4AYCA

Rnf8 ring domain structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
136
structure length
136
Chain Sequence
LGSMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
total genus 48
structure length 136
sequence length 136
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aycA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycA02
2K16A 3N9NA 2KE1A 4KHXA 2CKLB 2YSMA 1JOCA 3B8EB 3U5MA 3L1ZB 4GKGA 4GB0A 5TRBA 4I2LC 2P7JA 3FL2A 2XU6A 5B79A 2YNYA 5J3XA 1X4IA 2YQMA 3V4WA 1BORA 5D1MB 3KQIA 4FIPA 2Q5UA 4GNGA 1HBWA 5AVZB 1OXZA 4MVTA 3M0AA 2H0DB 2LGVA 1JUNA 1S9KE 2L5UA 3NMDA 2M1RA 2ECTA 2LDRA 4X3GA 4C46A 5H9MA 1HYIA 2E6SA 2YO3A 1A02F 2PUYA 4WZ0A 3SOUA 3ZNIA 3N9QA 3HE4B 3N9PA 2L0BA 2M6MA 4C9ZA 3LIDA 4A49A 3M91A 3C5KA 5APVA 2MA6A 4FO9A 1F62A 5AVQB 1WFKA 2YYRA 3EB6A 1FOSF 4WZ2A 2KFTA 4PPEA 3V4QA 4AYCA 4Q6FA 3TNUA 4YBMA 3MHSA 2L80A 4ZQLA 2VP7A 2Y1MA 1S9KD 5G05B 2YHOA 3ZPVE 5AW6B 2CKLA 4IC3A 3NXSA 3V43A 1X4UA 5AW7B 3O34A 2WPRA 2JMIA 1WEWA 2KGIA 4C7NA 1HWTC 2R5BA 1XWHA 1FP0A 1H89A 5APXA 2OXQC 2F6NA 2ZXEB 3ZTGA 5KH7A 2WT7B 4B86C 5B78A 4A0CD 3P7KA 1DVPA 1HUCA 3O35A 2Y1NA 2VPEA 5APWA 3GV4A 3O70A 1CZQA 2K17A 2KREA 4XE5B 1Z2QA 5FB1A 3O36A 4N3WA 2FUIA 3O8ZA 1VFYA 2KGGA 2LQ6A 3L11A 2KU3A 4LK9A 1YYCA 3PUQA 4AVXA 2KWJA 2YUCA 2QJ0A 1FOSE 1LDJB 2VJFB 4JYCA 4LJNA 2AN6A 4CA1A 1WEPA 5AVTB 2ECGA 2HDPA 3HCTA 4B86A 1WEEA 2C9LY 4BBQA 4GT1A 3VMYA 2JJLA 1GU5A 2YURA 3RPGB 1K2FA 3SOXA 1JM7A 1T1HA 2E42A 3KQGA 2MD8C 2QICA 2Q7CA 2LXHC 1KQLA 2FSAA 3ASLA 1CI6B 5CMZA 2JRJA 2L43A 1CHCA 5AVVB 1WEVA 1NWQA 3VN0A 2IPPA 2K1JA 4DZOA 2LGLA 4I7CA 4JYBA 4V3KC 2Q3IA 3A3YB 1Z60A 2MA5A 2M85A 1WEQA 2VPGA 3NG2A 2VJFA 4FK5A 3L35A 3VMZA 4P5OB 4WA6A 2R32A 1V87A 3I5CA 5DINA 2G6QA 5FB0A 5KH9A 1IO4A 1GK6A 2YU4A 1VD4A 3IHPA 5DKAA 2HYED 3T7LA 4AP4A 2Z5HA 2MIQA 2KYUA 3LQJA 2MNZA 1IYMA 2RSDA 3VK6A 2CT2A 3LIEA 5H1VA 5APYA 3SHBA 4V3LC 1G25A 4YBTA 3M99A 1WESA 5FEYA 3KNVA 2JMDA 3HCSA 3O37A 2EGPA 2VPDA 4W4UA 4L58A 3PURA 1GTWA 3QZVA 5LKTA 2WT7A 4FJCA 4NN2A 2LGGA 4ZDTA 2F42A 1HYJA 1FAVA 2ZETC 5LCWB 2Z5IA 2K4DA 3HE5B 5AW1B 1X4JA 5I3LA 4BHWA 1WE9A 3LQHA 4GNEA 3TNUB 2KIZA 4B7YC 4IC2A 5LKXA 2RI7A 3DQVR 4O64A 1ZBDB 5D1KB 1RMDA 3M62A 2YREA 2YHNA 5LKUA 1T2KD 1A02J 2F6JA 4GNFA 5APQA 1N87A 1WEUA 4GNDA 2H7HA 5JG6A 3KV6A 5G04B 3U5PA 1MUUA 3M9HA 1WIMA 5LKZA 5TDWA 2VNFA 1X8YA 1WILA 1GU4A 2QM8A 3M06A 5AW8B 3LRQA 3ZYQA 5AW5B 4PTBA 2CSZA 3SOWA 4LADB 2ECWA 2P67A 4N4FA 3T6RA 3V5BA 2WPSA 5D1LB 5AW9B 3O33A 5G0FA 2YQLA 4R8PK 3U5NA 3VTPC 2YW8A 1SLQA 1WENA 3LQIA 5B8DA 5AVRB 3NTNA 1NAFA 1OWAA 1J2JB 1HJBA 2ECVA 5AVXB 3I2DA 2KWNA 4F52B 2UZGA 2Y43A 5EYAF 4AUQB 2XB1A 2VJEB 1CI6A 1GD2E 5AIUA 5AW3B 1VYXA 5H1TA 2C9NY 2I50A 5B76A 2ECJA 1JNMA 3RPGC 5C13A 4I6MC 4AUWA 4R7EA 1MM2A 4M3LA 2QIZA 1JM7B 3HE5A 3M0DA 4LC1A 5AW0B 3SWFA 5AVUB 4ZUXU 4HYTB 4QF3A 3PHDA 1H88A 3ZVZB 2YO2A 2R3CA 4UP5A 1G2CB 2XZRA 5APUA 4AYCB 5H1UA 1H8AA 4S3OB 3EB5A 1T2KC 2DX8A 4YBSA 2MNYA 2XV5A 2BASA 3TYYA 2M3HA 2KWKA 3VMXA 2KWOA 5APSA 1SP4A 2VRSA 1U6GB 3A7OA 2LN0A 5APTA 3RTRB 4A4CA 2EODA 4WZ3B 4RESB 3A5TA 2JMJA 5KH3A 3T97A 3HCUA 4XI1A 4CCGX 1MFZA 3L36A 5TDRA 2KP8A 4R2YA 4I7DA 1MM3A 3P32A 2R5DA 5AW4B 4C7NB 5B75A 4AQRD 2VJEA 4I7BA 3ZVYA 2ZFCA 2ECIA 5AVWB 3L37A 2W6AA 3C6WA 3TK1A 3N9OA 2WPQA 1MV8A 4S3OC 5B77A 1Z6UA 3P8MC 2XEUA 3HTKC 2PNXA 1FBVA 3N9MA 2MUMA 3OAKA 2C2LA 4MSXA 2BAYA 3HE4A 4YABA 3DPLR 4YC9A 3O7AA 1GK4A 5AITA 5TBNA 2G45A 2IDAA 3M63A 3L1XA 2KR4A 2WWWA 4YADA 5C11A 3IR9A 2E6RA 1WEMA 4YAXA 4UP0A 2N9BA 2YT5A 3VYIA 2MT5A 3MD0A 3HTKA 1WGMA 3UIAA 4QF2A 4LLBA 4L7XA 2LXPC 1GZLA 3KDPB 5AVYB 2LGKA 2ECNA 2MD7B 1E4UA 2H0DA 4LKAA 4A4BA 2CSYA 2G43A 2YSJA 2D8SA 3MHHA 2FUUA 3GL6A 3ZPV1 3M9BA 2NAAA 2LRIC 3A2AA 3KV5A 3MGNA 2P2UA 4TKPB 3NFQA 2C2VS 2EA6A 2L75A 5AW2B 3N9LA 1WEOA 4UI9B 4YATA 1CSBA 2W27A 5AVSB 2QM7A 2WTYA 1DH3A 1LDKC 5FERA 2VPBA 2LV9A 5TABA 4EOTA 3U5OA 2E43A
chains in the Genus database with same CATH superfamily
2K16A 3P8CD 2KS1B 3U5MA 1LTJB 3B8EB 2QJPB 2IFNA 2XKMA 4I2LC 5GTIH 2YQMA 1SQQJ 2Q5UA 4D6TD 2H0DB 1JUNA 3Q2YA 1EZVE 2WSCH 5GTHE 1SFCA 4ZKUA 2B87B 5H9MA 1PGJA 1FZCB 1N73A 3ZNIA 2G3AA 1BE3G 3AE4C 2L0BA 2M6MA 3H1JD 2ITAA 1U7MA 2ZXXA 3CXHI 4JPZB 3V2RA 2MA6A 1NTKJ 5KAIH 1SQBG 1F62A 1PGOA 4Y99B 1WFKA 2YYRA 1MFTA 2O1KA 3GMAA 4Q6FA 3MUDC 4ZQLA 1OW8A 3ZPVE 1U7JA 5AW6B 1YTZT 1ZP0C 3NXSA 1X4UA 3D71A 2JMIA 1SFCB 1SFCC 2E5TA 2KGIA 4L74A 2D8UA 4D6TJ 1HVVA 2R5BA 5DJUB 1ZRTE 4O9BA 5APXA 2OXQC 2ZXEB 4BRYB 4B86C 1DVPA 3O35A 2Y1NA 1SQBJ 1H0TB 3RBZA 2BEQD 2BCCD 2K17A 2KREA 1RF1A 1Z2QA 3DWDA 2WMMA 2FUIA 1EXJA 2KGGA 3I56P 2FYZA 2QJ0A 3USSA 4ZNCA 2HG5D 3D6YA 1BDCA 1WEPA 4F1PA 5KLVG 3HCTA 1HGVA 2GUSA 4GT1A 1P84I 1UIIA 2YURA 2RMZA 5B5EH 2FFDC 2WVRA 5L8RJ 1K2FA 3SOXA 1VF5B 1IJDB 1OX3A 4NPFX 1NKNA 3MTUE 2QICA 2E76C 3L70J 1FZGA 3G9RA 1S5LX 1X0TA 2B87A 2IDBA 5M1BA 4BRYA 5BVZA 1QGKB 4PV1D 1J1EB 1IK9A 4O62A 1J1EC 1PIXA 2FYNC 3H1IE 3H1KE 1RE4C 1OVVA 3FXDA 3VOPA 3L35A 2YKPA 3VMZA 2CRWA 3G3ZA 4P5OB 4WA6A 4N6JA 1LTJA 5DINA 1SQVK 2K88A 2YU4A 1X9VA 2BEZF 1OIPA 3LQJA 1YQ3C 1IYMA 2BCCE 2RSDA 3VK6A 3SHBA 4V3LC 1NTME 4W7ZA 1P84H 1AA0A 1JCCA 3O37A 2WITA 2EGPA 2OYHA 2VPDA 4L58A 3KXDA 2IYPA 3PURA 1L4AB 4FJCA 5H2FH 2V7QH 3FM8C 1N73C 1FAVA 3RL0D 5LCWB 3HE5B 1E79H 1IFDA 2E61A 2ZAEB 1ZR2A 1WE9A 2CRRA 1G2CA 2FYUK 5LKXA 2RI7A 5C39A 3KZIE 1S3JA 4OWFA 1JB0J 4WY4A 2YREA 5LKUA 1IZNB 3RL0B 1N87A 2FXPA 4H0LC 5G04B 1MUUA 5TDWA 1KYOI 3M06A 3R2PA 4PTBA 4EIJA 1IFMA 3VP8A 1BCCE 2IZ1A 1PL5A 1AQ5A 1AJYA 1R5LA 3CX5E 5KAIE 4N3YB 1S72P 2WPSA 1VDFA 2PFXA 1VPCA 3CWBJ 2WSEH 4PD4I 2MKVA 3BCCD 3LQIA 4UB8E 3H7HA 3TDKA 1LTJC 3NTNA 2YVRA 2O01N 5AVXB 2KWNA 1YJNP 3EWKA 1N7LA 5EYAF 1FBMA 4AUQB 1NU1E 1FE6A 1VYXA 3Q5SA 3E1IA 4I7ZB 1YITP 5C13A 1M8OB 4M3LA 2OYHC 3L75E 2OYHB 3KPEA 1Q90D 2NZ2A 4YXDC 1SQPE 1T6AA 1GL2C 1NTZD 1BGYD 1XTGB 2OARA 2E74B 4DCKA 1SVFA 5CJ4A 5TISE 3C9IA 4UP5A 2D2CC 1LWUC 2OGUA 4ZKPA 1KFNA 2DX8A 2BASA 2M3HA 3VMXA 1NHLA 2KWOA 1YIJP 3CCLP 1U6GB 5APTA 1FS0E 4OGQC 2AEJA 4A4CA 1AVOA 2YIUB 3V2PA 5KH3A 4CCGX 4U3FE 2KP8A 3B5NA 3P32A 4AQRD 3QH9A 3ZVYA 3BASA 3GHGC 2NPSD 3A0BH 1SQVE 1K05A 1YQ4C 3AEFC 5B77A 1BCCJ 1Z6UA 3P8MC 4RO0A 3S4RA 2ZYAA 3HTKC 1SFCD 3Q3DA 4H13C 1DEBA 3FANA 2E76D 4W7YA 2BAYA 1URQB 1VQLP 2RN0A 2AXCA 2XOYA 3FJUB 1SQPG 4D6TG 3IR9A 2C0XA 3VYIA 2MT5A 3O6QA 2GUVA 3HTKA 4QF2A 5CCHC 2LXPC 1XTCC 2D2CB 3KDPB 3V2NA 2M5AB 5AVYB 2R44A 1MKMA 2FYUD 2H0DA 3KYQA 3W67A 3E7KA 2Y0CA 1KYOD 1NU1G 3L75J 3MHHA 