA 2QM7A 3PRJA 2WTYA 2R5BA 1PGPA 1GL2C 2WVRA 2E6RA 1VQOP 2BCCG 1E4UA 4A0CD 1U6GB 2MA5A 4ASVA 5APSA 3KPEA 1PGJA 1OFCX 1M57D 1EZVE 4F1PA 2K4DA 4R8PK 1FDIA 4O64A 2FYNC 5DINA 1Y8AA 2P1JA 2ECGA 3L71E 2K88A 2KIZA 1ZW0A 3CCMP 1YJWP 3V2RA 3RK3C 1DCQA 4LADB 1FZGA 2W90A 2XU6A 4YATA 2E75B 3WMM0 2RH0A 3HTKB 2QE7H 1CI6A 2ITAA 2ZT9B 2PNXA 4N3WA 2M85A 1FU1A 1NGMB 1GW4A 3AE9C 2PP6A 4W80A 1VQKP 3H1KG 4YBMA 1S72P 2ZETC 1L0LE 2HODA 3CWBG 4A4BA 2O3JA 3FWNA 1H0TA 3KZIH 3VYIA 3KV6A 2QG4A 5E79E 4BRYB 3AE2C 2LRIC 3B4SA 2IZ0A 2IBZD 2QM8A 2N9YB 1KV4A 4GNGA 3HE4A 2J59M 3OW2O 1WEWA 1TU3F 1SQBD 1IFDA 3CX5H 2OWAA 2IYOA 1JUNA 3RL0B 3LIEA 3PH0A 1LNQA 1E79H 1VQ9P 2YHOA 2KI7B 1WRGA 1BCCD 3IFMA 1VQ5P 5KTBA 3BATA 4B86C 1E5WA 3A0BH 2W6BA 2O1JA 4PJ0E 5FEYA 3V5BA 2WPRA 2JRJA 4IC3A 4GNEA 1S5LX 3BRVB 2CSYA 3A3YB 2BEZF 3M99A 5GTIE 3O35A 2PAJA 4ZQLA 3S4RA 1EZVG 5I3LA 3FANA 2QJKC 1X9VA 1RF0C 5H1TA 2GUVA 3MIWA 3LDYA 1BGYJ 5G04B 3CXHE 5APTA 3L71G 2JWDA 1JCDA 1USDA 5KJ7C 4YPCA 1LT9A 2F6JA 2IX7C 2XOCA 1MFZA 1UIIA 3QH9A 3ZVZB 1L0NJ 1MBMA 2M5AB 1VFYA 1KD1Q 3H1IJ 1BDDA 4XFJA 2LXHC 4N78D 1LTBC 2RR4A 4TKPB 1KB9H 1VPCA 2HFED 2KKYA 1A02F 3O6QB 2E74D 4WZ3B 1FJPA 5APXA 1SQXE 3FL2A 1URQA 1IFNA 1KILA 2M6MA 1P84H 3MUDC 2YIUB 3H1JE 1N7SA 2P10A 2FYUK 2C0WA 1L0LG 2XOYA 1NTZD 2K3RA 3TGUE 4R4MA 1JTHB 1HJBA 1BE3D 3G9RA 3U5NA 4WWIA 4P5OB 2FFDA 2JMJA 1AJYA 1MV8A 4W7YA 1M1JB 3NG2A 5BU8B 5K3QA 3C6WA 1SVFA 4FK5A 2IFMA 4HKZH 2E74C 3Q3DA 1NTMJ 1YQ4C 1DEBA 1NTZK 3O8ZA 2KU3A 4YBSA 4I1LA 3MUDA 4XA4A 5AW4B 1YTZI 2AXTE 2Q7CA 4OGQD 3N7NA 1N2DC 2YHNA 1G2CA 3H1LD 1JY3O 3N9OA 5GTHE 2NPSC 2VNFA 4PD4H 1HGZA 1VQ8P 2W83C 1M56D 5SVIB 3PJSK 1MKMA 3VMYA 5CCGD 4L58A 2YYRA 1WEMA 3WUTA 2JM3A 3L70E 1KYOI 2CRRA 2ECWA 3AEBC 3LVQE 3CCJP 1ZLLA 1RY3A 1HBWA 4ZMDA 4YABA 1WMKA 1JY2P 2WPVB 1WILA 4N4FA 4S3OB 4YXWH 4LJNA 1ZXGA 1YYCA 2Q3EA 2BAYA 1G1IA 3VMAA 1NTKJ 2BEQD 2ECNA 3KQIA 2EGMA 4XE5B 1Q7YQ 4H0LD 2YREA 5EFWB 2KYVA 1H0TB 2KGIA 1SQXG 2OGUA 2KS1A 4GIFA 2KIKA 2QIZA 2G43A 2D2CB 1FAVA 1K2FA 3H1JG 5B79A 2XP0A 1T6AA 5DKAA 4L7XA 3TGUG 2L91A 2KWNA 1MUUA 5L8RJ 5CCHD 2H43A 1Z60A 4LLBA 3GLMA 1PPJE 2CKLB 2N1TD 1RE4C 2HPCA 1ZRTE 2FBWC 1NYHA 4H9DA 4CPGA 3NXSA 3TNUB 2G6QA 4RO0A 3CI9A 3CCQP 4TLFA 2JDIH 1L4AC 4M3LA 4QMAA 2XZRA 5K5GB 1Z56A 3FEHA 2VJEA 1KILE 3AECC 2Y1MA 1PP9E 1BDCA 2P58A 1GTWA 4L75A 1WFKA 1G25A 2PUYA 4I7ZC 5CCHC 5LKTA 3H25A 2Q3IA 1LT9B 2JP3A 2WWWA 4Y99B 3L11A 1OVVA 3ZYQA 2WSEJ 4IL6X 3CC7P 4ZKPA 4H44D 3L70G 3C1LA 2A45G 2JKVA 3RBXA 3T9KA 2OARA 3V4WA 4JF7A 1K8AQ 4YADA 3M9HA 1LGHB 4BHWA 3B71A 4C9ZA 1URQB 1T2KD 1KILB 3TF5A 1RF1C 3N4XA 2J5UA 1YJNP 3DWDA 1N7SB 2OYHA 3EB5A 1LTTC 1W5CE 5LCWB 1LJ2A 5KKZB 2JJLA 2FYUE 1L0LD 2Z5IA 4EI2A 1ZR4A 1RE3A 3KZIE 4H44C 2KWJA 3ZPVE 2LDRA 2P57A 2ZXEB 1JMMA 5G0FA 2CRWA 1SQBJ 3LVRE 4U3FD 4GKGA 3CX5E 1EXIA 1T2KC 4JYCA 1PPJG 1BCCJ 2JO1A 3JUEA 3K5BA 1KYOD 1G2CB 2D8SA 4BRYA 1JEKA 4V3LC 4WBAA 4HH2A 1EQ7A 3VP8A 3Q5RA 4GOEA 1ZOYC 2HLOA 3A0BE 2O01J 3L74D 2LXBA 3L73E 3R4YA 5AVTB 3A0HH 3H1HD 1U7MA 1GU4A 1Q90D 3BRTB 1USEA 3G71P 1DVPA 3KDEC 4NPEA 1PP9G 2EXUA 1Q81Q 4KHXA 5AW7B 2Z4EA 1S9KE 1XWHA 4KJMA 5DJTB 2KWKA 3AE1C 2O01N 3MDBC 3HD7C 3L75J 5AW5B 5SVYA 2HG5D 2EODA 3II6A 1BORA 4MVTA 4HJGH 4WZ0A 3NTNA 2N9BA 2NPSB 1NTMK 1IFPA 3GHGC 2I1JA 1J1DC 5TJHA 1SS1A 3PHLA 2KS1B 4EOTA 3O47A 5FB1A 4H13D 1CSBA 1KB9E 1FJKA 1T3JA 2C9LY 3M0DC 3DDTA 1P84E 3AEAC 1NTZJ 3W68A 2RMZA 3OJAB 3CCEP 1BE3J 3GMAA 1SQPD 1NVOA 1SFCC 2FYUG 3PP5A 2EGPA 1N87A 2YQLA 2WSEH 5KLVD 5AVSB 2HPCB 2LAUA 1Q82Q 2E76C 1YBKA 5G05B 2WSSH 3BCCD 5B5EH 3AE3C 1N73A 5CBOA 2LV9A 1JM7A 1GD2E 1SQQD 1H88A 2Z5HA 2YXRB 1IJDB 3UIAA 1JTHA 2SPZA 3AE7C 1OVUA 1LWUC 4FO9A 1NTKK 3OA7A 3I56P 4RESB 2VJEB 3H1LJ 5AW3B 3WUUA 2LGGA 2WSFJ 5AVWB 3D6ZA 3SWFA 1YJ9P 1VL2A 3L73G 3HUSA 5KLVK 2K1JA 4PV1B 4W7ZA 2JUNA 1OMIA 3E7KA 3B5NC 4BWNA 4PD4E 4IFFA 2WPQA 1Q86Q 3M62A 2E6SA 3AE8C 1MM2A 1IO4A 1K73Q 1SQQK 4IL6H 2WZ7A 2P67A 2G3AA 2D2CD 1FZFA 1Z2QA 1NU1D 3P8CD 2FXPA 3L70D 3F5HA 3GF3A 5BU5A 4D6TD 1L4AB 1FZCA 3CCSP 2OYOA 1UIXA 2KUBA 2NAAA 3O33A 3V4QA 2CK3H 1VD4A 3ZVYA 5AVRB 1HWTC 3RK2D 5SVIA 2OYHB 2L75A 2FUIA 1YTZT 2Y1NA 1VF5D 1JCCA 3RTRB 3H7HA 1GL2A 2O01H 1DH3A 5TRBA 2L43A 2ECTA 5B77A 1NU1K 2YKPA 5AW8B 1NO4A 1JNMA 3PLWA 2B87A 1SQVD 1EDKA 5AVYB 2K1AA 1BGYE 3I55P 1WT6A 1RF1B 3P32A 1HH0A 2MD8C 3KQGA 2KWOA 2M1RA 1KC8Q 2XNDH 1N8RQ 1L0NE 5TABA 3P8MC 2MKVA 3H1IE 4W4UA 1HUCA 3VOPA 1FS0E 1KFNA 1PFIA 1S5LE 1SQVK 3ZDMA 3CD6P 2E61A 3IHPA 1MFTA 1M8OB 5APYA 2LGKA 3RPGB 2CKLA 1URQD 2CSZA 1V87A 2A06D 2QA4P 3HCTA 1J1EC 1PP9D 2QJPC 1EDJA 4LLHA 3M0AA 1QLED 3U5PA 3L36A 3TNUA 3GV4A 2XNXA 5CMZA 1SQBK 1JY2N 4A4CA 3WUVA 4L76A 3V43A 2D8UA 4UP0A 1IFJA 3Q5PA 1LTGC 3HCUA 2Y0EA 5KLIC 1OXZA 2JMIA 5AVVB 1NTME 4LK9A 2MNYA 4WVZA 1PL5A 4I7CA 5AW6B 1FOSF 4WB4A 2LN0A 4BBQA 2OTLP 1OZHA 1OIPA 1W2EA 4B86A 2WSFH 1G1JA 3M06A 1AQTA 2YXQB 2R3SA 1MM3A 4AUWA 2W6JH 3KV5A 4Z0RA 2XOZA 1JOCA 1EZVI 2XB1A 1RMDA 1KZUB 2P7JA 2IPPA 2KNCA 1IK7A 4U3FJ 3DPLR 4V3KC 1RF0A 1WEOA 2G8YA 1GU5A 1N73B 1BGYG 2H8PD 1JM7B 1LP1A 1KQFB 1JM0A 2LQ6A 4GT1A 5FERA 3MHVA 1AA0A 5KJ7A 5KAFH 3BVHA 3KHUA 3L72D 4QF2A 3M7KA 1NWQA 5KAIH 2ZJSE 2VJFA 1L0NG 2OXQC 3L74J 1J2JB 3HUSB 3H1IG 1NTKE 1JB0J 3H1HJ 1EXJA 4Q6FA 3A0HE 1YITP 2WITA 1QL1A 5LKXA 1K05A 2BCCD 2E76B 4CCGX 1WEPA 4UB8H 2LKMA 2L5UA 2CPSA 1FZCB 4XI1A 4DJGA 3USSA 1S9KD 1WIMA 1VQ6P 2VP7A 3BASA 3I2DA 1Z6UA 2DX8A 3MGNA 3RK3E 1DX7A 1EDLA 2WQYC 2WPSA 1GL2B 4U7JA 4L74A 1HYIA 4BXLA 4AVXA 2WSCJ 4WY4D 3ABVC 4ASWA 1Y47A 1NTMG 1FP0A 3L37A 3PHDA 4I7DA 2XKMA 2JMDA 1KQLA 4OGQC 3SHBA 2RN0A 1A02J 2B87B 3P7KA 1SQPJ 3PTZA 4HYTB 5C13A 1X4IA 2FYNB 2NPSA 3CC2P 1FC2C 2QICA 5KLVJ 5CCGC 3RK3B 4PTBA 4PV1D 1QEXA 3H1KD 3OAKA 3DQVR 1AFOA 3CWBD 5AVZB 3CXHI 3BCCJ 2ECVA 2K37A 1AVYA 2ZVNB 4EDFA 5EYAF 2M8RA 3U1CA 1SQQJ 4WY4C 5B5EE 2OYIC 3M9QA 4QQ4A 1NAYA 1KTMA 5CJ0A 5AVQB 2B89A 4EYYQ 1NTKG 1GDTA 3FJUB 3LJUX 4H0LC 3AE4C 2CPBA 4TT3H 3FGAD 4GDOA 1S5LH 4AYCA 3A5TA 5CCGA 1ZBDB 1GW3A 2FD4A 1LTAC 2KGGA 2E75D 3PUQA 2IBZE 1LTJC 5D1KB 2E42A 4IL6E 2ZYDA 2YVRA 3EWKA 1NU1J 2ZT9D 2E5TA 3LW5J 4D6TJ 3L35A 2YT5A 1SQBE 1EZVD 3PURA 2K9YA 3EB6A 1ZN5A 5TISH 1KYOH 2N1TC 1FDOA 3N9MA 1BCCE 3L71D 1OVRA 1WEUA 1RE4A 1J1EB 1VYXA 3FX0A 5AIUA 3C5KA 4QF3A 4ZKUA 2KP8A 1L4AA 4MSXA 1LTJA 2KNCB 2QJKB 3HTKC 3N9NA 4HB1A 2YU4A 3CL3D 5AW1B 1SQVJ 3D70A 4DOJA 3SOXA 3RL0D 2YUCA 1LP1B 3S9OA 5CCHA 1U57A 1JO5A 3SFDC 1SP4A 5TDRA 1QVFO 3B8EB 3G4SP 4LKAA 2N1TA 1T1HA 2A45I 1LDJB 2VJFB 3L75E 3Q5SA 2B88A 2M13A 2CSVA 1D7MA 1X79B 4N78E 2MIQA 1HGVA 3SSUA 3CCLP 2WSCH 3WU2H 3O34A 5AW2B 3ZTGA 2RSDA 5H1UA 3U5MA 1S3JA 2OQQA 3SUBA 2GM4A 3U1AA 1RF1A 2POHA 3SFEC 4JPZB 4DT0A 1PV3A 2M3HA 1CW5A 1VQMP 1GK4A 4MN4C 2EA6A 1L0LK 1NTZE 1KFMA 1OWAA 1NJIQ 1HTLC 2WMMA 1BE3E 4O9BA 2IDBA 2CONA 2IBZG 1PZQA 2KXPB 2ZVOB 1LTSC 2K17A 1PGQA 3LRQA 1SQBG 3HE5A 2E74B 2JEEA 4C7RA 4FJCA 3CCRP 4A49A 2KLUA 3CXHD 4A7PA 2O1KA 3KNVA 4NPFX 1BCCG 3A2AA 1T8ZA 4KT0J 2J58A 2W27A 3VK6A 1PGOA 2Y0CA 3H1LE 3O7AA 2QVAA 2NZ2A 2MA6A 4YTPC 1JY2O 2YMKA 1FBMA 3NMDA 1BSHA 5J3XA 2KR4A 4DCKA 1W2BO 3GL6A 5D1MB 2BASA 2YKQA 1SQXD 2LXCB 3T97A 3IF4A 4UP5A 3H1JD 3AEDC 2YIUC 4ZNCA 3GW6A 1Y9BA 3L72J 3HD7A 5B75A 2HYED 3TGUD 5KAFE 4I7BA 3L75G 2HYNA 2ZAEB 1F62A 2Q1KA 3CPWO 3H32B 1DD3A 1R8EA 5KAIE 5D1LB 4YXDC 2XDJA 1M1JC 1N86A 4I6MC 3KDPB 3GF7A 2H89C 3GHGA 2ECIA 3N9LA 1LDKC 4AYCB 2AEFA 4H13C 4B7YC 1GL2D 2BCCJ 3RGUA 3V2PA 3AEGC 3M0DA 1SQPK 2M0BA 3VMZA 3JCUH 2KLVA 3U5OA 2KB7P 1NTZG 4UB8E 2OYIB 3Q2YA 3VN0A 1BE3G
chains in the Genus database with same CATH topology
1X4UA 1HYJA 5B78A 1SFCA 1SLQA 1WILA 4N4FA 4S3OB 3VMXA 4LJNA 3HTKA 3V43A 1YYCA 1FBVA 4UP0A 3ZNIA 2BAYA 1G1IA 1IFJA 2YW8A 3O36A 3RL0C 1LTGC 3HCUA 2LGVA 3N9PA 2ECNA 3KQIA 4XE5B 1OXZA 2JMIA 3RPGC 5AVVB 4LK9A 2YREA 2KGIA 2KYVA 2LXPC 2MNYA 1ZV8A 3RK3D 4I7CA 1N7LA 5AW6B 4WB4A 1FOSF 2LN0A 2YURA 1WGMA 4GIFA 4BBQA 1X8YA 2QIZA 2G43A 3ZPV1 1W2EA 1FAVA 4B86A 1K2FA 2WSFH 1G1JA 5B79A 5APUA 1JY3N 3M06A 1L0NK 3HD7D 1JY3P 3TSIA 1LTJB 1MM3A 2FUUA 5DKAA 1LWUA 4AUWA 4LC1A 1IK9A 4L7XA 1HVVA 3KV5A 1JOCA 2KWNA 1MUUA 2XB1A 2HDPA 1RMDA 1KZUB 5CCHD 4S3OC 2H43A 2P7JA 1Z60A 2IPPA 3DPLR 4V3KC 4C7NB 4LLBA 1RF0A 1WEOA 2C0XA 3B5NA 2ECJA 3G3ZA 2H0DA 2CKLB 4YC9A 1AQ5A 2N1TD 1GU5A 2XV5A 1N73B 2H8PD 2N1TB 1JM7B 1RE4C 4I2LC 5AVUB 2HPCA 1WESA 2C9NY 2LQ6A 4GT1A 2IFNA 5FERA 5KJ7A 3NXSA 3TNUB 2G6QA 3BVHA 4WA6A 5APQA 3EQ2A 4QF2A 3CI9A 3KYQA 1NWQA 1WENA 3TK1A 2VJFA 4C46A 1L4AC 2OXQC 1WEQA 1J2JB 4M3LA 1SFCD 3HUSB 2IDAA 2XZRA 4F52B 1Z56A 2VJEA 2Y1MA 4AUQB 4Q6FA 5H1VA 3RK2C 1GTWA 2G45A 2YO2A 1WFKA 2PUYA 1G25A 3IR9A 5CCHC 2WITA 1QL1A 4PPEA 1NKNA 2A45H 3LW5H 5AVXB 5LKXA 5LKTA 2Q3IA 2R5DA 3ASLA 2Y43A 4CCGX 5KH7A 1LT9B 2WWWA 1WEPA 4Y99B 3L11A 4CA1A 3TYYA 1N73C 3ZYQA 2XEUA 2L80A 2Q5UA 1WEEA 4R7EA 4ZKPA 2LKMA 2L5UA 5CJ4A 2A45G 2CPSA 1FZCB 4XI1A 2GUSA 1S9KD 1WIMA 1FZEA 2OARA 3V4WA 4JF7A 2YMYA 2VP7A 2FXMA 2WT7A 3HE5B 3BASA 4YADA 5BVZA 1IFMA 3M9HA 1NHLA 2YNYA 1LGHB 3I2DA 3HUSC 1SQXK 1Z6UA 2DX8A 2QJ0A 3L1ZB 1URQB 3L4FA 5H9MA 1KILD 3MGNA 1FZBA 1T2KD 3T6RA 4C9ZA 1KILB 1DX7A 1VDFA 3B5ND 1RF1C 2WPSA 3QZVA 3N4XA 1GL2B 4EIJA 2H0DB 1N7SD 2L5GB 1HYIA 1N7SB 4AVXA 2OYHA 5AITA 4WY4D 3EB5A 3MTUE 1NH4A 4WY4B 1FP0A 2LGLA 1LTTC 3HCSA 5KJ7D 5LCWB 3L37A 3PHDA 1H8AA 1LT9C 2YQMA 4Y99C 1CHCA 2JJLA 2XKMA 4I7DA 2MUMA 2JMDA 1KQLA 4N3YB 3SHBA 2Z5IA 1ZR4A 2VPDA 1RE3A 1A02J 4X3GA 3P7KA 5C13A 4HYTB 4IFMA 1NKZB 1FZCC 2KWJA 2RI7A 3ZPVE 2LDRA 2ZXEB 3V2NA 2Q9IA 1X4IA 1JMMA 5G0FA 2AN6A 2NPSA 3MHSA 3N9QA 5FB0A 3A7OA 2KE1A 5AW0B 2VPGA 2QICA 1M1JA 2I50A 5JG6A 1FDMA 2QM7A 4GKGA 1URQC 5CCGC 3RK3B 4PTBA 4FIPA 1KILC 1T2KC 2WTYA 2R5BA 3OAKA 4JYCA 1AFOA 3DQVR 1NAFA 5AVZB 1GL2C 2E6RA 2VPEA 2M3BA 1E4UA 2ECVA 1N7SC 1LTIC 4A0CD 1U6GB 1WEVA 2MA5A 3LQHA 5EYAF 2M8RA 3HD7B 1G2CB 5APSA 3U1CA 4WY4C 2D8SA 3LQIA 4ZUXU 4V3LC 4WBAA 4HH2A 1EQ7A 3KPEA 3VP8A 2OYIC 2KREA 2FFDC 3M9QA 3O70A 2HLOA 5AVTB 1X4JA 5CJ0A 3H6PA 1GU4A 5C11A 5AVQB 2K4DA 1NOHA 3GHGB 3BRTB 4R8PK 1J1DB 5TDWA 1DVPA 1GDTA 2YSJA 1FOSE 4O64A 5DINA 2P1JA 2ECGA 3V2QA 2KIZA 2CPBA 3V2RA 3RK3C 4IFDK 1H89A 4KHXA 5AW7B 4AYCA 3A5TA 2Z4EA 5CCGA 1FZGA 1S9KE 1ZBDB 1GW3A 4LADB 1XWHA 1LTAC 2KGGA 4NN2A 2KWKA 1XTGB 3PUQA 2XU6A 4YATA 1LTJC 5D1KB 2E42A 3HD7C 1SFCB 3MHHA 3WMM0 3M91A 3SWYA 3HTKB 1CI6A 5AW5B 2MJZA 3HRNA 2HG5D 2YT5A 3L35A 2EODA 2YSMA 3II6A 1BORA 2PNXA 4MVTA 5CHXA 4DZOA 4N3WA 2NPSD 3PURA 4JYBA 3NTNA 2M85A 4R2YA 4WZ0A 3EB6A 1FU1A 2N9BA 2NPSB 1NTMK 1GW4A 3GHGC 2I1JA 1ZN5A 2FKWB 2PP6A 1J1DC 5B76A 4EOTA 2N1TC 2E43A 5FB1A 4W80A 3N9MA 1CSBA 1WEUA 1RE4A 1J1EB 4YBMA 1QL2A 1FJKA 1VYXA 2HODA 2ZETC 1FZAA 1T3JA 2C9LY 4A4BA 3M0DC 3SOWA 5AIUA 4GB0A 3LQJA 1LWUB 3VYIA 3C5KA 3KV6A 4QF3A 1XTCC 2KOGA 4ZKUA 2VPBA 2LRIC 3OJAB 3C9IA 2KP8A 2QM8A 2C2LA 1L4AA 4GNGA 3HE4A 2J59M 4MSXA 1SFCC 1WEWA 1LTJA 3PP5A 3HTKC 3N9NA 1GZLA 2YU4A 5KH9A 3CL3D 5AW1B 2EGPA 5LKUA 1IFDA 3B5NB 4DOJA 3SOXA 3EFGA 3RL0D 1N87A 2YUCA 2YQLA 2WSEH 1JUNA 3RL0B 5AVSB 1WE9A 3LIEA 2HPCB 5CCHA 2YHOA 1JO5A 4C7NA 1SP4A 1WRGA 5TDRA 3B8EB 5G05B 3IFMA 3U59A 4LKAA 2C2VS 1N73A 2LV9A 2N1TA 5KTBA 3BATA 1GD2E 