2FUUA 3ZPV1 3A2AA 5E79H 4IOIH 2J59M 1YI2P 2O01J 1PV3A 2OTLP 2QE7H 2EA6A 3N9LA 3QWOC 4YATA 1CSBA 2W27A 5AVSB 2QM7A 2N1TD 5FERA 2VPBA 2JDIH 2FYUJ 1W5CE 1IC2A 3L74G 3N9NA 2W90A 2L91A 2CKLB 4GKGA 5TRBA 1J1DB 3FL2A 2P7JA 2R3SA 3RK2C 2H8PD 2HPCA 3RK2B 3V4WA 1BORA 1LWUB 3G4SP 2FFDA 3AE1C 4GNGA 3H1LD 1HBWA 1LT9B 3M0AA 1URQD 2L5UA 2M1RA 2ECTA 4D6TE 4PJ0E 3CCRP 2E6SA 3MDBC 2YO3A 2PUYA 1DEEG 3SOUA 1NTMJ 4JF7A 1URQA 3LIDA 3N7NA 4ZMDA 3LDYA 3M91A 3C5KA 5APVA 1NVOA 3GG2A 2QEXP 1FOSF 2KFTA 4YBMA 4AYCA 1VQ7P 3H1HJ 1L0NK 1DCQA 1T3UA 2Y1MA 3L70D 2RKLA 2YHOA 2C0WA 1NJIQ 3V43A 1L0LD 2KB7P 5CCHA 1YHQP 3C1LA 1EXIA 4R4MA 1LWUA 1WEWA 2PAJA 3BATA 4ASVA 3MUDA 1LJ2A 1BGYG 1FP0A 5SVXA 2FBWC 2E74D 2WT7B 2K9JB 3H1HD 3CLQA 3HD7A 1GL2B 2AEMA 3F89A 1NTMD 5KLVJ 2VPEA 5APWA 3GV4A 2E74C 4DOJA 3O70A 3LJUX 5FB1A 1L0LJ 3O36A 4N3WA 4LK9A 2MKEA 3E1RA 1PGQA 4AVXA 2KWJA 5GTHH 2ZYDA 1EDIA 2YMKA 3CCJP 1L0NE 2KSEA 3CWBE 3IAOA 3A0BE 3H1KJ 2FYUE 4Z0RA 4CA1A 1SQXK 4OGCA 1T3JA 2JJLA 1GU5A 3H1KD 3AEEC 1S5LH 3O6QB 2FKWB 1JY3O 2E42A 2YMYA 5KAFH 3PH0A 4PD4E 2BCCJ 4L76A 1WEVA 2I8DA 3FEHA 1KILE 2HODA 3AE7C 3TGUE 3H1HG 1M1JC 1S2EA 4JYBA 4C7RA 4V3KC 1D7MA 1JMMA 2M85A 3MIWA 1WEQA 1S4XA 4EDFA 1L4AC 1IK7A 2LXCB 2R32A 3DDTA 3I5CA 1DD3A 1Y9BA 4RKUJ 2G6QA 1IO4A 3HUSA 3TF5A 3L75G 1SQVG 1MZ9A 3AE6C 5DKAA 2MIQA 2KYUA 2MNZA 2O3JA 5H1VA 5APYA 2WSCJ 3RL0C 4YBTA 3M99A 1ZN5A 1WESA 2OTKE 1HGZA 3L71E 4R4LA 3GF3A 4U3FJ 3HCSA 1L4AD 3RK3E 4W4UA 1GTWA 1R8EA 3PHLA 3QZVA 1W2EA 5KLIC 3M0DC 2F42A 2Z5IA 1K04A 1X4JA 2Y9YA 5DJTB 1L0LE 2V4HA 2JR8A 1DX7A 2FY8A 1LTAC 1Z56A 1BE3E 4H44D 1HTLC 2JWAA 2PGDA 3AE2C 5KLVK 2YHNA 3GW6A 4MN4C 1T2KD 3L73J 4LLHA 3CL3D 3AECC 1JY2O 1NTZE 3EFFK 2H7HA 3B4SA 5JG6A 1NU1J 3L72D 2VNFA 1X8YA 1GU4A 2FYNB 1VQ6P 5AW5B 4PV1B 2IQJA 2IBZD 4LADB 4OGQD 2P67A 4N4FA 2HFED 3V5BA 5D1LB 3Q5PA 1M57D 3VTPC 1JY3N 1SQPJ 1SLQA 1WENA 2CONA 2JO1A 5B8DA 5AVRB 2J58A 1KD1Q 1HJBA 2ECVA 2QSIA 1KTMA 3I2DA 4H13B 2QJKB 2M0BA 3L73D 2VJEB 2MJZA 1W2BO 2W8ZA 5AW3B 1FDMA 2KXPB 2C9NY 2I50A 1NH4A 5B76A 1SQBK 2QIZA 2JM3A 2A45H 3L71J 3CI9A 3L72E 3WU2E 1HH0A 3O47A 1JY3P 5AW0B 1AV1A 4ZUXU 4HYTB 2CSVA 1RF1B 1SQVJ 1SQPD 2L7PA 3PTZA 1LNQA 3GLMA 5APUA 4H0LB 4S3OB 2JEEA 1GW4A 4YBSA 1BE3J 2YXRB 4WY4D 1SP4A 2VRSA 3A7OA 2NRGA 3L73E 4RESB 2JMJA 3T97A 4R2YA 3CXHD 5B75A 4BWNA 2IBZE 3AE9C 3VMAA 3P8CE 3AEBC 3SWKA 2ZFCA 2P58A 2HODB 3C6WA 1YJ9P 4GODA 2XEUA 4U3FD 2PNXA 2V7QJ 2MUMA 4TT3H 3TGUD 3OAKA 2KLUA 5SVIA 4YABA 2Q3EA 3BCCJ 1N73B 4YC9A 3O7AA 3M9QA 5SVYA 1AFOA 5KJ7A 2A45G 3OJAB 2Q6QA 3ITKA 2G45A 2OYOA 2YKOA 1YJWP 3M63A 1EZVD 5C11A 3RL0g 4UB8H 3H1LG 4U7JA 1WEMA 4YAXA 2KK7A 4UP0A 3ABVC 4Y28J 2YT5A 1NTKE 1VQKP 3MD0A 4GIFA 3RGUA 1PP9D 2ECNA 1M1KQ 1E4UA 1PFIA 2UWJE 2E75D 2G8YA 1KB9H 1CW5A 1OFCX 2D8SA 1M1JB 2HYNA 2H88C 1M1JA 3M9BA 4KJMA 3A0HE 2P2UA 3PLNA 4WB4A 3NFQA 2C2VS 1GL2A 3HRNA 5AW2B 4UI9B 5BU5A 2E5YA 3B5ND 1N7SA 1UIXA 3LVQE 3T9KA 3I55P 1JTHB 2K37A 2PRRA 2YSMA 3PLWA 1JOCA 4W80A 4GB0A 2XU6A 1EZVG 5B79A 2JUNA 3S9OA 2B88A 4L75A 5KLVD 4GOFA 3CCSP 3HTKB 4FIPA 4MVTA 2KNCA 3FWLA 2LGVA 3NMDA 5KKZB 5CCGD 1PP9E 2JP3A 1BDDA 4WZ0A 4XA4A 1ZXGA 1FZCC 4C9ZA 1WRGA 1FJPA 5CCHD 3AEAC 4FO9A 1RQVA 1KB9I 1J1DC 5AVQB 1Q81Q 2B9BA 3V4QA 3RK3D 2IZ0A 3MHSA 3SWYA 1RE3C 2L80A 1DD4A 1S9KD 1X79B 3MP7B 5G05B 1KV4A 2CKLA 1NO4A 3II6A 1TU3F 1L0NG 5AW7B 3O34A 1FDOA 2WPRA 2A06E 2CK3H 1S5LE 1NKZB 1QX8A 4C7NA 2XP0A 4WVZA 1NTZJ 4A0CD 3P7KA 3SSUA 3C8VA 4XE5B 1SQQK 1SQXJ 3H32B 3O8ZA 2KLVA 2LQ6A 2KU3A 2KKYA 1QL1A 3BRTB 1N7SC 2N1TA 3RK3B 3L75D 1NTZG 1KFMA 2VJFB 4JYCA 3BRVB 4LJNA 1ZRTD 1LT9C 1AQTA 1GL2D 5AVTB 2ECGA 2I1JA 2HDPA 1SQBD 2P1JA 1K8AQ 1EZVI 3VMYA 2AXTE 2YXQB 1T8ZA 1N7SD 2N1TC 2ZT9C 3H1IG 1JMBA 1JM7A 2WSFH 2ZT9B 1T1HA 2MD8C 1KILC 3Q1MA 1LTSC 2Q7CA 4YPCA 1KILB 1JO5A 2FSAA 1YTZI 3ASLA 1CI6B 2QJPC 1PP9J 2Q1KA 2L43A 1CHCA 1NWQA 3VN0A 2IPPA 2K1JA 1RF1C 5KJ7D 4DZOA 2LGLA 2KNCB 1FZEA 1Z60A 2YKQA 1LTTC 2VPGA 4UB6H 5SVIB 3FXEA 3NG2A 2H89C 3E2DA 2A06G 3CMEP 1VQOP 5BU8B 5FB0A 1JTHA 3CXHE 5KH9A 3U1CA 3CCVP 1PPJG 4YXWH 1VD4A 2IYOA 2HPCB 3AE5C 3IHPA 4H9DA 1BCCD 1KILA 2HYED 3T7LA 4WWIA 2CPSA 2Z5HA 3LW5J 3RK3C 1RH5B 1USEA 2Z4EA 1VL2A 1ZMEC 2IFMA 2QJYC 3SFEC 2JMDA 3HD7D 1OVUA 1K9MQ 3WUUA 5LKTA 5GTIE 4NN2A 4ZDTA 1HYJA 1RY3A 2Q9IA 2K4DA 5I3LA 4BHWA 1H0TA 5CCGC 2P57A 4GNEA 3EFGA 3TNUB 2KIZA 1KYOE 4B7YC 3L70E 3BCCE 4O64A 1ZBDB 1RMDA 3WUTA 3M62A 2HR3A 1SS1A 3CX5I 1NOHA 2F6JA 3JC22 1WEUA 2D2CD 1NTKK 3CWBD 2Y0EA 3KV6A 5KLIB 4HKZH 1WIMA 5LKZA 1SQVD 3CX5H 3HD7B 1LP1A 4N78D 5AW8B 1P84D 3ZYQA 1HJ0A 2CSZA 1VQMP 1LTGC 2EXUA 1PGPA 4IFFA 4IFDK 1NAYA 1EQ7A 2YQLA 2ZYGA 3IF4A 2YW8A 4OH8B 2XNXA 4U3FG 2JWDA 3CC4P 4H0LD 3SUBA 1J2JB 1L2PA 2N9YB 3GHGB 1VQ4P 1NU1K 3FGAD 3H25A 2XB1A 1IFNA 4HB1A 1CI6A 1Y47A 3CC2P 5AIUA 3JCUE 2LR2A 2OYIC 1R5SA 1SQXD 3H1LJ 1S1CX 2ECJA 1JNMA 2M3EA 3RPGC 2K1AA 5CBOA 4R7EA 4PD4D 1MM2A 2DJAA 1JM7B 3HE5A 4LC1A 2FD4A 1KQGB 3TGUG 3MZWB 2ZVOB 1QVGO 3SWFA 2QRXA 5AVUB 1FC2C 3AE3C 1ZLLA 4QF3A 4Y99C 1N7SB 2IBZG 1Q2NA 2R3CA 2XZRA 2QA4P 4LGDE 3CMAP 2QJKC 5H1UA 3G71P 5APSA 4I1LA 2E75C 2ZVNB 3CC7P 2YIUC 2FYUG 2EODA 4WZ3B 4OGQB 2XNDH 3HCUA 4XI1A 1MFZA 4I7DA 2R5DA 4C7NB 2PP6A 4I7BA 1M90Q 1KB9E 2CPBA 2KZJA 2H43A 2ZJSE 2W6AA 1SQXG 3TK1A 2DSMA 2WPQA 1EDJA 1OMIA 4S3OC 2A06D 2KI7B 3G6EP 3H1JJ 3N9MA 5TJHA 5KKZC 1URQC 2C2LA 4I7ZC 3HE4A 1PPJD 1BGYE 4GOEA 1OVRA 4H44B 3DPLR 4IL6X 1GK4A 3WU2H 1N8RQ 5TBNA 1SQXE 3JSVC 3L1XA 2WWWA 4YADA 1RF0C 3CPWO 2WQYC 2JKVA 3D70A 3UIAA 4LLBA 4L7XA 2WSFJ 1MBMA 1KQSO 2LGKA 3H1HE 3SFDC 3R4YA 1RE4A 4LKAA 1K73Q 1BCCG 2CSYA 2G43A 1QL2A 4WY4C 2RH0A 3GL6A 1OZHA 1JCDA 3KV5A 4XFJA 2XOZA 3MGNA 3CCUP 1LTIC 3L70G 2L75A 4Z1MH 1FU1A 1NTMG 1VQPP 3EQ2A 3KZIH 4WBAA 2BCCG 5CBNA 5TABA 2IX7C 3U5OA 5G0FA 3RBXA 3PP5A 2GA1A 2KE1A 1RE3A 4KHXA 3L1ZB 1WT6A 1IFJA 2YNYA 1FZFA 1X4IA 1PZQA 5J3XA 3W68A 5D1MB 1Q86Q 3KQIA 4H44C 4HH2A 1NTKG 3AEDC 5AVZB 1OXZA 4OVNF 1S9KE 3S1KA 2LDRA 4X3GA 2E75B 2W6JH 4C46A 1HYIA 3BCCG 1A02F 3CCQP 1E5WA 3N9QA 3B71A 3HE4B 3N9PA 2OYIA 4A49A 4RJTA 1GDTA 1EDLA 3H1JE 1M7LA 1NTMK 3EB6A 4WZ2A 1KORA 4PPEA 3TNUA 1ZR4A 1N86A 3TSIA 2VP7A 5KJ7C 3A0HH 3TGUJ 3WMM0 4IC3A 2K3RA 1PP9G 5CHXA 3Q1DA 3L74D 2KZIA 1VF5D 2P10A 1NU1D 1HWTC 1L4AA 1M56D 1QEXA 2FFDB 3L74J 1XWHA 1FJKA 4IL6H 1H89A 2M8RA 2F6NA 1NYHA 3ZTGA 5KH7A 4NPEA 5B78A 1HUCA 1SQPK 1RHZB 3H6PA 1SQQD 2LKMA 1GMJA 3VP9A 1CZQA 2OTJP 3IFMA 1FDIA 2M3BA 3CD6P 1JEKA 3L11A 1VFYA 4Z0OA 1YYCA 3PUQA 1U57A 1BE3D 4N78E 1KMIZ 2YUCA 3M7KA 4WY4B 1FOSE 1LDJB 