1T1HA 1E5WA 4B86C 1JM7A 1H88A 2A45I 2W6BA 2Z5HA 2F42A 2O1JA 1LDJB 2VJFB 5FEYA 3L1XA 3V5BA 3P8CE 4UI9B 1IJDB 2WPRA 3UIAA 1JTHA 2JRJA 4GNEA 4IC3A 4YBTA 1LWUC 4FO9A 1NTKK 3OA7A 3BRVB 4RESB 4AP4A 1CZQA 2CSYA 2VJEB 1CI6B 3A3YB 5AW3B 1X79B 3M99A 5B8DA 4N78E 2MIQA 1HGVA 2LGGA 2KSJA 3O35A 5AVWB 2WSCH 4WZ2A 2PAJA 3O34A 3SWFA 4ZQLA 5AW2B 3ZTGA 3HUSA 5I3LA 2MT5A 5KLVK 1X9VA 3MD0A 2RSDA 2K1JA 1ZR2A 4W7ZA 1RF0C 5H1TA 3U5MA 5H1UA 2GUVA 3B5NC 3NFQA 5APWA 3MIWA 2GM4A 3U1AA 1RF1A 2POHA 5G04B 4IFFA 2WPQA 2M3HA 1CW5A 5APTA 3M62A 2E6SA 1GK4A 1MM2A 4N6JA 1JCDA 1L0LK 2HODB 1IO4A 1SQQK 2EA6A 2WZ7A 5KJ7C 1KFMA 1OWAA 2P67A 1LT9A 1HTLC 2F6JA 2IX7C 5LKZA 1MFZA 1FZFA 2WT7B 4O9BA 1Z2QA 2ZFCA 3P8CD 3ZVZB 2F6NA 4ZDTA 1L4AD 5BU5A 1VFYA 1L4AB 3HE4B 1FZCA 2LXHC 2R32A 3H32A 3M63A 4N78D 1LTSC 1LTBC 2K17A 3LRQA 2NAAA 3O33A 3V4QA 1VD4A 4TKPB 3ZVYA 1VPCA 2HFED 3HE5A 5AVRB 3R2PA 3RK2D 1HWTC 1A02F 4WZ3B 4BHWA 3RK2B 2OYHB 1FJPA 2L75A 2FUIA 5APXA 3FL2A 1URQA 2JEEA 1YTZT 2Y1NA 1IFNA 1KILA 1JCCA 2M6MA 3RTRB 4C7RA 1T3UA 4FJCA 4A49A 1GL2A 2K16A 2O01H 2O1KA 2UZGA 4AQRD 3KNVA 1N7SA 1DH3A 5TRBA 3A2AA 2FYUK 2L43A 1T8ZA 2C0WA 2ECTA 5TBNA 2YO3A 2J58A 2W27A 5B77A 4WY4A 2I1KA 3VK6A 1NU1K 2YKPA 5AW8B 2OYIA 1JTHB 2R3CA 5APVA 1HJBA 2KYUA 1NO4A 1JNMA 3U5NA 3O7AA 4P5OB 2FFDA 2MA6A 2JMJA 1MV8A 1JY2O 4W7YA 1FBMA 3NMDA 1M1JB 5J3XA 3E1IA 2KR4A 5BU8B 3NG2A 3C6WA 2FSAA 1SVFA 2YKOA 5AVYB 3GL6A 5D1MB 3M9BA 1IYMA 2MNZA 4FK5A 2CT2A 2KFTA 2L0BA 2BASA 1WT6A 1RF1B 2YKQA 2OYHC 2IFMA 2P2UA 4GNDA 3P32A 3T97A 1HH0A 2MD8C 3KQGA 5AW9B 4YAXA 2KWOA 1DEBA 4UP5A 2M1RA 3LIDA 1NTZK 3CLQA 3O8ZA 2KU3A 4YBSA 4I1LA 3MUDA 4XA4A 5AW4B 1YTZI 5TABA 2Q7CA 3P8MC 3T7LA 3N7NA 3VP9A 4IC2A 1N2DC 3HD7A 2YHNA 1G2CA 1RE3C 2HYED 1M7LA 4I7BA 4W4UA 1HUCA 3VOPA 5B75A 2HYNA 1JY3O 3SOUA 1KFNA 1IFIA 3N9OA 1PFIA 2FYZA 1F62A 1SQVK 3I5CA 3IHPA 3H32B 2MD7B 2NPSC 5APYA 2VNFA 5D1LB 2LGKA 1HGZA 1MZ9A 1GK6A 2XDJA 3RPGB 1M1JC 3VMYA 1N86A 4I6MC 3KDPB 2H7HA 2W6AA 3GHGA 2ECIA 2CKLA 1URQD 2CSZA 3N9LA 5CCGD 4L58A 1LDKC 1V87A 2YYRA 1IC2A 4AYCB 4LGDE 1WEMA 3HCTA 3O37A 1J1EC 4B7YC 1GL2D 3VTPC 4LLHA 3M0AA 3V2PA 3M0DA 1SQPK 2ECWA 3VMZA 3U5PA 3L36A 3TNUA 2VRSA 1ZLLA 2KLVA 4GNFA 1RY3A 3U5OA 3GV4A 2KB7P 2XNXA 1HBWA 5CMZA 1SQBK 2OYIB 1JY2N 5KH3A 4YABA 4OH8B 3VN0A 1JY2P 2FFDB 4A4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4U A;  1HYJ A;  5B78 A;  1WIL A;  1SLQ A;  4N4F A;  4S3O B;  3VMX A;  4LJN A;  3HTK A;  3V43 A;  1YYC A;  1FBV A;  4UP0 A;  3ZNI A;  2BAY A;  2YW8 A;  3O36 A;  3HCU A;  2LGV A;  3N9P A;  2ECN A;  3KQI A;  4XE5 B;  1OXZ A;  2JMI A;  3RPG C;  5AVV B;  4LK9 A;  2YRE A;  2KGI A;  2MNY A;  2LXP C;  4I7C A;  5AW6 B;  1FOS F;  2LN0 A;  2YUR A;  1WGM A;  4BBQ A;  1X8Y A;  2QIZ A;  2G43 A;  3ZPV 1;  1FAV A;  4B86 A;  1K2F A;  5B79 A;  5APU A;  3M06 A;  2FUU A;  5DKA A;  1MM3 A;  4AUW A;  4LC1 A;  4L7X A;  3KV5 A;  1JOC A;  2KWN A;  1MUU A;  2XB1 A;  2HDP A;  1RMD A;  4S3O C;  2P7J A;  1Z60 A;  2IPP A;  3DPL R;  4V3K C;  4C7N B;  4LLB A;  1WEO A;  2ECJ A;  2H0D A;  2CKL B;  4YC9 A;  1GU5 A;  2XV5 A;  1JM7 B;  4I2L C;  5AVU B;  1WES A;  2C9N Y;  2LQ6 A;  4GT1 A;  5FER A;  3NXS A;  3TNU B;  2G6Q A;  4WA6 A;  5APQ A;  4QF2 A;  1NWQ A;  1WEN A;  3TK1 A;  2VJF A;  4C46 A;  2OXQ C;  1WEQ A;  1J2J B;  4M3L A;  2IDA A;  2XZR A;  4F52 B;  2VJE A;  2Y1M A;  4AUQ B;  4Q6F A;  5H1V A;  1GTW A;  2G45 A;  2YO2 A;  1WFK A;  2PUY A;  1G25 A;  3IR9 A;  4PPE A;  5LKX A;  5AVX B;  5LKT A;  2Q3I A;  2R5D A;  3ASL A;  2Y43 A;  4CCG X;  5KH7 A;  2WWW A;  1WEP A;  3L11 A;  4CA1 A;  3TYY A;  3ZYQ A;  2XEU A;  2L80 A;  2Q5U A;  1WEE A;  4R7E A;  2L5U A;  4XI1 A;  1S9K D;  1WIM A;  3V4W A;  2VP7 A;  2WT7 A;  3HE5 B;  4YAD A;  3M9H A;  2YNY A;  3I2D A;  5H9M A;  1Z6U A;  2DX8 A;  2QJ0 A;  3L1Z B;  4BHW A;  4C9Z A;  1T2K D;  3MGN A;  3T6R A;  2WPS A;  3QZV A;  2H0D B;  1HYI A;  4AVX A;  5AIT A;  3EB5 A;  1FP0 A;  2LGL A;  3HCS A;  5LCW B;  3L37 A;  3PHD A;  1H8A A;  2YQM A;  1CHC A;  2JJL A;  4I7D A;  2MUM A;  2JMD A;  1KQL A;  3SHB A;  2Z5I A;  2VPD A;  1A02 J;  4X3G A;  3P7K A;  5C13 A;  4HYT B;  2KWJ A;  2RI7 A;  3ZPV E;  2LDR A;  2ZXE B;  1X4I A;  5G0F A;  2AN6 A;  3MHS A;  3N9Q A;  5FB0 A;  3A7O A;  2KE1 A;  5AW0 B;  2VPG A;  2QIC A;  2I50 A;  5JG6 A;  2QM7 A;  4GKG A;  4PTB A;  4FIP A;  1T2K C;  2WTY A;  2R5B A;  3OAK A;  4JYC A;  3DQV R;  1NAF A;  5AVZ B;  2E6R A;  2VPE A;  1E4U A;  2ECV A;  4A0C D;  1U6G B;  1WEV A;  2MA5 A;  3LQH A;  5EYA F;  3LQI A;  1G2C B;  5APS A;  4ZUX U;  2D8S A;  4V3L C;  2KRE A;  3O70 A;  5AVT B;  1X4J A;  1GU4 A;  5C11 A;  5AVQ B;  2K4D A;  4R8P K;  5TDW A;  1DVP A;  2YSJ A;  1FOS E;  4O64 A;  5DIN A;  2ECG A;  2KIZ A;  1H89 A;  4KHX A;  5AW7 B;  4AYC A;  3A5T A;  4LAD B;  1S9K E;  1ZBD B;  1XWH A;  2KGG A;  4NN2 A;  2KWK A;  3PUQ A;  2XU6 A;  4YAT A;  5D1K B;  2E42 A;  3MHH A;  3M91 A;  1CI6 A;  5AW5 B;  2YT5 A;  3L35 A;  2EOD A;  2YSM A;  1BOR A;  2PNX A;  4MVT A;  4N3W A;  4DZO A;  3PUR A;  4JYB A;  3NTN A;  2M85 A;  4R2Y A;  4WZ0 A;  3EB6 A;  2N9B A;  5B76 A;  4EOT A;  2E43 A;  5FB1 A;  3N9M A;  1CSB A;  1WEU A;  4YBM A;  1VYX A;  2ZET C;  2C9L Y;  4A4B A;  3SOW A;  5AIU A;  4GB0 A;  3LQJ A;  3VYI A;  3C5K A;  3KV6 A;  4QF3 A;  2VPB A;  2LRI C;  2KP8 A;  2QM8 A;  2C2L A;  4GNG A;  3HE4 A;  4MSX A;  1WEW A;  3HTK C;  3N9N A;  1GZL A;  2YU4 A;  5KH9 A;  5AW1 B;  2EGP A;  5LKU A;  3SOX A;  1N87 A;  2YUC A;  2YQL A;  1JUN A;  5AVS B;  1WE9 A;  3LIE A;  2YHO A;  4C7N A;  1SP4 A;  5TDR A;  3B8E B;  5G05 B;  4LKA A;  2C2V S;  2LV9 A;  1JM7 A;  1GD2 E;  1T1H A;  4B86 C;  1H88 A;  2Z5H A;  2F42 A;  1LDJ B;  2VJF B;  5FEY A;  3L1X A;  3V5B A;  4UI9 B;  2WPR A;  2JRJ A;  3UIA A;  4IC3 A;  4GNE A;  4YBT A;  4FO9 A;  4RES B;  4AP4 A;  1CZQ A;  2CSY A;  2VJE B;  1CI6 B;  3A3Y B;  5AW3 B;  3M99 A;  5B8D A;  2MIQ A;  2LGG A;  3O35 A;  5AVW B;  4WZ2 A;  3O34 A;  4ZQL A;  3SWF A;  5AW2 B;  3ZTG A;  5I3L A;  2MT5 A;  3MD0 A;  2RSD A;  2K1J A;  5H1U A;  5H1T A;  3U5M A;  5APW A;  3NFQ A;  5G04 B;  2WPQ A;  2M3H A;  5APT A;  3M62 A;  2E6S A;  1GK4 A;  1MM2 A;  1IO4 A;  2EA6 A;  1OWA A;  2P67 A;  2F6J A;  5LKZ A;  1MFZ A;  2WT7 B;  1Z2Q A;  2ZFC A;  3ZVZ B;  2F6N A;  4ZDT A;  1VFY A;  3HE4 B;  2LXH C;  2R32 A;  3M63 A;  2K17 A;  3LRQ A;  2NAA A;  3O33 A;  3V4Q A;  1VD4 A;  4TKP B;  3ZVY A;  3HE5 A;  5AVR B;  1HWT C;  1A02 F;  4WZ3 B;  2L75 A;  2FUI A;  5APX A;  3FL2 A;  2Y1N A;  2M6M A;  3RTR B;  4FJC A;  4A49 A;  2K16 A;  2UZG A;  4AQR D;  3KNV A;  1DH3 A;  5TRB A;  3A2A A;  2L43 A;  2ECT A;  5TBN A;  2YO3 A;  2W27 A;  5B77 A;  3VK6 A;  5AW8 B;  5APV A;  2R3C A;  1HJB A;  2KYU A;  3U5N A;  1JNM A;  3O7A A;  4P5O B;  2MA6 A;  2JMJ A;  1MV8 A;  3NMD A;  5J3X A;  2KR4 A;  3NG2 A;  3C6W A;  2FSA A;  5AVY B;  3GL6 A;  5D1M B;  3M9B A;  1IYM A;  2MNZ A;  4FK5 A;  2CT2 A;  2KFT A;  2L0B A;  2BAS A;  2P2U A;  4GND A;  3P32 A;  3T97 A;  2MD8 C;  3KQG A;  5AW9 B;  4YAX A;  2KWO A;  4UP5 A;  2M1R A;  3LID A;  3O8Z A;  2KU3 A;  4YBS A;  5AW4 B;  5TAB A;  2Q7C A;  3P8M C;  3T7L A;  4IC2 A;  2YHN A;  5B75 A;  2HYE D;  4W4U A;  4I7B A;  1HUC A;  3SOU A;  3N9O A;  1F62 A;  3I5C A;  3IHP A;  2MD7 B;  5APY A;  2VNF A;  5D1L B;  2LGK A;  1GK6 A;  3RPG B;  3VMY A;  4I6M C;  3KDP B;  2H7H A;  2W6A A;  2ECI A;  2CKL A;  2CSZ A;  3N9L A;  4L58 A;  1LDK C;  1V87 A;  2YYR A;  4AYC B;  1WEM A;  3HCT A;  3O37 A;  4B7Y C;  3VTP C;  3M0A A;  3M0D A;  2ECW A;  3VMZ A;  3U5P A;  3L36 A;  3TNU A;  2VRS A;  4GNF A;  3U5O A;  3GV4 A;  1HBW A;  5CMZ A;  5KH3 A;  4YAB A;  3VN0 A;  4A4C A; 
#chains in the Genus database with same CATH topology
 5B78 A;  1SFC A;  1SLQ A;  1FBV A;  2LGV A;  5B66 H;  3CX5 I;  4H0L B;  3RK3 D;  2YUR A;  1WGM A;  4L73 A;  1L2P A;  2V7Q J;  3AEE C;  3KXD A;  1JY3 P;  3TSI A;  1LTJ B;  1LWU A;  3H1L G;  2HDP A;  4I7Z B;  4S3O C;  4GOF A;  1KQG B;  2KZJ A;  2C0X A;  2ZXX A;  3B5N A;  2ECJ A;  3G3Z A;  2QEX P;  4YC9 A;  2QIW A;  2N1T B;  3H1K J;  4I2L C;  2Q6Q A;  3CCV P;  3CWB J;  1VQN P;  1DEE G;  2D2C C;  3KYQ A;  4C46 A;  2B0O E;  4F52 B;  4AUQ B;  1ZME C;  5H1V A;  3RK2 C;  2YO2 A;  3IR9 A;  2ZYA A;  4PPE A;  1NKN A;  1PPJ D;  1VF5 C;  1JMB A;  1KB9 I;  1RQV A;  2R5D A;  3ASL A;  5SVX A;  2KK7 A;  3TYY A;  2XEU A;  2L80 A;  1ZRT D;  1YIJ P;  2Q5U A;  1WEE A;  4R7E A;  1P84 I;  3FAO A;  4H44 B;  5CJ4 A;  2GUS A;  3AE6 C;  2FXM A;  2WT7 A;  3HE5 B;  1DIP A;  5BVZ A;  1IFM A;  4U3F E;  2YNY A;  2QJ0 A;  3L4F A;  1KIL D;  4O62 A;  3T6R A;  2IYP A;  3IAO A;  2NRG A;  2H0D B;  4EIJ A;  2QJY C;  1N7S D;  4UB6 H;  2DW3 A;  3MP7 B;  3L71 J;  1NH4 A;  3E2D A;  5TIS E;  2LGL A;  1KYO E;  3MZW B;  2AXC A;  5KJ7 D;  3HCS A;  3TDK A;  4OVN F;  1LT9 C;  4Y99 C;  3CMA P;  2MUM A;  2K9J A;  2Y0D A;  1U7J A;  4Z1M H;  3L74 E;  2LR2 A;  2PGD A;  1KN7 A;  3H1H E;  4IFM A;  2RI7 A;  3V2N A;  2Q9I A;  1AV1 A;  1HF9 A;  1RHZ B;  5FB0 A;  3A7O A;  2I50 A;  5JG6 A;  1URQ C;  3T97 B;  4FIP A;  1KIL C;  4PD4 I;  2FY8 A;  1NAF A;  2VPE A;  2M3B A;  1N7S C;  1LTI C;  1WEV A;  3LQH A;  1L0L J;  3HD7 B;  3D71 A;  3LQI A;  4ZUX U;  1IZN B;  3V6I A;  2UWJ E;  2L7P A;  5H2F H;  5KKZ C;  2KRE A;  2QSI A;  2FFD C;  3O70 A;  2FYU D;  1DD4 A;  2RKL A;  5C39 A;  1X4J A;  3H6P A;  3L75 D;  5C11 A;  3FXE A;  1NOH A;  2KSE A;  3GHG B;  1J1D B;  5TDW A;  1PIX A;  2YSJ A;  1OW8 A;  1FOS E;  1KMI Z;  3W67 A;  3WU2 E;  3V2Q A;  2V7Q H;  3CX5 D;  4Y28 J;  4IFD K;  1H89 A;  1QGK B;  4NN2 A;  1XTG B;  1SQP E;  2QRX A;  1SFC B;  3MHH A;  3M91 A;  3SWY A;  2MJZ A;  3HRN A;  2IZ1 A;  2YSM A;  3L73 D;  5CHX A;  4DZO A;  2NPS D;  4JYB A;  4R2Y A;  5KLV E;  2I8D A;  3JC2 2;  1X0T A;  1YHQ P;  4U3F G;  2FKW B;  5B76 A;  4RKU J;  2E43 A;  3BCC E;  4H13 B;  1KQS O;  1QL2 A;  1SQQ E;  1FZA A;  2R44 A;  3SOW A;  3EFF K;  4GB0 A;  3LQJ A;  1LWU B;  1XTC C;  2KOG A;  2VPB A;  3C9I A;  2C2L A;  4JQ0 D;  3L74 G;  2Y9Y A;  3C8V A;  1GZL A;  5KH9 A;  5LKU A;  3H1H G;  2KZI A;  3B5N B;  1OW6 A;  1S2E A;  2HR3 A;  3EFG A;  1WE9 A;  4C7N A;  1SQX J;  1KB9 D;  3U59 A;  2C2V S;  3CCU P;  4K3A A;  2FFW A;  3H1J J;  2F42 A;  2OTJ P;  3L1X A;  4UI9 B;  1NU1 E;  3P8C E;  4YBT A;  1P84 D;  5M1B A;  4D6T E;  4AP4 A;  1CZQ A;  3TGU J;  1CI6 B;  5B8D A;  3RBZ A;  2KSJ A;  4WZ2 A;  3D6Y A;  2MT5 A;  3MD0 A;  1ZR2 A;  5APW A;  3NFQ A;  3Q1D A;  2OTK E;  5CBN A;  2W8Z A;  2FXO A;  5DJU B;  4N6J A;  2HOD B;  2JWA A;  1R5S A;  5LKZ A;  2WT7 B;  2ZFC A;  2F6N A;  4ZDT A;  1L4A D;  3JCU E;  4JBZ A;  1SQP G;  3HE4 B;  1SQV E;  2R32 A;  3H32 A;  3M63 A;  3R2P A;  3RK2 B;  1Q2N A;  5KLV G;  4OWF A;  4PV1 C;  1T3U A;  4PD4 D;  1VF5 B;  5E79 H;  2K16 A;  4K35 A;  1M90 Q;  5B66 E;  2UZG A;  2K9J B;  4AQR D;  3BCC G;  1LT1 A;  5TBN A;  2YO3 A;  3FWL A;  3CC4 P;  1SQQ G;  4WY4 A;  1S1C X;  2I1K A;  3L70 J;  2OYI A;  5APV A;  2R3C A;  2KYU A;  1RQU A;  3E1I A;  2FSA A;  2YKO A;  3M9B A;  1IYM A;  2MNZ A;  2CT2 A;  