2POHA 2AN6A 4B86A 2KUBA 3HUSB 1WEEA 2C9LY 4BBQA 3HUSC 1NTKD 3RPGB 5H2FE 1X22A 3KQGA 2OWAA 1KC8Q 4OGEA 2LXHC 1KQLA 4K35A 5EFWB 5CMZA 2JRJA 3H1LE 2KSJA 1EC5A 5AVVB 3AE8C 3RK2D 5K5GB 1LT9A 4I7CA 1KQFB 4PJ0H 2W6BA 1KN7A 2QJYB 2Q3IA 3A3YB 2MA5A 3K5BA 3L71D 1SQQG 4H13D 2VJFA 4FK5A 1G1JA 2N1TB 3KHUA 2DW3A 1V87A 1WMKA 3AEGC 4NPDA 3H32A 2WZ7A 1GK6A 3OA7A 4KT0J 1BSHA 2AXTH 4JQ0D 2WSSH 5KLVE 1Q82Q 4AP4A 2KS1A 2NPSA 1KZUB 2CT2A 3H1KG 3LIEA 1G25A 4DT0A 5FEYA 3H1ID 1L0NJ 1G1IA 5B66E 3KNVA 2KYVA 3D6ZA 2RR4A 3PJSK 4CPGA 5TISH 1HF9A 3H1IJ 2WT7A 1N2DC 2B0OE 2LGGA 2FXOA 2KIKA 2ZETC 4TLFA 5AW1B 2GM4A 2FFWA 3LQHA 3JUEA 4EYYQ 3U1AA 1VF5C 4IC2A 3L72J 3CCMP 1USDA 2E76B 1BGYJ 3DQVR 3FX0A 5D1KB 4QMAA 3MHVA 2J5UA 1LT1A 3L71G 1A02J 4A7PA 2XDJA 4GNFA 1EDKA 5APQA 3CX5D 4GNDA 2NPSB 4BXLA 5CJ0A 4YTPC 3U5PA 3M9HA 1ZW0A 1P84E 1WILA 1SQBE 2QM8A 3LRQA 3BVHA 3SOWA 1QVFO 5KAFE 2ECWA 2M5AA 3T6RA 2O01H 5AW9B 3O33A 4R8PK 1FZAA 3U5NA 1KILD 4HJGH 4IL6E 1KYOH 2ZT9D 4GDOA 1L0LG 1FZBA 3H1JG 1NAFA 3LVRE 1OWAA 2A45I 4DJGA 2W83C 4UB6E 4F52B 2UZGA 2Y43A 1VQ8P 4QQ4A 3HD7C 1JY2N 2QG4A 3T97B 1GD2E 1L0LK 3PRJA 5H1TA 2M13A 1ZV8A 1JM0A 4I6MC 2O1JA 3V6IA 4AUWA 4PD4H 1PPJE 2SPZA 3L4FA 1L0ND 1VQ5P 3M0DA 5KTBA 3CWBG 1LGHB 3F5HA 3PHDA 2NPSC 1H88A 3ZVZB 2YO2A 1G2CB 3IN6A 4AYCB 1H8AA 3EB5A 2HLOA 2QVAA 1T2KC 1YBKA 2FXMA 4PV1C 3U59A 1JY2P 2KWKA 2XV5A 3TYYA 2OQQA 2MNYA 1BSNA 4EI2A 3N4XA 4ASWA 2LN0A 2KOGA 3RTRB 1SQQE 5K3QA 3L72G 1AVYA 1VQ9P 3A5TA 2K9JA 3L36A 5TDRA 3LW5H 3FAOA 2K9YA 1MM3A 4L73A 2L5GB 5AW4B 3L73G 2VJEA 1KB9D 3Q5RA 2ECIA 1RF0A 5AVWB 3L37A 1FZCA 3L74E 2AEFA 3N9OA 1MV8A 2EGMA 2Y0DA 5E79E 1OW7A 1NTZK 1FBVA 1LP1B 3GF7A 1GW3A 3OW2O 2I1KA 4MSXA 3ZDMA 2KKXA 1NGMB 5B66H 5AITA 2IBZI 2OYIB 1Y8AA 2IDAA 2KR4A 1LTBC 3GHGA 2E6RA 2LXBA 2N9BA 5CCGA 3CXHH 3KDEC 5B5EE 1IFPA 3B5NC 3FWNA 1WGMA 4K3AA 3B5NB 1GZLA 2WPVB 2MD7B 1DIPA 3WUVA 3JCUH 4A4BA 1ZOYC 2YSJA 1VQNP 2Y9ZA 1RQUA 4IFMA 1QLED 2NAAA 2LRIC 4TKPB 1Q7YQ 2LAUA 4JBZA 1IFIA 2B89A 2WSEJ 3V2QA 1WEOA 1OW6A 2XOCA 2QIWA 2WTYA 1DH3A 1LDKC 3CCEP 2LV9A 4EOTA 2E43A
chains in the Genus database with same CATH topology
2K16A 3N9NA 3PP5A 3P8CD 2KE1A 1RE3A 4KHXA 2CKLB 1LTJB 1JOCA 3B8EB 2YSMA 3U5MA 2IFNA 3L1ZB 4GKGA 4W80A 4GB0A 1WT6A 2XKMA 1J1DB 4I2LC 2P7JA 3FL2A 2XU6A 5TRBA 3RK2C 5B79A 2H8PD 1IFJA 2YNYA 1FZFA 2HPCA 1X4IA 5J3XA 2YQMA 3RK2B 3V4WA 1BORA 5D1MB 3KQIA 1LWUB 2FFDA 3HTKB 2Q5UA 4HH2A 4FIPA 4GNGA 1HBWA 5AVZB 1OXZA 4MVTA 1LT9B 3M0AA 2H0DB 2LGVA 1URQD 1S9KE 1JUNA 2WSCH 2L5UA 3NMDA 2M1RA 5CCGD 1SFCA 2ECTA 2LDRA 4X3GA 4ZKUA 4C46A 5H9MA 1HYIA 2E6SA 2YO3A 1FZCB 1N73A 1A02F 2PUYA 4WZ0A 3SOUA 3ZNIA 1E5WA 4XA4A 4JF7A 3N9QA 1URQA 3HE4B 1FZCC 3N9PA 2OYIA 2L0BA 2M6MA 4C9ZA 1WRGA 3LIDA 1FJPA 3N7NA 4A49A 1GDTA 5CCHD 3V2RA 3M91A 3C5KA 5APVA 2MA6A 4FO9A 1F62A 1M7LA 1J1DC 1NTMK 4Y99B 5AVQB 1WFKA 2YYRA 3EB6A 2O1KA 1FOSF 4WZ2A 2KFTA 4PPEA 3V4QA 4AYCA 4Q6FA 3RK3D 3TNUA 4YBMA 1ZR4A 1L0NK 3MHSA 3SWYA 1RE3C 1N86A 2L80A 3TSIA 4ZQLA 2VP7A 1T3UA 5KJ7C 2Y1MA 1S9KD 1X79B 5G05B 2YHOA 3ZPVE 5AW6B 1YTZT 3WMM0 2C0WA 2CKLA 4IC3A 1NO4A 3NXSA 3V43A 3II6A 5CHXA 2KB7P 5CCHA 1X4UA 5AW7B 3O34A 2WPRA 1SFCB 2JMIA 1LWUA 1WEWA 2PAJA 1SFCC 2KGIA 1NKZB 3BATA 3MUDA 4C7NA 1L4AA 1HWTC 1HVVA 2FFDB 2R5BA 1XWHA 4O9BA 1FJKA 5APXA 1H89A 2M8RA 1FP0A 2F6NA 2ZXEB 2OXQC 3ZTGA 5KH7A 2WT7B 4B86C 5B78A 3CLQA 3HD7A 4A0CD 1GL2B 3P7KA 1DVPA 1HUCA 1SQPK 3H6PA 3O35A 2Y1NA 2VPEA 5APWA 2LKMA 3GV4A 3VP9A 4DOJA 1CZQA 3O70A 2K17A 2KREA 3IFMA 4XE5B 1RF1A 1Z2QA 5FB1A 2M3BA 1SQQK 3O36A 4N3WA 2FUIA 3H32B 3O8ZA 2KLVA 1VFYA 2KGGA 2KU3A 2LQ6A 1YYCA 3L11A 4LK9A 3PUQA 1QL1A 4AVXA 3BRTB 1N7SC 4N78E 2KWJA 2FYZA 2YUCA 2QJ0A 2N1TA 4WY4B 3RK3B 1FOSE 1LDJB 1KFMA 2VJFB 4JYCA 2POHA 2HG5D 3BRVB 4LJNA 1LT9C 2AN6A 4CA1A 1SQXK 1WEPA 1GL2D 5AVTB 2ECGA 2I1JA 2HDPA 3HCTA 1T3JA 4B86A 2P1JA 3HUSB 1HGVA 2GUSA 4GT1A 3VMYA 2JJLA 1GU5A 2C9LY 1WEEA 4BBQA 3HUSC 2YURA 2FFDC 1T8ZA 1N7SD 3RPGB 2N1TC 1K2FA 3SOXA 1JM7A 2WSFH 1IJDB 2FKWB 1T1HA 1JY3O 1NKNA 3KQGA 2E42A 1KILC 2MD8C 3MTUE 2QICA 1LTSC 2YMYA 2Q7CA 1FZGA 2LXHC 1KILB 1JO5A 1KQLA 2FSAA 1YTZI 3ASLA 1CI6B 5CMZA 2JRJA 5BVZA 2L43A 1CHCA 2KSJA 5AVVB 1WEVA 1NWQA 3VN0A 2IPPA 3RK2D 2K1JA 1RF1C 5KJ7D 4DZOA 2HODA 2LGLA 1LT9A 1J1EB 1IK9A 1FZEA 4I7CA 1M1JC 4JYBA 1J1EC 2W6BA 4C7RA 2Q3IA 4V3KC 3A3YB 1Z60A 2MA5A 1JMMA 2YKQA 1LTTC 2M85A 1RE4C 3MIWA 1WEQA 2VPGA 3VOPA 3NG2A 2VJFA 4FK5A 3L35A 2YKPA 1G1JA 2N1TB 3VMZA 1L4AC 3G3ZA 4P5OB 4WA6A 4N6JA 2R32A 5BU8B 1V87A 3I5CA 1LTJA 5DINA 1JTHA 2G6QA 5FB0A 1SQVK 5KH9A 1IO4A 3HUSA 3H32A 3U1CA 2WZ7A 1GK6A 3OA7A 2YU4A 1VD4A 1X9VA 2HPCB 1MZ9A 3IHPA 5DKAA 1KILA 2HYED 3T7LA 4AP4A 2CPSA 2Z5HA 2MIQA 2KYUA 3LQJA 2NPSA 1KZUB 2MNZA 2RSDA 1IYMA 3RK3C 3VK6A 2CT2A 3LIEA 5H1VA 5APYA 3SHBA 3RL0C 4V3LC 4YBTA 1G25A 2Z4EA 1ZN5A 3M99A 1WESA 1HGZA 4W7ZA 2IFMA 5FEYA 1G1IA 3KNVA 2KYVA 2JMDA 3HD7D 1JCCA 3HCSA 3O37A 2WITA 2EGPA 1L4AD 2OYHA 2VPDA 4L58A 4W4UA 3PURA 1GTWA 3QZVA 1L4AB 1W2EA 5LKTA 2WT7A 1N2DC 3M0DC 4FJCA 4NN2A 2LGGA 4ZDTA 1N73C 2F42A 1FAVA 1HYJA 3RL0D 2ZETC 1RY3A 2Z5IA 2Q9IA 5LCWB 2K4DA 3HE5B 5AW1B 1X4JA 2GM4A 5I3LA 1IFDA 4BHWA 5CCGC 1ZR2A 1WE9A 3LQHA 1G2CA 4GNEA 3EFGA 3TNUB 2KIZA 1DX7A 3U1AA 4B7YC 4IC2A 1LTAC 1Z56A 2FYUK 5LKXA 2RI7A 1HTLC 3DQVR 4O64A 1ZBDB 5D1KB 4WY4A 1RMDA 3M62A 2YREA 5KLVK 2YHNA 5LKUA 1T2KD 1A02J 1NOHA 4LLHA 3RL0B 2F6JA 3CL3D 2XDJA 4GNFA 5APQA 1N87A 1WEUA 1JY2O 4GNDA 2H7HA 2NPSB 1NTKK 5CJ0A 5JG6A 3KV6A 5G04B 3U5PA 1MUUA 3M9HA 1WIMA 5LKZA 5TDWA 2VNFA 1X8YA 1WILA 1GU4A 2QM8A 3M06A 3HD7B 4N78D 5AW8B 3LRQA 3ZYQA 3BVHA 5AW5B 3R2PA 4PTBA 2CSZA 4EIJA 3SOWA 1IFMA 3VP8A 1LTGC 4LADB 2ECWA 1AQ5A 2P67A 4IFFA 4N4FA 4IFDK 2HFED 4N3YB 3T6RA 2O01H 1EQ7A 3V5BA 2WPSA 5D1LB 1VDFA 5AW9B 3O33A 5G0FA 1VPCA 2YQLA 4R8PK 1FZAA 2WSEH 3U5NA 1KILD 3VTPC 1JY3N 2YW8A 1SLQA 1WENA 4OH8B 3LQIA 5B8DA 2XNXA 5AVRB 1LTJC 2J58A 3NTNA 1FZBA 1NAFA 1J2JB 1OWAA 1HJBA 2ECVA 2A45I 5AVXB 3I2DA 2KWNA 3GHGB 4F52B 2UZGA 2Y43A 1NU1K 1N7LA 5EYAF 1FBMA 3HD7C 4AUQB 2XB1A 1IFNA 2VJEB 2MJZA 1CI6A 1JY2N 1GD2E 1L0LK 5AIUA 5AW3B 1VYXA 5H1TA 2OYIC 1FDMA 2C9NY 2I50A 1NH4A 5B76A 3E1IA 1SQBK 2ECJA 1JNMA 1ZV8A 3RPGC 5C13A 4I6MC 2O1JA 4AUWA 4R7EA 1MM2A 4M3LA 2QIZA 3L4FA 2OYHC 2A45H 1JM7B 3HE5A 3CI9A 2OYHB 3M0DA 4LC1A 1HH0A 5KTBA 3KPEA 1JY3P 5AW0B 1LGHB 3SWFA 5AVUB 1GL2C 4ZUXU 4HYTB 1XTGB 1ZLLA 4QF3A 2OARA 3PHDA 4Y99C 2NPSC 1N7SB 1H88A 3ZVZB 2YO2A 1RF1B 1SVFA 5CJ4A 2R3CA 3C9IA 4UP5A 1G2CB 2XZRA 5APUA 4LGDE 4AYCB 5H1UA 1LWUC 1H8AA 4S3OB 3EB5A 2HLOA 2JEEA 1GW4A 4ZKPA 1KFNA 1T2KC 2DX8A 2FXMA 3U59A 4YBSA 1JY2P 2KWKA 2XV5A 2BASA 3TYYA 2M3HA 2MNYA 3VMXA 1NHLA 2KWOA 4WY4D 5APSA 4I1LA 1SP4A 2VRSA 3N4XA 1U6GB 3A7OA 2LN0A 5APTA 2KOGA 3RTRB 4A4CA 2EODA 4WZ3B 4RESB 3A5TA 2JMJA 3V2PA 5KH3A 3T97A 3HCUA 4XI1A 4CCGX 1MFZA 3L36A 5TDRA 3LW5H 2KP8A 3B5NA 4R2YA 4I7DA 1MM3A 3P32A 2L5GB 2R5DA 5AW4B 4C7NB 5B75A 3P8CE 4AQRD 2PP6A 2VJEA 4I7BA 3ZVYA 2ZFCA 2ECIA 1RF0A 3BASA 3GHGC 5AVWB 2CPBA 2H43A 3L37A 2NPSD 1FZCA 2HODB 2W6AA 3C6WA 3TK1A 3N9OA 2WPQA 1MV8A 4S3OC 5B77A 1Z6UA 3P8MC 2XEUA 3HTKC 2PNXA 1NTZK 1SFCD 1FBVA 3N9MA 2MUMA 1DEBA 1GW3A 1URQC 3OAKA 2I1KA 2C2LA 4MSXA 4W7YA 2BAYA 1URQB 3HE4A 4YABA 1N73B 3DPLR 4YC9A 3O7AA 3M9QA 1GK4A 5AITA 5KJ7A 2A45G 3OJAB 2OYIB 1AFOA 5TBNA 2G45A 2YKOA 2IDAA 3M63A 3L1XA 2KR4A 1LTBC 2WWWA 4YADA 5C11A 1RF0C 3GHGA 3IR9A 1WEMA 2E6RA 4YAXA 4UP0A 2N9BA 2C0XA 5CCGA 2YT5A 3VYIA 2MT5A 3MD0A 4GIFA 2GUVA 3B5NC 3HTKA 1WGMA 3UIAA 4QF2A 5CCHC 4LLBA 4L7XA 3B5NB 1GZLA 1XTCC 2LXPC 3KDPB 3V2NA 5AVYB 2LGKA 2ECNA 2MD7B 1E4UA 1PFIA 2H0DA 3KYQA 1RE4A 4LKAA 4A4BA 2CSYA 2G43A 2YSJA 1QL2A 4WY4C 1CW5A 2D8SA 3MHHA 1M1JB 2FUUA 2HYNA 4IFMA 3GL6A 3ZPV1 1M1JA 1JCDA 3M9BA 2NAAA 2LRIC 3A2AA 3KV5A 2J59M 3MGNA 2P2UA 4TKPB 4WB4A 1IFIA 3NFQA 2C2VS 1GL2A 1LTIC 3HRNA 2EA6A 2L75A 5AW2B 1FU1A 3V2QA 1WEOA 3N9LA 4UI9B 4YATA 1CSBA 3EQ2A 2W27A 4WBAA 5BU5A 5AVSB 2QM7A 2N1TD 2WTYA 3B5ND 1DH3A 1LDKC 5FERA 2VPBA 1N7SA 2LV9A 5TABA 2IX7C 1JTHB 4EOTA 3U5OA 2E43A 1IC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K16 A;  3N9N A;  2KE1 A;  4KHX A;  2CKL B;  2YSM A;  1JOC A;  3B8E B;  3U5M A;  3L1Z B;  4GKG A;  4GB0 A;  5TRB A;  4I2L C;  2P7J A;  3FL2 A;  2XU6 A;  5B79 A;  2YNY A;  5J3X A;  1X4I A;  2YQM A;  3V4W A;  1BOR A;  5D1M B;  3KQI A;  4FIP A;  2Q5U A;  4GNG A;  1HBW A;  5AVZ B;  1OXZ A;  4MVT A;  3M0A A;  2H0D B;  2LGV A;  1JUN A;  1S9K E;  2L5U A;  3NMD A;  2M1R A;  2ECT A;  2LDR A;  4X3G A;  4C46 A;  5H9M A;  1HYI A;  2E6S A;  2YO3 A;  1A02 F;  2PUY A;  4WZ0 A;  3SOU A;  3ZNI A;  3N9Q A;  3HE4 B;  3N9P A;  2L0B A;  2M6M A;  4C9Z A;  3LID A;  4A49 A;  3M91 A;  3C5K A;  5APV A;  2MA6 A;  4FO9 A;  1F62 A;  5AVQ B;  1WFK A;  2YYR A;  3EB6 A;  1FOS F;  4WZ2 A;  2KFT A;  4PPE A;  3V4Q A;  4AYC A;  4Q6F A;  3TNU A;  4YBM A;  3MHS A;  2L80 A;  4ZQL A;  2VP7 A;  2Y1M A;  1S9K D;  5G05 B;  2YHO A;  3ZPV E;  5AW6 B;  2CKL A;  4IC3 A;  3NXS A;  3V43 A;  1X4U A;  5AW7 B;  3O34 A;  2WPR A;  2JMI A;  1WEW A;  2KGI A;  4C7N A;  1HWT C;  2R5B A;  1XWH A;  1FP0 A;  1H89 A;  5APX A;  2OXQ C;  2F6N A;  2ZXE B;  3ZTG A;  5KH7 A;  2WT7 B;  4B86 C;  5B78 A;  4A0C D;  3P7K A;  1DVP A;  1HUC A;  3O35 A;  2Y1N A;  2VPE A;  5APW A;  3GV4 A;  3O70 A;  1CZQ A;  2K17 A;  2KRE A;  4XE5 B;  1Z2Q A;  5FB1 A;  3O36 A;  4N3W A;  2FUI A;  3O8Z A;  1VFY A;  2KGG A;  2LQ6 A;  3L11 A;  2KU3 A;  4LK9 A;  1YYC A;  3PUQ A;  4AVX A;  2KWJ A;  2YUC A;  2QJ0 A;  1FOS E;  1LDJ B;  2VJF B;  4JYC A;  4LJN A;  2AN6 A;  4CA1 A;  1WEP A;  5AVT B;  2ECG A;  2HDP A;  3HCT A;  4B86 A;  1WEE A;  2C9L Y;  4BBQ A;  4GT1 A;  3VMY A;  2JJL A;  1GU5 A;  2YUR A;  3RPG B;  1K2F A;  3SOX A;  1JM7 A;  1T1H A;  2E42 A;  3KQG A;  2MD8 C;  2QIC A;  2Q7C A;  2LXH C;  1KQL A;  2FSA A;  3ASL A;  1CI6 B;  5CMZ A;  2JRJ A;  2L43 A;  1CHC A;  5AVV B;  1WEV A;  1NWQ A;  3VN0 A;  2IPP A;  2K1J A;  4DZO A;  2LGL A;  4I7C A;  4JYB A;  4V3K C;  2Q3I A;  3A3Y B;  1Z60 A;  2MA5 A;  2M85 A;  1WEQ A;  2VPG A;  3NG2 A;  2VJF A;  4FK5 A;  3L35 A;  3VMZ A;  4P5O B;  4WA6 A;  2R32 A;  1V87 A;  3I5C A;  5DIN A;  2G6Q A;  5FB0 A;  5KH9 A;  1IO4 A;  1GK6 A;  2YU4 A;  1VD4 A;  3IHP A;  5DKA A;  2HYE D;  3T7L A;  4AP4 A;  2Z5H A;  2MIQ A;  2KYU A;  3LQJ A;  2MNZ A;  1IYM A;  2RSD A;  3VK6 A;  2CT2 A;  3LIE A;  5H1V A;  5APY A;  3SHB A;  4V3L C;  1G25 A;  4YBT A;  3M99 A;  1WES A;  5FEY A;  3KNV A;  2JMD A;  3HCS A;  3O37 A;  2EGP A;  2VPD A;  4W4U A;  4L58 A;  3PUR A;  1GTW A;  3QZV A;  5LKT A;  2WT7 A;  4FJC A;  4NN2 A;  2LGG A;  4ZDT A;  2F42 A;  1HYJ A;  1FAV A;  2ZET C;  5LCW B;  2Z5I A;  2K4D A;  3HE5 B;  5AW1 B;  1X4J A;  5I3L A;  4BHW A;  1WE9 A;  3LQH A;  4GNE A;  3TNU B;  2KIZ A;  4B7Y C;  4IC2 A;  5LKX A;  2RI7 A;  3DQV R;  4O64 A;  1ZBD B;  5D1K B;  1RMD A;  3M62 A;  2YRE A;  2YHN A;  5LKU A;  1T2K D;  1A02 J;  2F6J A;  4GNF A;  5APQ A;  1N87 A;  1WEU A;  4GND A;  2H7H A;  5JG6 A;  3KV6 A;  5G04 B;  3U5P A;  1MUU A;  3M9H A;  1WIM A;  5LKZ A;  5TDW A;  2VNF A;  1X8Y A;  1WIL A;  1GU4 A;  2QM8 A;  3M06 A;  5AW8 B;  3LRQ A;  3ZYQ A;  5AW5 B;  4PTB A;  2CSZ A;  3SOW A;  4LAD B;  2ECW A;  2P67 A;  4N4F A;  3T6R A;  3V5B A;  2WPS A;  5D1L B;  5AW9 B;  3O33 A;  5G0F A;  2YQL A;  4R8P K;  3U5N A;  3VTP C;  2YW8 A;  1SLQ A;  1WEN A;  3LQI A;  5B8D A;  5AVR B;  3NTN A;  1NAF A;  1OWA A;  1J2J B;  1HJB A;  2ECV A;  5AVX B;  3I2D A;  2KWN A;  4F52 B;  2UZG A;  2Y43 A;  5EYA F;  4AUQ B;  2XB1 A;  2VJE B;  1CI6 A;  1GD2 E;  5AIU A;  5AW3 B;  1VYX A;  5H1T A;  2C9N Y;  2I50 A;  5B76 A;  2ECJ A;  1JNM A;  3RPG C;  5C13 A;  4I6M C;  4AUW A;  4R7E A;  1MM2 A;  4M3L A;  2QIZ A;  1JM7 B;  3HE5 A;  3M0D A;  4LC1 A;  5AW0 B;  3SWF A;  5AVU B;  4ZUX U;  4HYT B;  4QF3 A;  3PHD A;  1H88 A;  3ZVZ B;  2YO2 A;  2R3C A;  4UP5 A;  1G2C B;  2XZR A;  5APU A;  4AYC B;  5H1U A;  1H8A A;  4S3O B;  3EB5 A;  1T2K C;  2DX8 A;  4YBS A;  2MNY A;  2XV5 A;  2BAS A;  3TYY A;  2M3H A;  2KWK A;  3VMX A;  2KWO A;  5APS A;  1SP4 A;  2VRS A;  1U6G B;  3A7O A;  2LN0 A;  5APT A;  3RTR B;  4A4C A;  2EOD A;  4WZ3 B;  4RES B;  3A5T A;  2JMJ A;  5KH3 A;  3T97 A;  3HCU A;  4XI1 A;  4CCG X;  1MFZ A;  3L36 A;  5TDR A;  2KP8 A;  4R2Y A;  4I7D A;  1MM3 A;  3P32 A;  2R5D A;  5AW4 B;  4C7N B;  5B75 A;  4AQR D;  2VJE A;  4I7B A;  3ZVY A;  2ZFC A;  2ECI A;  5AVW B;  3L37 A;  2W6A A;  3C6W A;  3TK1 A;  3N9O A;  2WPQ A;  1MV8 A;  4S3O C;  5B77 A;  1Z6U A;  3P8M C;  2XEU A;  3HTK C;  2PNX A;  1FBV A;  3N9M A;  2MUM A;  3OAK A;  2C2L A;  4MSX A;  2BAY A;  3HE4 A;  4YAB A;  3DPL R;  4YC9 A;  3O7A A;  1GK4 A;  5AIT A;  5TBN A;  2G45 A;  2IDA A;  3M63 A;  3L1X A;  2KR4 A;  2WWW A;  4YAD A;  5C11 A;  3IR9 A;  2E6R A;  1WEM A;  4YAX A;  4UP0 A;  2N9B A;  2YT5 A;  3VYI A;  2MT5 A;  3MD0 A;  3HTK A;  1WGM A;  3UIA A;  4QF2 A;  4LLB A;  4L7X A;  2LXP C;  1GZL A;  3KDP B;  5AVY B;  2LGK A;  2ECN A;  2MD7 B;  1E4U A;  2H0D A;  4LKA A;  4A4B A;  2CSY A;  2G43 A;  2YSJ A;  2D8S A;  3MHH A;  2FUU A;  3GL6 A;  3ZPV 1;  3M9B A;  2NAA A;  2LRI C;  3A2A A;  3KV5 A;  3MGN A;  2P2U A;  4TKP B;  3NFQ A;  2C2V S;  2EA6 A;  2L75 A;  5AW2 B;  3N9L A;  1WEO A;  4UI9 B;  4YAT A;  1CSB A;  2W27 A;  5AVS B;  2QM7 A;  2WTY A;  1DH3 A;  1LDK C;  5FER A;  2VPB A;  2LV9 A;  5TAB A;  4EOT A;  3U5O A;  2E43 A; 