2A06 E;  2KFT A;  2L0B A;  2QJP B;  2QJY B;  2OYH C;  4PJ0 H;  2P2U A;  1M1K Q;  4GND A;  4IOI H;  5AW9 B;  4YAX A;  4R4L A;  3LID A;  3CLQ A;  1K04 A;  2E75 C;  1OX3 A;  5GTI H;  3T7L A;  3VP9 A;  4IC2 A;  1RE3 C;  1M7L A;  2PFX A;  2KKX A;  2ZT9 C;  1NU1 G;  3SOU A;  1IFI A;  2FYZ A;  4D6T G;  1EDI A;  3ITK A;  3I5C A;  2MD7 B;  5KLI B;  3FM8 C;  1MZ9 A;  1HJ0 A;  4OGE A;  1GK6 A;  3CXH H;  3IN6 A;  2H7H A;  2W6A A;  3JSV C;  1S4X A;  1BGY D;  1IC2 A;  4LGD E;  3O37 A;  2M3E A;  3VTP C;  2DSM A;  1R5L A;  2VRS A;  4GNF A;  1GMJ A;  2DJA A;  2JR8 A;  1L0N D;  5KH3 A;  4OH8 B;  3AE5 C;  2FFD B;  3H1I D;  2E5Y A;  1X4U A;  1HYJ A;  3GG2 A;  3VMX A;  3HTK A;  3S1K A;  3ZNI A;  2YW8 A;  3G6E P;  1SQV G;  3O36 A;  3RL0 C;  3N9P A;  1PP9 J;  3RPG C;  2LXP C;  1ZV8 A;  2AEJ A;  1N7L A;  4NPD A;  1X8Y A;  4UB6 E;  3ZPV 1;  3L72 E;  5APU A;  1JY3 N;  1L0N K;  3F89 A;  3HD7 D;  2FUU A;  4RJT A;  4LC1 A;  1IK9 A;  1VQL P;  1HVV A;  2GA1 A;  2V4H A;  1BSN A;  1VQ7 P;  3RL0 g;  1QVG O;  4C7N B;  3FXD A;  1AVO A;  3AEF C;  2H0D A;  2BCC E;  1AQ5 A;  2XV5 A;  2A06 G;  1NTM D;  5AVU B;  1WES A;  2C9N Y;  2AXT H;  2IFN A;  4WA6 A;  5APQ A;  3EQ2 A;  2IBZ I;  1YQ3 C;  1FE6 A;  4OGC A;  1WEN A;  3QWO C;  1QX8 A;  5GTH H;  3TK1 A;  2FYU J;  1WEQ A;  1SFC D;  2IDA A;  5H2F E;  3CME P;  2Y9Z A;  4Z0O A;  1KOR A;  2G45 A;  4GOD A;  2ZYG A;  3PLN A;  2A45 H;  2E76 D;  3LW5 H;  5AVX B;  5KH7 A;  2Y43 A;  1VQP P;  1N73 C;  4CA1 A;  1VQ4 P;  2IQJ A;  4OGQ B;  1FZE A;  2YMY A;  2H88 C;  1K9M Q;  1ZP0 C;  3L73 J;  1NHL A;  2M5A A;  5H9M A;  1NTK D;  1SQX K;  3HUS C;  3L1Z B;  2PRR A;  1FZB A;  1OW7 A;  1EC5 A;  1VDF A;  3B5N D;  3H1K E;  3QZV A;  3CWB E;  2L5G B;  1RH5 B;  3O6Q A;  5AIT A;  3MTU E;  4WY4 B;  1YI2 P;  3SWK A;  1H8A A;  2AEM A;  2YQM A;  1CHC A;  1X22 A;  2B9B A;  4N3Y B;  3E1R A;  3L72 G;  3Q1M A;  2VPD A;  4X3G A;  1NKZ B;  1FZC C;  2AN6 A;  3MHS A;  3N9Q A;  2KE1 A;  2VPG A;  5AW0 B;  2MKE A;  1M1J A;  1FDM A;  2QM7 A;  3PRJ A;  2WTY A;  2R5B A;  1PGP A;  1GL2 C;  2WVR A;  2E6R A;  1VQO P;  2BCC G;  1E4U A;  4A0C D;  1U6G B;  2MA5 A;  4ASV A;  5APS A;  3KPE A;  1PGJ A;  1OFC X;  1M57 D;  1EZV E;  4F1P A;  2K4D A;  4R8P K;  1FDI A;  4O64 A;  2FYN C;  5DIN A;  1Y8A A;  2P1J A;  2ECG A;  3L71 E;  2K88 A;  2KIZ A;  1ZW0 A;  3CCM P;  1YJW P;  3V2R A;  3RK3 C;  1DCQ A;  4LAD B;  1FZG A;  2W90 A;  2XU6 A;  4YAT A;  2E75 B;  3WMM 0;  2RH0 A;  3HTK B;  2QE7 H;  1CI6 A;  2ITA A;  2ZT9 B;  2PNX A;  4N3W A;  2M85 A;  1FU1 A;  1NGM B;  1GW4 A;  3AE9 C;  2PP6 A;  4W80 A;  1VQK P;  3H1K G;  4YBM A;  1S72 P;  2ZET C;  1L0L E;  2HOD A;  3CWB G;  4A4B A;  2O3J A;  3FWN A;  1H0T A;  3KZI H;  3VYI A;  3KV6 A;  2QG4 A;  5E79 E;  4BRY B;  3AE2 C;  2LRI C;  3B4S A;  2IZ0 A;  2IBZ D;  2QM8 A;  2N9Y B;  1KV4 A;  4GNG A;  3HE4 A;  2J59 M;  3OW2 O;  1WEW A;  1TU3 F;  1SQB D;  1IFD A;  3CX5 H;  2OWA A;  2IYO A;  1JUN A;  3RL0 B;  3LIE A;  3PH0 A;  1LNQ A;  1E79 H;  1VQ9 P;  2YHO A;  2KI7 B;  1WRG A;  1BCC D;  3IFM A;  1VQ5 P;  5KTB A;  3BAT A;  4B86 C;  1E5W A;  3A0B H;  2W6B A;  2O1J A;  4PJ0 E;  5FEY A;  3V5B A;  2WPR A;  2JRJ A;  4IC3 A;  4GNE A;  1S5L X;  3BRV B;  2CSY A;  3A3Y B;  2BEZ F;  3M99 A;  5GTI E;  3O35 A;  2PAJ A;  4ZQL A;  3S4R A;  1EZV G;  5I3L A;  3FAN A;  2QJK C;  1X9V A;  1RF0 C;  5H1T A;  2GUV A;  3MIW A;  3LDY A;  1BGY J;  5G04 B;  3CXH E;  5APT A;  3L71 G;  2JWD A;  1JCD A;  1USD A;  5KJ7 C;  4YPC A;  1LT9 A;  2F6J A;  2IX7 C;  2XOC A;  1MFZ A;  1UII A;  3QH9 A;  3ZVZ B;  1L0N J;  1MBM A;  2M5A B;  1VFY A;  1KD1 Q;  3H1I J;  1BDD A;  4XFJ A;  2LXH C;  4N78 D;  1LTB C;  2RR4 A;  4TKP B;  1KB9 H;  1VPC A;  2HFE D;  2KKY A;  1A02 F;  3O6Q B;  2E74 D;  4WZ3 B;  1FJP A;  5APX A;  1SQX E;  3FL2 A;  1URQ A;  1IFN A;  1KIL A;  2M6M A;  1P84 H;  3MUD C;  2YIU B;  3H1J E;  1N7S A;  2P10 A;  2FYU K;  2C0W A;  1L0L G;  2XOY A;  1NTZ D;  2K3R A;  3TGU E;  4R4M A;  1JTH B;  1HJB A;  1BE3 D;  3G9R A;  3U5N A;  4WWI A;  4P5O B;  2FFD A;  2JMJ A;  1AJY A;  1MV8 A;  4W7Y A;  1M1J B;  3NG2 A;  5BU8 B;  5K3Q A;  3C6W A;  1SVF A;  4FK5 A;  2IFM A;  4HKZ H;  2E74 C;  3Q3D A;  1NTM J;  1YQ4 C;  1DEB A;  1NTZ K;  3O8Z A;  2KU3 A;  4YBS A;  4I1L A;  3MUD A;  4XA4 A;  5AW4 B;  1YTZ I;  2AXT E;  2Q7C A;  4OGQ D;  3N7N A;  1N2D C;  2YHN A;  1G2C A;  3H1L D;  1JY3 O;  3N9O A;  5GTH E;  2NPS C;  2VNF A;  4PD4 H;  1HGZ A;  1VQ8 P;  2W83 C;  1M56 D;  5SVI B;  3PJS K;  1MKM A;  3VMY A;  5CCG D;  4L58 A;  2YYR A;  1WEM A;  3WUT A;  2JM3 A;  3L70 E;  1KYO I;  2CRR A;  2ECW A;  3AEB C;  3LVQ E;  3CCJ P;  1ZLL A;  1RY3 A;  1HBW A;  4ZMD A;  4YAB A;  1WMK A;  1JY2 P;  2WPV B;  1WIL A;  4N4F A;  4S3O B;  4YXW H;  4LJN A;  1ZXG A;  1YYC A;  2Q3E A;  2BAY A;  1G1I A;  3VMA A;  1NTK J;  2BEQ D;  2ECN A;  3KQI A;  2EGM A;  4XE5 B;  1Q7Y Q;  4H0L D;  2YRE A;  5EFW B;  2KYV A;  1H0T B;  2KGI A;  1SQX G;  2OGU A;  2KS1 A;  4GIF A;  2KIK A;  2QIZ A;  2G43 A;  2D2C B;  1FAV A;  1K2F A;  3H1J G;  5B79 A;  2XP0 A;  1T6A A;  5DKA A;  4L7X A;  3TGU G;  2L91 A;  2KWN A;  1MUU A;  5L8R J;  5CCH D;  2H43 A;  1Z60 A;  4LLB A;  3GLM A;  1PPJ E;  2CKL B;  2N1T D;  1RE4 C;  2HPC A;  1ZRT E;  2FBW C;  1NYH A;  4H9D A;  4CPG A;  3NXS A;  3TNU B;  2G6Q A;  4RO0 A;  3CI9 A;  3CCQ P;  4TLF A;  2JDI H;  1L4A C;  4M3L A;  4QMA A;  2XZR A;  5K5G B;  1Z56 A;  3FEH A;  2VJE A;  1KIL E;  3AEC C;  2Y1M A;  1PP9 E;  1BDC A;  2P58 A;  1GTW A;  4L75 A;  1WFK A;  1G25 A;  2PUY A;  4I7Z C;  5CCH C;  5LKT A;  3H25 A;  2Q3I A;  1LT9 B;  2JP3 A;  2WWW A;  4Y99 B;  3L11 A;  1OVV A;  3ZYQ A;  2WSE J;  4IL6 X;  3CC7 P;  4ZKP A;  4H44 D;  3L70 G;  3C1L A;  2A45 G;  2JKV A;  3RBX A;  3T9K A;  2OAR A;  3V4W A;  4JF7 A;  1K8A Q;  4YAD A;  3M9H A;  1LGH B;  4BHW A;  3B71 A;  4C9Z A;  1URQ B;  1T2K D;  1KIL B;  3TF5 A;  1RF1 C;  3N4X A;  2J5U A;  1YJN P;  3DWD A;  1N7S B;  2OYH A;  3EB5 A;  1LTT C;  1W5C E;  5LCW B;  1LJ2 A;  5KKZ B;  2JJL A;  2FYU E;  1L0L D;  2Z5I A;  4EI2 A;  1ZR4 A;  1RE3 A;  3KZI E;  4H44 C;  2KWJ A;  3ZPV E;  2LDR A;  2P57 A;  2ZXE B;  1JMM A;  5G0F A;  2CRW A;  1SQB J;  3LVR E;  4U3F D;  4GKG A;  3CX5 E;  1EXI A;  1T2K C;  4JYC A;  1PPJ G;  1BCC J;  2JO1 A;  3JUE A;  3K5B A;  1KYO D;  1G2C B;  2D8S A;  4BRY A;  1JEK A;  4V3L C;  4WBA A;  4HH2 A;  1EQ7 A;  3VP8 A;  3Q5R A;  4GOE A;  1ZOY C;  2HLO A;  3A0B E;  2O01 J;  3L74 D;  2LXB A;  3L73 E;  3R4Y A;  5AVT B;  3A0H H;  3H1H D;  1U7M A;  1GU4 A;  1Q90 D;  3BRT B;  1USE A;  3G71 P;  1DVP A;  3KDE C;  4NPE A;  1PP9 G;  2EXU A;  1Q81 Q;  4KHX A;  5AW7 B;  2Z4E A;  1S9K E;  1XWH A;  4KJM A;  5DJT B;  2KWK A;  3AE1 C;  2O01 N;  3MDB C;  3HD7 C;  3L75 J;  5AW5 B;  5SVY A;  2HG5 D;  2EOD A;  3II6 A;  1BOR A;  4MVT A;  4HJG H;  4WZ0 A;  3NTN A;  2N9B A;  2NPS B;  1NTM K;  1IFP A;  3GHG C;  2I1J A;  1J1D C;  5TJH A;  1SS1 A;  3PHL A;  2KS1 B;  4EOT A;  3O47 A;  5FB1 A;  4H13 D;  1CSB A;  1KB9 E;  1FJK A;  1T3J A;  2C9L Y;  3M0D C;  3DDT A;  1P84 E;  3AEA C;  1NTZ J;  3W68 A;  2RMZ A;  3OJA B;  3CCE P;  1BE3 J;  3GMA A;  1SQP D;  1NVO A;  1SFC C;  2FYU G;  3PP5 A;  2EGP A;  1N87 A;  2YQL A;  2WSE H;  5KLV D;  5AVS B;  2HPC B;  2LAU A;  1Q82 Q;  2E76 C;  1YBK A;  5G05 B;  2WSS H;  3BCC D;  5B5E H;  3AE3 C;  1N73 A;  5CBO A;  2LV9 A;  1JM7 A;  1GD2 E;  1SQQ D;  1H88 A;  2Z5H A;  2YXR B;  1IJD B;  3UIA A;  1JTH A;  2SPZ A;  3AE7 C;  1OVU A;  1LWU C;  4FO9 A;  1NTK K;  3OA7 A;  3I56 P;  4RES B;  2VJE B;  3H1L J;  5AW3 B;  3WUU A;  2LGG A;  2WSF J;  5AVW B;  3D6Z A;  3SWF A;  1YJ9 P;  1VL2 A;  3L73 G;  3HUS A;  5KLV K;  2K1J A;  4PV1 B;  4W7Z A;  2JUN A;  1OMI A;  3E7K A;  3B5N C;  4BWN A;  4PD4 E;  4IFF A;  2WPQ A;  1Q86 Q;  3M62 A;  2E6S A;  3AE8 C;  1MM2 A;  1IO4 A;  1K73 Q;  1SQQ K;  4IL6 H;  2WZ7 A;  2P67 A;  2G3A A;  2D2C D;  1FZF A;  1Z2Q A;  1NU1 D;  3P8C D;  2FXP A;  3L70 D;  3F5H A;  3GF3 A;  5BU5 A;  4D6T D;  1L4A B;  1FZC A;  3CCS P;  2OYO A;  1UIX A;  2KUB A;  2NAA A;  3O33 A;  3V4Q A;  2CK3 H;  1VD4 A;  3ZVY A;  5AVR B;  1HWT C;  3RK2 D;  5SVI A;  2OYH B;  2L75 A;  2FUI A;  1YTZ T;  2Y1N A;  1VF5 D;  1JCC A;  3RTR B;  3H7H A;  1GL2 A;  2O01 H;  1DH3 A;  5TRB A;  2L43 A;  2ECT A;  5B77 A;  1NU1 K;  2YKP A;  5AW8 B;  1NO4 A;  1JNM A;  3PLW A;  2B87 A;  1SQV D;  1EDK A;  5AVY B;  2K1A A;  1BGY E;  3I55 P;  1WT6 A;  1RF1 B;  3P32 A;  1HH0 A;  2MD8 C;  3KQG A;  2KWO A;  2M1R A;  1KC8 Q;  2XND H;  1N8R Q;  1L0N E;  5TAB A;  3P8M C;  2MKV A;  3H1I E;  4W4U A;  1HUC A;  3VOP A;  1FS0 E;  1KFN A;  1PFI A;  1S5L E;  1SQV K;  3ZDM A;  3CD6 P;  2E61 A;  3IHP A;  1MFT A;  1M8O B;  5APY A;  2LGK A;  3RPG B;  2CKL A;  1URQ D;  2CSZ A;  1V87 A;  2A06 D;  2QA4 P;  3HCT A;  1J1E C;  1PP9 D;  2QJP C;  1EDJ A;  4LLH A;  3M0A A;  1QLE D;  3U5P A;  3L36 A;  3TNU A;  3GV4 A;  2XNX A;  5CMZ A;  1SQB K;  1JY2 N;  4A4C A;  3WUV A;  4L76 A;  3V43 A;  2D8U A;  4UP0 A;  1IFJ A;  3Q5P A;  1LTG C;  3HCU A;  2Y0E A;  5KLI C;  1OXZ A;  2JMI A;  5AVV B;  1NTM E;  4LK9 A;  2MNY A;  4WVZ A;  1PL5 A;  4I7C A;  5AW6 B;  1FOS F;  4WB4 A;  2LN0 A;  4BBQ A;  2OTL P;  1OZH A;  1OIP A;  1W2E A;  4B86 A;  2WSF H;  1G1J A;  3M06 A;  1AQT A;  2YXQ B;  2R3S A;  1MM3 A;  4AUW A;  2W6J H;  3KV5 A;  4Z0R A;  2XOZ A;  1JOC A;  1EZV I;  2XB1 A;  1RMD A;  1KZU B;  2P7J A;  2IPP A;  2KNC A;  1IK7 A;  4U3F J;  3DPL R;  4V3K C;  1RF0 A;  1WEO A;  2G8Y A;  1GU5 A;  1N73 B;  1BGY G;  2H8P D;  1JM7 B;  1LP1 A;  1KQF B;  1JM0 A;  2LQ6 A;  4GT1 A;  5FER A;  3MHV A;  1AA0 A;  5KJ7 A;  5KAF H;  3BVH A;  3KHU A;  3L72 D;  4QF2 A;  3M7K A;  1NWQ A;  5KAI H;  2ZJS E;  2VJF A;  1L0N G;  2OXQ C;  3L74 J;  1J2J B;  3HUS B;  3H1I G;  1NTK E;  1JB0 J;  3H1H J;  1EXJ A;  4Q6F A;  3A0H E;  1YIT P;  2WIT A;  1QL1 A;  5LKX A;  1K05 A;  2BCC D;  2E76 B;  4CCG X;  1WEP A;  4UB8 H;  2LKM A;  2L5U A;  2CPS A;  1FZC B;  4XI1 A;  4DJG A;  3USS A;  1S9K D;  1WIM A;  1VQ6 P;  2VP7 A;  3BAS A;  3I2D A;  1Z6U A;  2DX8 A;  3MGN A;  3RK3 E;  1DX7 A;  1EDL A;  2WQY C;  2WPS A;  1GL2 B;  4U7J A;  4L74 A;  1HYI A;  4BXL A;  4AVX A;  2WSC J;  4WY4 D;  3ABV C;  4ASW A;  1Y47 A;  1NTM G;  1FP0 A;  3L37 A;  3PHD A;  4I7D A;  2XKM A;  2JMD A;  1KQL A;  4OGQ C;  3SHB A;  2RN0 A;  1A02 J;  2B87 B;  3P7K A;  1SQP J;  3PTZ A;  4HYT B;  5C13 A;  1X4I A;  2FYN B;  2NPS A;  3CC2 P;  1FC2 C;  2QIC A;  5KLV J;  5CCG C;  3RK3 B;  4PTB A;  4PV1 D;  1QEX A;  3H1K D;  3OAK A;  3DQV R;  1AFO A;  3CWB D;  5AVZ B;  3CXH I;  3BCC J;  2ECV A;  2K37 A;  1AVY A;  2ZVN B;  4EDF A;  5EYA F;  2M8R A;  3U1C A;  1SQQ J;  4WY4 C;  5B5E E;  2OYI C;  3M9Q A;  4QQ4 A;  1NAY A;  1KTM A;  5CJ0 A;  5AVQ B;  2B89 A;  4EYY Q;  1NTK G;  1GDT A;  3FJU B;  3LJU X;  4H0L C;  3AE4 C;  2CPB A;  4TT3 H;  3FGA D;  4GDO A;  1S5L H;  4AYC A;  3A5T A;  5CCG A;  1ZBD B;  1GW3 A;  2FD4 A;  1LTA C;  2KGG A;  2E75 D;  3PUQ A;  2IBZ E;  1LTJ C;  5D1K B;  2E42 