#chains in the Genus database with same CATH topology
 2K16 A;  3P8C D;  2KS1 B;  3U5M A;  1LTJ B;  3B8E B;  2QJP B;  2IFN A;  2XKM A;  4I2L C;  5GTI H;  2YQM A;  1SQQ J;  2Q5U A;  4D6T D;  2H0D B;  1JUN A;  3Q2Y A;  1EZV E;  2WSC H;  5GTH E;  1SFC A;  4ZKU A;  2B87 B;  5H9M A;  1PGJ A;  1FZC B;  1N73 A;  3ZNI A;  2G3A A;  1BE3 G;  3AE4 C;  2L0B A;  2M6M A;  3H1J D;  2ITA A;  1U7M A;  2ZXX A;  3CXH I;  4JPZ B;  3V2R A;  2MA6 A;  1NTK J;  5KAI H;  1SQB G;  1F62 A;  1PGO A;  4Y99 B;  1WFK A;  2YYR A;  1MFT A;  2O1K A;  3GMA A;  4Q6F A;  3MUD C;  4ZQL A;  1OW8 A;  3ZPV E;  1U7J A;  5AW6 B;  1YTZ T;  1ZP0 C;  3NXS A;  1X4U A;  3D71 A;  2JMI A;  1SFC B;  1SFC C;  2E5T A;  2KGI A;  4L74 A;  2D8U A;  4D6T J;  1HVV A;  2R5B A;  5DJU B;  1ZRT E;  4O9B A;  5APX A;  2OXQ C;  2ZXE B;  4BRY B;  4B86 C;  1DVP A;  3O35 A;  2Y1N A;  1SQB J;  1H0T B;  3RBZ A;  2BEQ D;  2BCC D;  2K17 A;  2KRE A;  1RF1 A;  1Z2Q A;  3DWD A;  2WMM A;  2FUI A;  1EXJ A;  2KGG A;  3I56 P;  2FYZ A;  2QJ0 A;  3USS A;  4ZNC A;  2HG5 D;  3D6Y A;  1BDC A;  1WEP A;  4F1P A;  5KLV G;  3HCT A;  1HGV A;  2GUS A;  4GT1 A;  1P84 I;  1UII A;  2YUR A;  2RMZ A;  5B5E H;  2FFD C;  2WVR A;  5L8R J;  1K2F A;  3SOX A;  1VF5 B;  1IJD B;  1OX3 A;  4NPF X;  1NKN A;  3MTU E;  2QIC A;  2E76 C;  3L70 J;  1FZG A;  3G9R A;  1S5L X;  1X0T A;  2B87 A;  2IDB A;  5M1B A;  4BRY A;  5BVZ A;  1QGK B;  4PV1 D;  1J1E B;  1IK9 A;  4O62 A;  1J1E C;  1PIX A;  2FYN C;  3H1I E;  3H1K E;  1RE4 C;  1OVV A;  3FXD A;  3VOP A;  3L35 A;  2YKP A;  3VMZ A;  2CRW A;  3G3Z A;  4P5O B;  4WA6 A;  4N6J A;  1LTJ A;  5DIN A;  1SQV K;  2K88 A;  2YU4 A;  1X9V A;  2BEZ F;  1OIP A;  3LQJ A;  1YQ3 C;  1IYM A;  2BCC E;  2RSD A;  3VK6 A;  3SHB A;  4V3L C;  1NTM E;  4W7Z A;  1P84 H;  1AA0 A;  1JCC A;  3O37 A;  2WIT A;  2EGP A;  2OYH A;  2VPD A;  4L58 A;  3KXD A;  2IYP A;  3PUR A;  1L4A B;  4FJC A;  5H2F H;  2V7Q H;  3FM8 C;  1N73 C;  1FAV A;  3RL0 D;  5LCW B;  3HE5 B;  1E79 H;  1IFD A;  2E61 A;  2ZAE B;  1ZR2 A;  1WE9 A;  2CRR A;  1G2C A;  2FYU K;  5LKX A;  2RI7 A;  5C39 A;  3KZI E;  1S3J A;  4OWF A;  1JB0 J;  4WY4 A;  2YRE A;  5LKU A;  1IZN B;  3RL0 B;  1N87 A;  2FXP A;  4H0L C;  5G04 B;  1MUU A;  5TDW A;  1KYO I;  3M06 A;  3R2P A;  4PTB A;  4EIJ A;  1IFM A;  3VP8 A;  1BCC E;  2IZ1 A;  1PL5 A;  1AQ5 A;  1AJY A;  1R5L A;  3CX5 E;  5KAI E;  4N3Y B;  1S72 P;  2WPS A;  1VDF A;  2PFX A;  1VPC A;  3CWB J;  2WSE H;  4PD4 I;  2MKV A;  3BCC D;  3LQI A;  4UB8 E;  3H7H A;  3TDK A;  1LTJ C;  3NTN A;  2YVR A;  2O01 N;  5AVX B;  2KWN A;  1YJN P;  3EWK A;  1N7L A;  5EYA F;  1FBM A;  4AUQ B;  1NU1 E;  1FE6 A;  1VYX A;  3Q5S A;  3E1I A;  4I7Z B;  1YIT P;  5C13 A;  1M8O B;  4M3L A;  2OYH C;  3L75 E;  2OYH B;  3KPE A;  1Q90 D;  2NZ2 A;  4YXD C;  1SQP E;  1T6A A;  1GL2 C;  1NTZ D;  1BGY D;  1XTG B;  2OAR A;  2E74 B;  4DCK A;  1SVF A;  5CJ4 A;  5TIS E;  3C9I A;  4UP5 A;  2D2C C;  1LWU C;  2OGU A;  4ZKP A;  1KFN A;  2DX8 A;  2BAS A;  2M3H A;  3VMX A;  1NHL A;  2KWO A;  1YIJ P;  3CCL P;  1U6G B;  5APT A;  1FS0 E;  4OGQ C;  2AEJ A;  4A4C A;  1AVO A;  2YIU B;  3V2P A;  5KH3 A;  4CCG X;  4U3F E;  2KP8 A;  3B5N A;  3P32 A;  4AQR D;  3QH9 A;  3ZVY A;  3BAS A;  3GHG C;  2NPS D;  3A0B H;  1SQV E;  1K05 A;  1YQ4 C;  3AEF C;  5B77 A;  1BCC J;  1Z6U A;  3P8M C;  4RO0 A;  3S4R A;  2ZYA A;  3HTK C;  1SFC D;  3Q3D A;  4H13 C;  1DEB A;  3FAN A;  2E76 D;  4W7Y A;  2BAY A;  1URQ B;  1VQL P;  2RN0 A;  2AXC A;  2XOY A;  3FJU B;  1SQP G;  4D6T G;  3IR9 A;  2C0X A;  3VYI A;  2MT5 A;  3O6Q A;  2GUV A;  3HTK A;  4QF2 A;  5CCH C;  2LXP C;  1XTC C;  2D2C B;  3KDP B;  3V2N A;  2M5A B;  5AVY B;  2R44 A;  1MKM A;  2FYU D;  2H0D A;  3KYQ A;  3W67 A;  3E7K A;  2Y0C A;  1KYO D;  1NU1 G;  3L75 J;  3MHH A;  2FUU A;  3ZPV 1;  3A2A A;  5E79 H;  4IOI H;  2J59 M;  1YI2 P;  2O01 J;  1PV3 A;  2OTL P;  2QE7 H;  2EA6 A;  3N9L A;  3QWO C;  4YAT A;  1CSB A;  2W27 A;  5AVS B;  2QM7 A;  2N1T D;  5FER A;  2VPB A;  2JDI H;  2FYU J;  1W5C E;  1IC2 A;  3L74 G;  3N9N A;  2W90 A;  2L91 A;  2CKL B;  4GKG A;  5TRB A;  1J1D B;  3FL2 A;  2P7J A;  2R3S A;  3RK2 C;  2H8P D;  2HPC A;  3RK2 B;  3V4W A;  1BOR A;  1LWU B;  3G4S P;  2FFD A;  3AE1 C;  4GNG A;  3H1L D;  1HBW A;  1LT9 B;  3M0A A;  1URQ D;  2L5U A;  2M1R A;  2ECT A;  4D6T E;  4PJ0 E;  3CCR P;  2E6S A;  3MDB C;  2YO3 A;  2PUY A;  1DEE G;  3SOU A;  1NTM J;  4JF7 A;  1URQ A;  3LID A;  3N7N A;  4ZMD A;  3LDY A;  3M91 A;  3C5K A;  5APV A;  1NVO A;  3GG2 A;  2QEX P;  1FOS F;  2KFT A;  4YBM A;  4AYC A;  1VQ7 P;  3H1H J;  1L0N K;  1DCQ A;  1T3U A;  2Y1M A;  3L70 D;  2RKL A;  2YHO A;  2C0W A;  1NJI Q;  3V43 A;  1L0L D;  2KB7 P;  5CCH A;  1YHQ P;  3C1L A;  1EXI A;  4R4M A;  1LWU A;  1WEW A;  2PAJ A;  3BAT A;  4ASV A;  3MUD A;  1LJ2 A;  1BGY G;  1FP0 A;  5SVX A;  2FBW C;  2E74 D;  2WT7 B;  2K9J B;  3H1H D;  3CLQ A;  3HD7 A;  1GL2 B;  2AEM A;  3F89 A;  1NTM D;  5KLV J;  2VPE A;  5APW A;  3GV4 A;  2E74 C;  4DOJ A;  3O70 A;  3LJU X;  5FB1 A;  1L0L J;  3O36 A;  4N3W A;  4LK9 A;  2MKE A;  3E1R A;  1PGQ A;  4AVX A;  2KWJ A;  5GTH H;  2ZYD A;  1EDI A;  2YMK A;  3CCJ P;  1L0N E;  2KSE A;  3CWB E;  3IAO A;  3A0B E;  3H1K J;  2FYU E;  4Z0R A;  4CA1 A;  1SQX K;  4OGC A;  1T3J A;  2JJL A;  1GU5 A;  3H1K D;  3AEE C;  1S5L H;  3O6Q B;  2FKW B;  1JY3 O;  2E42 A;  2YMY A;  5KAF H;  3PH0 A;  4PD4 E;  2BCC J;  4L76 A;  1WEV A;  2I8D A;  3FEH A;  1KIL E;  2HOD A;  3AE7 C;  3TGU E;  3H1H G;  1M1J C;  1S2E A;  4JYB A;  4C7R A;  4V3K C;  1D7M A;  1JMM A;  2M85 A;  3MIW A;  1WEQ A;  1S4X A;  4EDF A;  1L4A C;  1IK7 A;  2LXC B;  2R32 A;  3DDT A;  3I5C A;  1DD3 A;  1Y9B A;  4RKU J;  2G6Q A;  1IO4 A;  3HUS A;  3TF5 A;  3L75 G;  1SQV G;  1MZ9 A;  3AE6 C;  5DKA A;  2MIQ A;  2KYU A;  2MNZ A;  2O3J A;  5H1V A;  5APY A;  2WSC J;  3RL0 C;  4YBT A;  3M99 A;  1ZN5 A;  1WES A;  2OTK E;  1HGZ A;  3L71 E;  4R4L A;  3GF3 A;  4U3F J;  3HCS A;  1L4A D;  3RK3 E;  4W4U A;  1GTW A;  1R8E A;  3PHL A;  3QZV A;  1W2E A;  5KLI C;  3M0D C;  2F42 A;  2Z5I