A;  4IL6 E;  2ZYD A;  2YVR A;  3EWK A;  1NU1 J;  2ZT9 D;  2E5T A;  3LW5 J;  4D6T J;  3L35 A;  2YT5 A;  1SQB E;  1EZV D;  3PUR A;  2K9Y A;  3EB6 A;  1ZN5 A;  5TIS H;  1KYO H;  2N1T C;  1FDO A;  3N9M A;  1BCC E;  3L71 D;  1OVR A;  1WEU A;  1RE4 A;  1J1E B;  1VYX A;  3FX0 A;  5AIU A;  3C5K A;  4QF3 A;  4ZKU A;  2KP8 A;  1L4A A;  4MSX A;  1LTJ A;  2KNC B;  2QJK B;  3HTK C;  3N9N A;  4HB1 A;  2YU4 A;  3CL3 D;  5AW1 B;  1SQV J;  3D70 A;  4DOJ A;  3SOX A;  3RL0 D;  2YUC A;  1LP1 B;  3S9O A;  5CCH A;  1U57 A;  1JO5 A;  3SFD C;  1SP4 A;  5TDR A;  1QVF O;  3B8E B;  3G4S P;  4LKA A;  2N1T A;  1T1H A;  2A45 I;  1LDJ B;  2VJF B;  3L75 E;  3Q5S A;  2B88 A;  2M13 A;  2CSV A;  1D7M A;  1X79 B;  4N78 E;  2MIQ A;  1HGV A;  3SSU A;  3CCL P;  2WSC H;  3WU2 H;  3O34 A;  5AW2 B;  3ZTG A;  2RSD A;  5H1U A;  3U5M A;  1S3J A;  2OQQ A;  3SUB A;  2GM4 A;  3U1A A;  1RF1 A;  2POH A;  3SFE C;  4JPZ B;  4DT0 A;  1PV3 A;  2M3H A;  1CW5 A;  1VQM P;  1GK4 A;  4MN4 C;  2EA6 A;  1L0L K;  1NTZ E;  1KFM A;  1OWA A;  1NJI Q;  1HTL C;  2WMM A;  1BE3 E;  4O9B A;  2IDB A;  2CON A;  2IBZ G;  1PZQ A;  2KXP B;  2ZVO B;  1LTS C;  2K17 A;  1PGQ A;  3LRQ A;  1SQB G;  3HE5 A;  2E74 B;  2JEE A;  4C7R A;  4FJC A;  3CCR P;  4A49 A;  2KLU A;  3CXH D;  4A7P A;  2O1K A;  3KNV A;  4NPF X;  1BCC G;  3A2A A;  1T8Z A;  4KT0 J;  2J58 A;  2W27 A;  3VK6 A;  1PGO A;  2Y0C A;  3H1L E;  3O7A A;  2QVA A;  2NZ2 A;  2MA6 A;  4YTP C;  1JY2 O;  2YMK A;  1FBM A;  3NMD A;  1BSH A;  5J3X A;  2KR4 A;  4DCK A;  1W2B O;  3GL6 A;  5D1M B;  2BAS A;  2YKQ A;  1SQX D;  2LXC B;  3T97 A;  3IF4 A;  4UP5 A;  3H1J D;  3AED C;  2YIU C;  4ZNC A;  3GW6 A;  1Y9B A;  3L72 J;  3HD7 A;  5B75 A;  2HYE D;  3TGU D;  5KAF E;  4I7B A;  3L75 G;  2HYN A;  2ZAE B;  1F62 A;  2Q1K A;  3CPW O;  3H32 B;  1DD3 A;  1R8E A;  5KAI E;  5D1L B;  4YXD C;  2XDJ A;  1M1J C;  1N86 A;  4I6M C;  3KDP B;  3GF7 A;  2H89 C;  3GHG A;  2ECI A;  3N9L A;  1LDK C;  4AYC B;  2AEF A;  4H13 C;  4B7Y C;  1GL2 D;  2BCC J;  3RGU A;  3V2P A;  3AEG C;  3M0D A;  1SQP K;  2M0B A;  3VMZ A;  3JCU H;  2KLV A;  3U5O A;  2KB7 P;  1NTZ G;  4UB8 E;  2OYI B;  3Q2Y A;  3VN0 A;  1BE3 G; 
#chains in the Genus database with same CATH homology
 1X4U A;  1HYJ A;  5B78 A;  1SFC A;  1SLQ A;  1WIL A;  4N4F A;  4S3O B;  3VMX A;  4LJN A;  3HTK A;  3V43 A;  1YYC A;  1FBV A;  4UP0 A;  3ZNI A;  2BAY A;  1G1I A;  1IFJ A;  2YW8 A;  3O36 A;  3RL0 C;  1LTG C;  3HCU A;  2LGV A;  3N9P A;  2ECN A;  3KQI A;  4XE5 B;  1OXZ A;  2JMI A;  3RPG C;  5AVV B;  4LK9 A;  2YRE A;  2KGI A;  2KYV A;  2LXP C;  2MNY A;  1ZV8 A;  3RK3 D;  4I7C A;  1N7L A;  5AW6 B;  4WB4 A;  1FOS F;  2LN0 A;  2YUR A;  1WGM A;  4GIF A;  4BBQ A;  1X8Y A;  2QIZ A;  2G43 A;  3ZPV 1;  1W2E A;  1FAV A;  4B86 A;  1K2F A;  2WSF H;  1G1J A;  5B79 A;  5APU A;  1JY3 N;  3M06 A;  1L0N K;  3HD7 D;  1JY3 P;  3TSI A;  1LTJ B;  1MM3 A;  2FUU A;  5DKA A;  1LWU A;  4AUW A;  4LC1 A;  1IK9 A;  4L7X A;  1HVV A;  3KV5 A;  1JOC A;  2KWN A;  1MUU A;  2XB1 A;  2HDP A;  1RMD A;  1KZU B;  5CCH D;  4S3O C;  2H43 A;  2P7J A;  1Z60 A;  2IPP A;  3DPL R;  4V3K C;  4C7N B;  4LLB A;  1RF0 A;  1WEO A;  2C0X A;  3B5N A;  2ECJ A;  3G3Z A;  2H0D A;  2CKL B;  4YC9 A;  1AQ5 A;  2N1T D;  1GU5 A;  2XV5 A;  1N73 B;  2H8P D;  2N1T B;  1JM7 B;  1RE4 C;  4I2L C;  5AVU B;  2HPC A;  1WES A;  2C9N Y;  2LQ6 A;  4GT1 A;  2IFN A;  5FER A;  5KJ7 A;  3NXS A;  3TNU B;  2G6Q A;  3BVH A;  4WA6 A;  5APQ A;  3EQ2 A;  4QF2 A;  3CI9 A;  3KYQ A;  1NWQ A;  1WEN A;  3TK1 A;  2VJF A;  4C46 A;  1L4A C;  2OXQ C;  1WEQ A;  1J2J B;  4M3L A;  1SFC D;  3HUS B;  2IDA A;  2XZR A;  4F52 B;  1Z56 A;  2VJE A;  2Y1M A;  4AUQ B;  4Q6F A;  5H1V A;  3RK2 C;  1GTW A;  2G45 A;  2YO2 A;  1WFK A;  2PUY A;  1G25 A;  3IR9 A;  5CCH C;  2WIT A;  1QL1 A;  4PPE A;  1NKN A;  2A45 H;  3LW5 H;  5AVX B;  5LKX A;  5LKT A;  2Q3I A;  2R5D A;  3ASL A;  2Y43 A;  4CCG X;  5KH7 A;  1LT9 B;  2WWW A;  1WEP A;  4Y99 B;  3L11 A;  4CA1 A;  3TYY A;  1N73 C;  3ZYQ A;  2XEU A;  2L80 A;  2Q5U A;  1WEE A;  4R7E A;  4ZKP A;  2LKM A;  2L5U A;  5CJ4 A;  2A45 G;  2CPS A;  1FZC B;  4XI1 A;  2GUS A;  1S9K D;  1WIM A;  1FZE A;  2OAR A;  3V4W A;  4JF7 A;  2YMY A;  2VP7 A;  2FXM A;  2WT7 A;  3HE5 B;  3BAS A;  4YAD A;  5BVZ A;  1IFM A;  3M9H A;  1NHL A;  2YNY A;  1LGH B;  3I2D A;  3HUS C;  1SQX K;  1Z6U A;  2DX8 A;  2QJ0 A;  3L1Z B;  1URQ B;  3L4F A;  5H9M A;  1KIL D;  3MGN A;  1FZB A;  1T2K D;  3T6R A;  4C9Z A;  1KIL B;  1DX7 A;  1VDF A;  3B5N D;  1RF1 C;  2WPS A;  3QZV A;  3N4X A;  1GL2 B;  4EIJ A;  2H0D B;  1N7S D;  2L5G B;  1HYI A;  1N7S B;  4AVX A;  2OYH A;  5AIT A;  4WY4 D;  3EB5 A;  3MTU E;  1NH4 A;  4WY4 B;  1FP0 A;  2LGL A;  1LTT C;  3HCS A;  5KJ7 D;  5LCW B;  3L37 A;  3PHD A;  1H8A A;  1LT9 C;  2YQM A;  4Y99 C;  1CHC A;  2JJL A;  2XKM A;  4I7D A;  2MUM A;  2JMD A;  1KQL A;  4N3Y B;  3SHB A;  2Z5I A;  1ZR4 A;  2VPD A;  1RE3 A;  1A02 J;  4X3G A;  3P7K A;  5C13 A;  4HYT B;  4IFM A;  1NKZ B;  1FZC C;  2KWJ A;  2RI7 A;  3ZPV E;  2LDR A;  2ZXE B;  3V2N A;  2Q9I A;  1X4I A;  1JMM A;  5G0F A;  2AN6 A;  2NPS A;  3MHS A;  3N9Q A;  5FB0 A;  3A7O A;  2KE1 A;  5AW0 B;  2VPG A;  2QIC A;  1M1J A;  2I50 A;  5JG6 A;  1FDM A;  2QM7 A;  4GKG A;  1URQ C;  5CCG C;  3RK3 B;  4PTB A;  4FIP A;  1KIL C;  1T2K C;  2WTY A;  2R5B A;  3OAK A;  4JYC A;  1AFO A;  3DQV R;  1NAF A;  5AVZ B;  1GL2 C;  2E6R A;  2VPE A;  2M3B A;  1E4U A;  2ECV A;  1N7S C;  1LTI C;  4A0C D;  1U6G B;  1WEV