A;  1K04 A;  1X4J A;  2Y9Y A;  5DJT B;  1L0L E;  2V4H A;  2JR8 A;  1DX7 A;  2FY8 A;  1LTA C;  1Z56 A;  1BE3 E;  4H44 D;  1HTL C;  2JWA A;  2PGD A;  3AE2 C;  5KLV K;  2YHN A;  3GW6 A;  4MN4 C;  1T2K D;  3L73 J;  4LLH A;  3CL3 D;  3AEC C;  1JY2 O;  1NTZ E;  3EFF K;  2H7H A;  3B4S A;  5JG6 A;  1NU1 J;  3L72 D;  2VNF A;  1X8Y A;  1GU4 A;  2FYN B;  1VQ6 P;  5AW5 B;  4PV1 B;  2IQJ A;  2IBZ D;  4LAD B;  4OGQ D;  2P67 A;  4N4F A;  2HFE D;  3V5B A;  5D1L B;  3Q5P A;  1M57 D;  3VTP C;  1JY3 N;  1SQP J;  1SLQ A;  1WEN A;  2CON A;  2JO1 A;  5B8D A;  5AVR B;  2J58 A;  1KD1 Q;  1HJB A;  2ECV A;  2QSI A;  1KTM A;  3I2D A;  4H13 B;  2QJK B;  2M0B A;  3L73 D;  2VJE B;  2MJZ A;  1W2B O;  2W8Z A;  5AW3 B;  1FDM A;  2KXP B;  2C9N Y;  2I50 A;  1NH4 A;  5B76 A;  1SQB K;  2QIZ A;  2JM3 A;  2A45 H;  3L71 J;  3CI9 A;  3L72 E;  3WU2 E;  1HH0 A;  3O47 A;  1JY3 P;  5AW0 B;  1AV1 A;  4ZUX U;  4HYT B;  2CSV A;  1RF1 B;  1SQV J;  1SQP D;  2L7P A;  3PTZ A;  1LNQ A;  3GLM A;  5APU A;  4H0L B;  4S3O B;  2JEE A;  1GW4 A;  4YBS A;  1BE3 J;  2YXR B;  4WY4 D;  1SP4 A;  2VRS A;  3A7O A;  2NRG A;  3L73 E;  4RES B;  2JMJ A;  3T97 A;  4R2Y A;  3CXH D;  5B75 A;  4BWN A;  2IBZ E;  3AE9 C;  3VMA A;  3P8C E;  3AEB C;  3SWK A;  2ZFC A;  2P58 A;  2HOD B;  3C6W A;  1YJ9 P;  4GOD A;  2XEU A;  4U3F D;  2PNX A;  2V7Q J;  2MUM A;  4TT3 H;  3TGU D;  3OAK A;  2KLU A;  5SVI A;  4YAB A;  2Q3E A;  3BCC J;  1N73 B;  4YC9 A;  3O7A A;  3M9Q A;  5SVY A;  1AFO A;  5KJ7 A;  2A45 G;  3OJA B;  2Q6Q A;  3ITK A;  2G45 A;  2OYO A;  2YKO A;  1YJW P;  3M63 A;  1EZV D;  5C11 A;  3RL0 g;  4UB8 H;  3H1L G;  4U7J A;  1WEM A;  4YAX A;  2KK7 A;  4UP0 A;  3ABV C;  4Y28 J;  2YT5 A;  1NTK E;  1VQK P;  3MD0 A;  4GIF A;  3RGU A;  1PP9 D;  2ECN A;  1M1K Q;  1E4U A;  1PFI A;  2UWJ E;  2E75 D;  2G8Y A;  1KB9 H;  1CW5 A;  1OFC X;  2D8S A;  1M1J B;  2HYN A;  2H88 C;  1M1J A;  3M9B A;  4KJM A;  3A0H E;  2P2U A;  3PLN A;  4WB4 A;  3NFQ A;  2C2V S;  1GL2 A;  3HRN A;  5AW2 B;  4UI9 B;  5BU5 A;  2E5Y A;  3B5N D;  1N7S A;  1UIX A;  3LVQ E;  3T9K A;  3I55 P;  1JTH B;  2K37 A;  2PRR A;  2YSM A;  3PLW A;  1JOC A;  4W80 A;  4GB0 A;  2XU6 A;  1EZV G;  5B79 A;  2JUN A;  3S9O A;  2B88 A;  4L75 A;  5KLV D;  4GOF A;  3CCS P;  3HTK B;  4FIP A;  4MVT A;  2KNC A;  3FWL A;  2LGV A;  3NMD A;  5KKZ B;  5CCG D;  1PP9 E;  2JP3 A;  1BDD A;  4WZ0 A;  4XA4 A;  1ZXG A;  1FZC C;  4C9Z A;  1WRG A;  1FJP A;  5CCH D;  3AEA C;  4FO9 A;  1RQV A;  1KB9 I;  1J1D C;  5AVQ B;  1Q81 Q;  2B9B A;  3V4Q A;  3RK3 D;  2IZ0 A;  3MHS A;  3SWY A;  1RE3 C;  2L80 A;  1DD4 A;  1S9K D;  1X79 B;  3MP7 B;  5G05 B;  1KV4 A;  2CKL A;  1NO4 A;  3II6 A;  1TU3 F;  1L0N G;  5AW7 B;  3O34 A;  1FDO A;  2WPR A;  2A06 E;  2CK3 H;  1S5L E;  1NKZ B;  1QX8 A;  4C7N A;  2XP0 A;  4WVZ A;  1NTZ J;  4A0C D;  3P7K A;  3SSU A;  3C8V A;  4XE5 B;  1SQQ K;  1SQX J;  3H32 B;  3O8Z A;  2KLV A;  2LQ6 A;  2KU3 A;  2KKY A;  1QL1 A;  3BRT B;  1N7S C;  2N1T A;  3RK3 B;  3L75 D;  1NTZ G;  1KFM A;  2VJF B;  4JYC A;  3BRV B;  4LJN A;  1ZRT D;  1LT9 C;  1AQT A;  1GL2 D;  5AVT B;  2ECG A;  2I1J A;  2HDP A;  1SQB D;  2P1J A;  1K8A Q;  1EZV I;  3VMY A;  2AXT E;  2YXQ B;  1T8Z A;  1N7S D;  2N1T C;  2ZT9 C;  3H1I G;  1JMB A;  1JM7 A;  2WSF H;  2ZT9 B;  1T1H A;  2MD8 C;  1KIL C;  3Q1M A;  1LTS C;  2Q7C A;  4YPC A;  1KIL B;  1JO5 A;  2FSA A;  1YTZ I;  3ASL A;  1CI6 B;  2QJP C;  1PP9 J;  2Q1K A;  2L43 A;  1CHC A;  1NWQ A;  3VN0 A;  2IPP A;  2K1J A;  1RF1 C;  5KJ7 D;  4DZO A;  2LGL A;  2KNC B;  1FZE A;  1Z60 A;  2YKQ A;  1LTT C;  2VPG A;  4UB6 H;  5SVI B;  3FXE A;  3NG2 A;  2H89 C;  3E2D A;  2A06 G;  3CME P;  1VQO P;  5BU8 B;  5FB0 A;  1JTH A;  3CXH E;  5KH9 A;  3U1C A;  3CCV P;  1PPJ G;  4YXW H;  1VD4 A;  2IYO A;  2HPC B;  3AE5 C;  3IHP A;  4H9D A;  1BCC D;  1KIL A;  2HYE D;  3T7L A;  4WWI A;  2CPS A;  2Z5H A;  3LW5 J;  3RK3 C;  1RH5 B;  1USE A;  2Z4E A;  1VL2 A;  1ZME C;  2IFM A;  2QJY C;  3SFE C;  2JMD A;  3HD7 D;  1OVU A;  1K9M Q;  3WUU A;  5LKT A;  5GTI E;  4NN2 A;  4ZDT A;  1HYJ A;  1RY3 A;  2Q9I A;  2K4D A;  5I3L A;  4BHW A;  1H0T A;  5CCG C;  2P57 A;  4GNE A;  3EFG A;  3TNU B;  2KIZ A;  1KYO E;  4B7Y C;  3L70 E;  3BCC E;  4O64 A;  1ZBD B;  1RMD A;  3WUT A;  3M62 A;  2HR3 A;  1SS1 A;  3CX5 I;  1NOH A;  2F6J A;  3JC2 2;  1WEU A;  2D2C D;  1NTK K;  3CWB D;  2Y0E A;  3KV6 A;  5KLI B;  4HKZ H;  1WIM A;  5LKZ A;  1SQV D;  3CX5 H;  3HD7 B;  1LP1 A;  4N78 D;  5AW8 B;  1P84 D;  3ZYQ A;  1HJ0 A;  2CSZ A;  1VQM P;  1LTG C;  2EXU A;  1PGP A;  4IFF A;  4IFD K;  1NAY A;  1EQ7 A;  2YQL A;  2ZYG A;  3IF4 A;  2YW8 A;  4OH8 B;  2XNX A;  4U3F G;  2JWD A;  3CC4 P;  4H0L D;  3SUB A;  1J2J B;  1L2P A;  2N9Y B;  3GHG B;  1VQ4 P;  1NU1 K;  3FGA D;  3H25 A;  2XB1 A;  1IFN A;  4HB1 A;  1CI6 A;  1Y47 A;  3CC2 P;  5AIU A;  3JCU E;  2LR2 A;  2OYI C;  1R5S A;  1SQX D;  3H1L J;  1S1C X;  2ECJ A;  1JNM A;  2M3E A;  3RPG C;  2K1A A;  5CBO A;  4R7E A;  4PD4 D;  1MM2 A;  2DJA A;  1JM7 B;  3HE5 A;  4LC1 A;  2FD4 A;  1KQG B;  3TGU G;  3MZW B;  2ZVO B;  1QVG O;  3SWF A;  2QRX A;  5AVU B;  1FC2 C;  3AE3 C;  1ZLL A;  4QF3 A;  4Y99 C;  1N7S B;  2IBZ G;  1Q2N A;  2R3C A;  2XZR A;  2QA4 P;  4LGD E;  3CMA P;  2QJK C;  5H1U A;  3G71 P;  5APS A;  4I1L A;  2E75 C;  2ZVN B;  3CC7 P;  2YIU C;  2FYU G;  2EOD A;  4WZ3 B;  4OGQ B;  2XND H;  3HCU A;  4XI1 A;  1MFZ A;  4I7D A;  2R5D A;  4C7N B;  2PP6 A;  4I7B A;  1M90 Q;  1KB9 E;  2CPB A;  2KZJ A;  2H43 A;  2ZJS E;  2W6A A;  1SQX G;  3TK1 A;  2DSM A;  2WPQ A;  1EDJ A;  1OMI A;  4S3O C;  2A06 D;  2KI7 B;  3G6E P;  3H1J J;  3N9M A;  5TJH A;  5KKZ C;  1URQ C;  2C2L A;  4I7Z C;  3HE4 A;  1PPJ D;  1BGY E;  4GOE A;  1OVR A;  4H44 B;  3DPL R;  4IL6 X;  1GK4 A;  3WU2 H;  1N8R Q;  5TBN A;  1SQX E;  3JSV C;  3L1X A;  2WWW A;  4YAD A;  1RF0 C;  3CPW O;  2WQY C;  2JKV A;  3D70 A;  3UIA A;  4LLB A;  4L7X A;  2WSF J;  1MBM A;  1KQS O;  2LGK A;  3H1H E;  3SFD C;  3R4Y A;  1RE4 A;  4LKA A;  1K73 Q;  1BCC G;  2CSY A;  2G43 A;  1QL2 A;  4WY4 C;  2RH0 A;  3GL6 A;  1OZH A;  1JCD A;  3KV5 A;  4XFJ A;  2XOZ A;  3MGN A;  3CCU P;  1LTI C;  3L70 G;  2L75 A;  4Z1M H;  1FU1 A;  1NTM G;  1VQP P;  3EQ2 A;  3KZI H;  4WBA A;  2BCC G;  5CBN A;  5TAB A;  2IX7 C;  3U5O A;  5G0F A;  3RBX A;  3PP5 A;  2GA1 A;  2KE1 A;  1RE3 A;  4KHX A;  3L1Z B;  1WT6 A;  1IFJ A;  2YNY A;  1FZF A;  1X4I A;  1PZQ A;  5J3X A;  3W68 A;  5D1M B;  1Q86 Q;  3KQI A;  4H44 C;  4HH2 A;  1NTK G;  3AED C;  5AVZ B;  1OXZ A;  4OVN F;  1S9K E;  3S1K A;  2LDR A;  4X3G A;  2E75 B;  2W6J H;  4C46 A;  1HYI A;  3BCC G;  1A02 F;  3CCQ P;  1E5W A;  3N9Q A;  3B71 A;  3HE4 B;  3N9P A;  2OYI A;  4A49 A;  4RJT A;  1GDT A;  1EDL A;  3H1J E;  1M7L A;  1NTM K;  3EB6 A;  4WZ2 A;  1KOR A;  4PPE A;  3TNU A;  1ZR4 A;  1N86 A;  3TSI A;  2VP7 A;  5KJ7 C;  3A0H H;  3TGU J;  3WMM 0;  4IC3 A;  2K3R A;  1PP9 G;  5CHX A;  3Q1D A;  3L74 D;  2KZI A;  1VF5 D;  2P10 A;  1NU1 D;  1HWT C;  1L4A A;  1M56 D;  1QEX A;  2FFD B;  3L74 J;  1XWH A;  1FJK A;  4IL6 H;  1H89 A;  2M8R A;  2F6N A;  1NYH A;  3ZTG A;  5KH7 A;  4NPE A;  5B78 A;  1HUC A;  1SQP K;  1RHZ B;  3H6P A;  1SQQ D;  2LKM A;  1GMJ A;  3VP9 A;  1CZQ A;  2OTJ P;  3IFM A;  1FDI A;  2M3B A;  3CD6 P;  1JEK A;  3L11 A;  1VFY A;  4Z0O A;  1YYC A;  3PUQ A;  1U57 A;  1BE3 D;  4N78 E;  1KMI Z;  2YUC A;  3M7K A;  4WY4 B;  1FOS E;  1LDJ B;  2POH A;  2AN6 A;  4B86 A;  2KUB A;  3HUS B;  1WEE A;  2C9L Y;  4BBQ A;  3HUS C;  1NTK D;  3RPG B;  5H2F E;  1X22 A;  3KQG A;  2OWA A;  1KC8 Q;  4OGE A;  2LXH C;  1KQL A;  4K35 A;  5EFW B;  5CMZ A;  2JRJ A;  3H1L E;  2KSJ A;  1EC5 A;  5AVV B;  3AE8 C;  3RK2 D;  5K5G B;  1LT9 A;  4I7C A;  1KQF B;  4PJ0 H;  2W6B A;  1KN7 A;  2QJY B;  2Q3I A;  3A3Y B;  2MA5 A;  3K5B A;  3L71 D;  1SQQ G;  4H13 D;  2VJF A;  4FK5 A;  1G1J A;  2N1T B;  3KHU A;  2DW3 A;  1V87 A;  1WMK A;  3AEG C;  4NPD A;  3H32 A;  2WZ7 A;  1GK6 A;  3OA7 A;  4KT0 J;  1BSH A;  2AXT H;  4JQ0 D;  2WSS H;  5KLV E;  1Q82 Q;  4AP4 A;  2KS1 A;  2NPS A;  1KZU B;  2CT2 A;  3H1K G;  3LIE A;  1G25 A;  4DT0 A;  5FEY A;  3H1I D;  1L0N J;  1G1I A;  5B66 E;  3KNV A;  2KYV A;  3D6Z A;  2RR4 A;  3PJS K;  4CPG A;  5TIS H;  1HF9 A;  3H1I J;  2WT7 A;  1N2D C;  2B0O E;  2LGG A;  2FXO A;  2KIK A;  2ZET C;  4TLF A;  5AW1 B;  2GM4 A;  2FFW A;  3LQH A;  3JUE A;  4EYY Q;  3U1A A;  1VF5 C;  4IC2 A;  3L72 J;  3CCM P;  1USD A;  2E76 B;  1BGY J;  3DQV R;  3FX0 A;  5D1K B;  4QMA A;  3MHV A;  2J5U A;  1LT1 A;  3L71 G;  1A02 J;  4A7P A;  2XDJ A;  4GNF A;  1EDK A;  5APQ A;  3CX5 D;  4GND A;  2NPS B;  4BXL A;  5CJ0 A;  4YTP C;  3U5P A;  3M9H A;  1ZW0 A;  1P84 E;  1WIL A;  1SQB E;  2QM8 A;  3LRQ A;  3BVH A;  3SOW A;  1QVF O;  5KAF E;  2ECW A;  2M5A A;  3T6R A;  2O01 H;  5AW9 B;  3O33 A;  4R8P K;  1FZA A;  3U5N A;  1KIL D;  4HJG H;  4IL6 E;  1KYO H;  2ZT9 D;  4GDO A;  1L0L G;  1FZB A;  3H1J G;  1NAF A;  3LVR E;  1OWA A;  2A45 I;  4DJG A;  2W83 C;  4UB6 E;  4F52 B;  2UZG A;  2Y43 A;  1VQ8 P;  4QQ4 A;  3HD7 C;  1JY2 N;  2QG4 A;  3T97 B;  1GD2 E;  1L0L K;  3PRJ A;  5H1T A;  2M13 A;  1ZV8 A;  1JM0 A;  4I6M C;  2O1J A;  3V6I A;  4AUW A;  4PD4 H;  1PPJ E;  2SPZ A;  3L4F A;  1L0N D;  1VQ5 P;  3M0D A;  5KTB A;  3CWB G;  1LGH B;  3F5H A;  3PHD A;  2NPS C;  1H88 A;  3ZVZ B;  2YO2 A;  1G2C B;  3IN6 A;  4AYC B;  1H8A A;  3EB5 A;  2HLO A;  2QVA A;  1T2K C;  1YBK A;  2FXM A;  4PV1 C;  3U59 A;  1JY2 P;  2KWK A;  2XV5 A;  3TYY A;  2OQQ A;  2MNY A;  1BSN A;  4EI2 A;  3N4X A;  4ASW A;  2LN0 A;  2KOG A;  3RTR B;  1SQQ E;  5K3Q A;  3L72 G;  1AVY A;  1VQ9 P;  3A5T A;  2K9J A;  3L36 A;  5TDR A;  3LW5 H;  3FAO A;  2K9Y A;  1MM3 A;  4L73 A;  2L5G B;  5AW4 B;  3L73 G;  2VJE A;  1KB9 D;  3Q5R A;  2ECI A;  1RF0 A;  5AVW B;  3L37 A;  1FZC A;  3L74 E;  2AEF A;  3N9O A;  1MV8 A;  2EGM A;  2Y0D A;  5E79 E;  1OW7 A;  1NTZ K;  1FBV A;  1LP1 B;  3GF7 A;  1GW3 A;  3OW2 O;  2I1K A;  4MSX A;  3ZDM A;  2KKX A;  1NGM B;  5B66 H;  5AIT A;  2IBZ I;  2OYI B;  1Y8A A;  2IDA A;  2KR4 A;  1LTB C;  3GHG A;  2E6R A;  2LXB A;  2N9B A;  5CCG A;  3CXH H;  3KDE C;  5B5E E;  1IFP A;  3B5N C;  3FWN A;  1WGM A;  4K3A A;  3B5N B;  1GZL A;  2WPV B;  2MD7 B;  1DIP A;  3WUV A;  3JCU H;  4A4B A;  1ZOY C;  2YSJ A;  1VQN P;  2Y9Z A;  1RQU A;  4IFM A;  1QLE D;  2NAA A;  2LRI C;  4TKP B;  1Q7Y Q;  2LAU A;  4JBZ A;  1IFI A;  2B89 A;  2WSE J;  3V2Q A;  1WEO A;  1OW6 A;  2XOC A;  2QIW A;  2WTY A;  1DH3 A;  1LDK C;  3CCE P;  2LV9 A;  4EOT A;  2E43 A; 
#chains in the Genus database with same CATH homology
 2K16 A;  3N9N A;  3PP5 A;  3P8C D;  2KE1 A;  1RE3 A;  4KHX A;  2CKL B;  1LTJ B;  1JOC A;  3B8E B;  2YSM A;  3U5M A;  2IFN A;  3L1Z B;  4GKG A;  4W80 A;  4GB0 A;  1WT6 A;  2XKM A;  1J1D B;  4I2L C;  2P7J A;  3FL2 A;  2XU6 A;  5TRB A;  3RK2 C;  5B79 A;  2H8P D;  1IFJ A;  2YNY A;  1FZF A;  2HPC A;  1X4I A;  5J3X A;  2YQM A;  3RK2 B;  3V4W A;  1BOR A;  5D1M B;  3KQI A;  1LWU B;  2FFD A;  3HTK B;  2Q5U A;  4HH2 A;  4FIP A;  4GNG A;  1HBW A;  5AVZ B;  1OXZ A;  4MVT A;  1LT9 B;  3M0A A;  2H0D B;  2LGV A;  1URQ D;  1S9K E;  1JUN A;  2WSC H;  2L5U A;  3NMD A;  2M1R A;  5CCG D;  1SFC A;  2ECT A;  2LDR A;  4X3G A;  4ZKU A;  4C46 A;  5H9M A;  1HYI A;  2E6S A;  2YO3 A;  1FZC B;  1N73 A;  1A02 F;  2PUY A;  4WZ0 A;  3SOU A;  3ZNI A;  1E5W A;  4XA4 A;  4JF7 A;  3N9Q A;  1URQ A;  3HE4 B;  1FZC C;  3N9P A;  2OYI A;  2L0B A;  2M6M A;  4C9Z A;  1WRG A;  3LID A;  1FJP A;  3N7N A;  4A49 A;  1GDT A;  5CCH D;  3V2R A;  3M91 A;  3C5K A;  5APV A;  2MA6 A;  4FO9 A;  1F62 A;  1M7L A;  1J1D C;  1NTM K;  4Y99 B;  5AVQ B;  1WFK A;  2YYR A;  3EB6 A;  2O1K A;  1FOS F;  4WZ2 A;  2KFT A;  4PPE A;  3V4Q A;  4AYC A;  4Q6F A;  3RK3 D;  3TNU A;  4YBM A;  1ZR4 A;  1L0N K;  3MHS A;  3SWY A;  1RE3 C;  1N86 A;  2L80 A;  3TSI A;  4ZQL A;  2VP7 A;  1T3U A;  5KJ7 C;  2Y1M A;  1S9K D;  1X79 B;  5G05 B;  2YHO A;  3ZPV E;  5AW6 B;  1YTZ T;  3WMM 0;  2C0W A;  2CKL A;  4IC3 A;  1NO4 A;  3NXS A;  3V43 A;  3II6 A;  5CHX A;  2KB7 P;  5CCH A;  1X4U A;  5AW7 B;  3O34 A;  2WPR A;  1SFC B;  2JMI A;  1LWU A;  1WEW A;  2PAJ A;  1SFC C;  2KGI A;  1NKZ B;  3BAT A;  3MUD A;  4C7N A;  1L4A A;  1HWT C;  1HVV A;  2FFD B;  2R5B A;  1XWH A;  4O9B A;  1FJK A;  5APX A;  1H89 A;  2M8R A;  1FP0 A;  2F6N A;  2ZXE B;  2OXQ C;  3ZTG A;  5KH7 A;  2WT7 B;  4B86 C;  5B78 A;  3CLQ A;  3HD7 A;  4A0C D;  1GL2 B;  3P7K A;  1DVP A;  1HUC A;  1SQP K;  3H6P A;  3O35 A;  2Y1N A;  2VPE A;  5APW A;  2LKM A;  3GV4 A;  3VP9 A;  4DOJ A;  1CZQ A;  3O70 A;  2K17 A;  2KRE A;  3IFM A;  4XE5 B;  1RF1 A;  1Z2Q A;  5FB1 A;  2M3B A;  1SQQ K;  3O36 A;  4N3W A;  2FUI A;  3H32 B;  3O8Z A;  2KLV A;  1VFY A;  2KGG A;  2KU3 A;  2LQ6 A;  1YYC A;  3L11 A;  4LK9 A;  3PUQ A;  1QL1 A;  4AVX A;  3BRT B;  1N7S C;  4N78 E;  2KWJ A;  2FYZ A;  2YUC A;  2QJ0 A;  2N1T A;  4WY4 B;  3RK3 B;  