A;  2MA5 A;  3LQH A;  5EYA F;  2M8R A;  3HD7 B;  1G2C B;  5APS A;  3U1C A;  4WY4 C;  2D8S A;  3LQI A;  4ZUX U;  4V3L C;  4WBA A;  4HH2 A;  1EQ7 A;  3KPE A;  3VP8 A;  2OYI C;  2KRE A;  2FFD C;  3M9Q A;  3O70 A;  2HLO A;  5AVT B;  1X4J A;  5CJ0 A;  3H6P A;  1GU4 A;  5C11 A;  5AVQ B;  2K4D A;  1NOH A;  3GHG B;  3BRT B;  4R8P K;  1J1D B;  5TDW A;  1DVP A;  1GDT A;  2YSJ A;  1FOS E;  4O64 A;  5DIN A;  2P1J A;  2ECG A;  3V2Q A;  2KIZ A;  2CPB A;  3V2R A;  3RK3 C;  4IFD K;  1H89 A;  4KHX A;  5AW7 B;  4AYC A;  3A5T A;  2Z4E A;  5CCG A;  1FZG A;  1S9K E;  1ZBD B;  1GW3 A;  4LAD B;  1XWH A;  1LTA C;  2KGG A;  4NN2 A;  2KWK A;  1XTG B;  3PUQ A;  2XU6 A;  4YAT A;  1LTJ C;  5D1K B;  2E42 A;  3HD7 C;  1SFC B;  3MHH A;  3WMM 0;  3M91 A;  3SWY A;  3HTK B;  1CI6 A;  5AW5 B;  2MJZ A;  3HRN A;  2HG5 D;  2YT5 A;  3L35 A;  2EOD A;  2YSM A;  3II6 A;  1BOR A;  2PNX A;  4MVT A;  5CHX A;  4DZO A;  4N3W A;  2NPS D;  3PUR A;  4JYB A;  3NTN A;  2M85 A;  4R2Y A;  4WZ0 A;  3EB6 A;  1FU1 A;  2N9B A;  2NPS B;  1NTM K;  1GW4 A;  3GHG C;  2I1J A;  1ZN5 A;  2FKW B;  2PP6 A;  1J1D C;  5B76 A;  4EOT A;  2N1T C;  2E43 A;  5FB1 A;  4W80 A;  3N9M A;  1CSB A;  1WEU A;  1RE4 A;  1J1E B;  4YBM A;  1QL2 A;  1FJK A;  1VYX A;  2HOD A;  2ZET C;  1FZA A;  1T3J A;  2C9L Y;  4A4B A;  3M0D C;  3SOW A;  5AIU A;  4GB0 A;  3LQJ A;  1LWU B;  3VYI A;  3C5K A;  3KV6 A;  4QF3 A;  1XTC C;  2KOG A;  4ZKU A;  2VPB A;  2LRI C;  3OJA B;  3C9I A;  2KP8 A;  2QM8 A;  2C2L A;  1L4A A;  4GNG A;  3HE4 A;  2J59 M;  4MSX A;  1SFC C;  1WEW A;  1LTJ A;  3PP5 A;  3HTK C;  3N9N A;  1GZL A;  2YU4 A;  5KH9 A;  3CL3 D;  5AW1 B;  2EGP A;  5LKU A;  1IFD A;  3B5N B;  4DOJ A;  3SOX A;  3EFG A;  3RL0 D;  1N87 A;  2YUC A;  2YQL A;  2WSE H;  1JUN A;  3RL0 B;  5AVS B;  1WE9 A;  3LIE A;  2HPC B;  5CCH A;  2YHO A;  1JO5 A;  4C7N A;  1SP4 A;  1WRG A;  5TDR A;  3B8E B;  5G05 B;  3IFM A;  3U59 A;  4LKA A;  2C2V S;  1N73 A;  2LV9 A;  2N1T A;  5KTB A;  3BAT A;  1GD2 E;  1T1H A;  1E5W A;  4B86 C;  1JM7 A;  1H88 A;  2A45 I;  2W6B A;  2Z5H A;  2F42 A;  2O1J A;  1LDJ B;  2VJF B;  5FEY A;  3L1X A;  3V5B A;  3P8C E;  4UI9 B;  1IJD B;  2WPR A;  3UIA A;  1JTH A;  2JRJ A;  4GNE A;  4IC3 A;  4YBT A;  1LWU C;  4FO9 A;  1NTK K;  3OA7 A;  3BRV B;  4RES B;  4AP4 A;  1CZQ A;  2CSY A;  2VJE B;  1CI6 B;  3A3Y B;  5AW3 B;  1X79 B;  3M99 A;  5B8D A;  4N78 E;  2MIQ A;  1HGV A;  2LGG A;  2KSJ A;  3O35 A;  5AVW B;  2WSC H;  4WZ2 A;  2PAJ A;  3O34 A;  3SWF A;  4ZQL A;  5AW2 B;  3ZTG A;  3HUS A;  5I3L A;  2MT5 A;  5KLV K;  1X9V A;  3MD0 A;  2RSD A;  2K1J A;  1ZR2 A;  4W7Z A;  1RF0 C;  5H1T A;  3U5M A;  5H1U A;  2GUV A;  3B5N C;  3NFQ A;  5APW A;  3MIW A;  2GM4 A;  3U1A A;  1RF1 A;  2POH A;  5G04 B;  4IFF A;  2WPQ A;  2M3H A;  1CW5 A;  5APT A;  3M62 A;  2E6S A;  1GK4 A;  1MM2 A;  4N6J A;  1JCD A;  1L0L K;  2HOD B;  1IO4 A;  1SQQ K;  2EA6 A;  2WZ7 A;  5KJ7 C;  1KFM A;  1OWA A;  2P67 A;  1LT9 A;  1HTL C;  2F6J A;  2IX7 C;  5LKZ A;  1MFZ A;  1FZF A;  2WT7 B;  4O9B A;  1Z2Q A;  2ZFC A;  3P8C D;  3ZVZ B;  2F6N A;  4ZDT A;  1L4A D;  5BU5 A;  1VFY A;  1L4A B;  3HE4 B;  1FZC A;  2LXH C;  2R32 A;  3H32 A;  3M63 A;  4N78 D;  1LTS C;  1LTB C;  2K17 A;  3LRQ A;  2NAA A;  3O33 A;  3V4Q A;  1VD4 A;  4TKP B;  3ZVY A;  1VPC A;  2HFE D;  3HE5 A;  5AVR B;  3R2P A;  3RK2 D;  1HWT C;  1A02 F;  4WZ3 B;  4BHW A;  3RK2 B;  2OYH B;  1FJP A;  2L75 A;  2FUI A;  5APX A;  3FL2 A;  1URQ A;  2JEE A;  1YTZ T;  2Y1N A;  1IFN A;  1KIL A;  1JCC A;  2M6M A;  3RTR B;  4C7R A;  1T3U A;  4FJC A;  4A49 A;  1GL2 A;  2K16 A;  2O01 H;  2O1K A;  2UZG A;  4AQR D;  3KNV A;  1N7S A;  1DH3 A;  5TRB A;  3A2A A;  2FYU K;  2L43 A;  1T8Z A;  2C0W A;  2ECT A;  5TBN A;  2YO3 A;  2J58 A;  2W27 A;  5B77 A;  4WY4 A;  2I1K A;  3VK6 A;  1NU1 K;  2YKP A;  5AW8 B;  2OYI A;  1JTH B;  2R3C A;  5APV A;  1HJB A;  2KYU A;  1NO4 A;  1JNM A;  3U5N A;  3O7A A;  4P5O B;  2FFD A;  2MA6 A;  2JMJ A;  1MV8 A;  1JY2 O;  4W7Y A;  1FBM A;  3NMD A;  1M1J B;  5J3X A;  3E1I A;  2KR4 A;  5BU8 B;  3NG2 A;  3C6W A;  2FSA A;  1SVF A;  2YKO A;  5AVY B;  3GL6 A;  5D1M B;  3M9B A;  1IYM A;  2MNZ A;  4FK5 A;  2CT2 A;  2KFT A;  2L0B A;  2BAS A;  1WT6 A;  1RF1 B;  2YKQ A;  2OYH C;  2IFM A;  2P2U A;  4GND A;  3P32 A;  3T97 A;  1HH0 A;  2MD8 C;  3KQG A;  5AW9 B;  4YAX A;  2KWO A;  1DEB A;  4UP5 A;  2M1R A;  3LID A;  1NTZ K;  3CLQ A;  3O8Z A;  2KU3 A;  4YBS A;  4I1L A;  3MUD A;  4XA4 A;  5AW4 B;  1YTZ I;  5TAB A;  2Q7C A;  3P8M C;  3T7L A;  3N7N A;  3VP9 A;  4IC2 A;  1N2D C;  3HD7 A;  2YHN A;  1G2C A;  1RE3 C;  2HYE D;  1M7L A;  4I7B A;  4W4U A;  1HUC A;  3VOP A;  5B75 A;  2HYN A;  1JY3 O;  3SOU A;  1KFN A;  1IFI A;  3N9O A;  1PFI A;  2FYZ A;  1F62 A;  1SQV K;  3I5C A;  3IHP A;  3H32 B;  2MD7 B;  2NPS C;  5APY A;  2VNF A;  5D1L B;  2LGK A;  1HGZ A;  1MZ9 A;  1GK6 A;  2XDJ A;  3RPG B;  1M1J C;  3VMY A;  1N86 A;  4I6M C;  3KDP B;  2H7H A;  2W6A A;  3GHG A;  2ECI A;  2CKL A;  1URQ D;  2CSZ A;  3N9L A;  5CCG D;  4L58 A;  1LDK C;  1V87 A;  2YYR A;  1IC2 A;  4AYC B;  4LGD E;  1WEM A;  3HCT A;  3O37 A;  1J1E C;  4B7Y C;  1GL2 D;  3VTP C;  4LLH A;  3M0A A;  3V2P A;  3M0D A;  1SQP K;  2ECW A;  3VMZ A;  3U5P A;  3L36 A;  3TNU A;  2VRS A;  1ZLL A;  2KLV A;  4GNF A;  1RY3 A;  3U5O A;  3GV4 A;  2KB7 P;  2XNX A;  1HBW A;  5CMZ A;  1SQB K;  2OYI B;  1JY2 N;  5KH3 A;  4YAB A;  4OH8 B;  3VN0 A;  1JY2 P;  2FFD B;  4A4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...