1FOS E;  1LDJ B;  1KFM A;  2VJF B;  4JYC A;  2POH A;  2HG5 D;  3BRV B;  4LJN A;  1LT9 C;  2AN6 A;  4CA1 A;  1SQX K;  1WEP A;  1GL2 D;  5AVT B;  2ECG A;  2I1J A;  2HDP A;  3HCT A;  1T3J A;  4B86 A;  2P1J A;  3HUS B;  1HGV A;  2GUS A;  4GT1 A;  3VMY A;  2JJL A;  1GU5 A;  2C9L Y;  1WEE A;  4BBQ A;  3HUS C;  2YUR A;  2FFD C;  1T8Z A;  1N7S D;  3RPG B;  2N1T C;  1K2F A;  3SOX A;  1JM7 A;  2WSF H;  1IJD B;  2FKW B;  1T1H A;  1JY3 O;  1NKN A;  3KQG A;  2E42 A;  1KIL C;  2MD8 C;  3MTU E;  2QIC A;  1LTS C;  2YMY A;  2Q7C A;  1FZG A;  2LXH C;  1KIL B;  1JO5 A;  1KQL A;  2FSA A;  1YTZ I;  3ASL A;  1CI6 B;  5CMZ A;  2JRJ A;  5BVZ A;  2L43 A;  1CHC A;  2KSJ A;  5AVV B;  1WEV A;  1NWQ A;  3VN0 A;  2IPP A;  3RK2 D;  2K1J A;  1RF1 C;  5KJ7 D;  4DZO A;  2HOD A;  2LGL A;  1LT9 A;  1J1E B;  1IK9 A;  1FZE A;  4I7C A;  1M1J C;  4JYB A;  1J1E C;  2W6B A;  4C7R A;  2Q3I A;  4V3K C;  3A3Y B;  1Z60 A;  2MA5 A;  1JMM A;  2YKQ A;  1LTT C;  2M85 A;  1RE4 C;  3MIW A;  1WEQ A;  2VPG A;  3VOP A;  3NG2 A;  2VJF A;  4FK5 A;  3L35 A;  2YKP A;  1G1J A;  2N1T B;  3VMZ A;  1L4A C;  3G3Z A;  4P5O B;  4WA6 A;  4N6J A;  2R32 A;  5BU8 B;  1V87 A;  3I5C A;  1LTJ A;  5DIN A;  1JTH A;  2G6Q A;  5FB0 A;  1SQV K;  5KH9 A;  1IO4 A;  3HUS A;  3H32 A;  3U1C A;  2WZ7 A;  1GK6 A;  3OA7 A;  2YU4 A;  1VD4 A;  1X9V A;  2HPC B;  1MZ9 A;  3IHP A;  5DKA A;  1KIL A;  2HYE D;  3T7L A;  4AP4 A;  2CPS A;  2Z5H A;  2MIQ A;  2KYU A;  3LQJ A;  2NPS A;  1KZU B;  2MNZ A;  2RSD A;  1IYM A;  3RK3 C;  3VK6 A;  2CT2 A;  3LIE A;  5H1V A;  5APY A;  3SHB A;  3RL0 C;  4V3L C;  4YBT A;  1G25 A;  2Z4E A;  1ZN5 A;  3M99 A;  1WES A;  1HGZ A;  4W7Z A;  2IFM A;  5FEY A;  1G1I A;  3KNV A;  2KYV A;  2JMD A;  3HD7 D;  1JCC A;  3HCS A;  3O37 A;  2WIT A;  2EGP A;  1L4A D;  2OYH A;  2VPD A;  4L58 A;  4W4U A;  3PUR A;  1GTW A;  3QZV A;  1L4A B;  1W2E A;  5LKT A;  2WT7 A;  1N2D C;  3M0D C;  4FJC A;  4NN2 A;  2LGG A;  4ZDT A;  1N73 C;  2F42 A;  1FAV A;  1HYJ A;  3RL0 D;  2ZET C;  1RY3 A;  2Z5I A;  2Q9I A;  5LCW B;  2K4D A;  3HE5 B;  5AW1 B;  1X4J A;  2GM4 A;  5I3L A;  1IFD A;  4BHW A;  5CCG C;  1ZR2 A;  1WE9 A;  3LQH A;  1G2C A;  4GNE A;  3EFG A;  3TNU B;  2KIZ A;  1DX7 A;  3U1A A;  4B7Y C;  4IC2 A;  1LTA C;  1Z56 A;  2FYU K;  5LKX A;  2RI7 A;  1HTL C;  3DQV R;  4O64 A;  1ZBD B;  5D1K B;  4WY4 A;  1RMD A;  3M62 A;  2YRE A;  5KLV K;  2YHN A;  5LKU A;  1T2K D;  1A02 J;  1NOH A;  4LLH A;  3RL0 B;  2F6J A;  3CL3 D;  2XDJ A;  4GNF A;  5APQ A;  1N87 A;  1WEU A;  1JY2 O;  4GND A;  2H7H A;  2NPS B;  1NTK K;  5CJ0 A;  5JG6 A;  3KV6 A;  5G04 B;  3U5P A;  1MUU A;  3M9H A;  1WIM A;  5LKZ A;  5TDW A;  2VNF A;  1X8Y A;  1WIL A;  1GU4 A;  2QM8 A;  3M06 A;  3HD7 B;  4N78 D;  5AW8 B;  3LRQ A;  3ZYQ A;  3BVH A;  5AW5 B;  3R2P A;  4PTB A;  2CSZ A;  4EIJ A;  3SOW A;  1IFM A;  3VP8 A;  1LTG C;  4LAD B;  2ECW A;  1AQ5 A;  2P67 A;  4IFF A;  4N4F A;  4IFD K;  2HFE D;  4N3Y B;  3T6R A;  2O01 H;  1EQ7 A;  3V5B A;  2WPS A;  5D1L B;  1VDF A;  5AW9 B;  3O33 A;  5G0F A;  1VPC A;  2YQL A;  4R8P K;  1FZA A;  2WSE H;  3U5N A;  1KIL D;  3VTP C;  1JY3 N;  2YW8 A;  1SLQ A;  1WEN A;  4OH8 B;  3LQI A;  5B8D A;  2XNX A;  5AVR B;  1LTJ C;  2J58 A;  3NTN A;  1FZB A;  1NAF A;  1J2J B;  1OWA A;  1HJB A;  2ECV A;  2A45 I;  5AVX B;  3I2D A;  2KWN A;  3GHG B;  4F52 B;  2UZG A;  2Y43 A;  1NU1 K;  1N7L A;  5EYA F;  1FBM A;  3HD7 C;  4AUQ B;  2XB1 A;  1IFN A;  2VJE B;  2MJZ A;  1CI6 A;  1JY2 N;  1GD2 E;  1L0L K;  5AIU A;  5AW3 B;  1VYX A;  5H1T A;  2OYI C;  1FDM A;  2C9N Y;  2I50 A;  1NH4 A;  5B76 A;  3E1I A;  1SQB K;  2ECJ A;  1JNM A;  1ZV8 A;  3RPG C;  5C13 A;  4I6M C;  2O1J A;  4AUW A;  4R7E A;  1MM2 A;  4M3L A;  2QIZ A;  3L4F A;  2OYH C;  2A45 H;  1JM7 B;  3HE5 A;  3CI9 A;  2OYH B;  3M0D A;  4LC1 A;  1HH0 A;  5KTB A;  3KPE A;  1JY3 P;  5AW0 B;  1LGH B;  3SWF A;  5AVU B;  1GL2 C;  4ZUX U;  4HYT B;  1XTG B;  1ZLL A;  4QF3 A;  2OAR A;  3PHD A;  4Y99 C;  2NPS C;  1N7S B;  1H88 A;  3ZVZ B;  2YO2 A;  1RF1 B;  1SVF A;  5CJ4 A;  2R3C A;  3C9I A;  4UP5 A;  1G2C B;  2XZR A;  5APU A;  4LGD E;  4AYC B;  5H1U A;  1LWU C;  1H8A A;  4S3O B;  3EB5 A;  2HLO A;  2JEE A;  1GW4 A;  4ZKP A;  1KFN A;  1T2K C;  2DX8 A;  2FXM A;  3U59 A;  4YBS A;  1JY2 P;  2KWK A;  2XV5 A;  2BAS A;  3TYY A;  2M3H A;  2MNY A;  3VMX A;  1NHL A;  2KWO A;  4WY4 D;  5APS A;  4I1L A;  1SP4 A;  2VRS A;  3N4X A;  1U6G B;  3A7O A;  2LN0 A;  5APT A;  2KOG A;  3RTR B;  4A4C A;  2EOD A;  4WZ3 B;  4RES B;  3A5T A;  2JMJ A;  3V2P A;  5KH3 A;  3T97 A;  3HCU A;  4XI1 A;  4CCG X;  1MFZ A;  3L36 A;  5TDR A;  3LW5 H;  2KP8 A;  3B5N A;  4R2Y A;  4I7D A;  1MM3 A;  3P32 A;  2L5G B;  2R5D A;  5AW4 B;  4C7N B;  5B75 A;  3P8C E;  4AQR D;  2PP6 A;  2VJE A;  4I7B A;  3ZVY A;  2ZFC A;  2ECI A;  1RF0 A;  3BAS A;  3GHG C;  5AVW B;  2CPB A;  2H43 A;  3L37 A;  2NPS D;  1FZC A;  2HOD B;  2W6A A;  3C6W A;  3TK1 A;  3N9O A;  2WPQ A;  1MV8 A;  4S3O C;  5B77 A;  1Z6U A;  3P8M C;  2XEU A;  3HTK C;  2PNX A;  1NTZ K;  1SFC D;  1FBV A;  3N9M A;  2MUM A;  1DEB A;  1GW3 A;  1URQ C;  3OAK A;  2I1K A;  2C2L A;  4MSX A;  4W7Y A;  2BAY A;  1URQ B;  3HE4 A;  4YAB A;  1N73 B;  3DPL R;  4YC9 A;  3O7A A;  3M9Q A;  1GK4 A;  5AIT A;  5KJ7 A;  2A45 G;  3OJA B;  2OYI B;  1AFO A;  5TBN A;  2G45 A;  2YKO A;  2IDA A;  3M63 A;  3L1X A;  2KR4 A;  1LTB C;  2WWW A;  4YAD A;  5C11 A;  1RF0 C;  3GHG A;  3IR9 A;  1WEM A;  2E6R A;  4YAX A;  4UP0 A;  2N9B A;  2C0X A;  5CCG A;  2YT5 A;  3VYI A;  2MT5 A;  3MD0 A;  4GIF A;  2GUV A;  3B5N C;  3HTK A;  1WGM A;  3UIA A;  4QF2 A;  5CCH C;  4LLB A;  4L7X A;  3B5N B;  1GZL A;  1XTC C;  2LXP C;  3KDP B;  3V2N A;  5AVY B;  2LGK A;  2ECN A;  2MD7 B;  1E4U A;  1PFI A;  2H0D A;  3KYQ A;  1RE4 A;  4LKA A;  4A4B A;  2CSY A;  2G43 A;  2YSJ A;  1QL2 A;  4WY4 C;  1CW5 A;  2D8S A;  3MHH A;  1M1J B;  2FUU A;  2HYN A;  4IFM A;  3GL6 A;  3ZPV 1;  1M1J A;  1JCD A;  3M9B A;  2NAA A;  2LRI C;  3A2A A;  3KV5 A;  2J59 M;  3MGN A;  2P2U A;  4TKP B;  4WB4 A;  1IFI A;  3NFQ A;  2C2V S;  1GL2 A;  1LTI C;  3HRN A;  2EA6 A;  2L75 A;  5AW2 B;  1FU1 A;  3V2Q A;  1WEO A;  3N9L A;  4UI9 B;  4YAT A;  1CSB A;  3EQ2 A;  2W27 A;  4WBA A;  5BU5 A;  5AVS B;  2QM7 A;  2N1T D;  2WTY A;  3B5N D;  1DH3 A;  1LDK C;  5FER A;  2VPB A;  1N7S A;  2LV9 A;  5TAB A;  2IX7 C;  1JTH B;  4EOT A;  3U5O A;  2E43 A;  1IC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...