4AYCA

Rnf8 ring domain structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
136
structure length
136
Chain Sequence
LGSMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 48
structure length 136
sequence length 136
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aycA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycA02
1T2KC 4UP5A 2UZGA 2RI7A 1G25A 2BASA 3P32A 3L35A 3VYIA 4FO9A 2R5BA 1NWQA 3LQIA 3DQVR 4PTBA 4L58A 1WILA 5LCWB 1HWTC 5G0FA 3HCTA 4FK5A 4ZDTA 2Q5UA 1S9KE 5AIUA 4AQRD 2CKLB 2QM8A 2VPEA 3VN0A 2QICA 5D1KB 3M9HA 1JM7A 2LV9A 4YABA 1H8AA 4JYBA 2VPBA 2YT5A 2Q3IA 1DVPA 5AVVB 4ZQLA 3OAKA 2YQLA 2L5UA 4CA1A 3N9LA 4FJCA 4I2LC 2MNZA 5KH7A 2LXPC 2R5DA 2LXHC 3RPGC 3N9QA 2WPSA 5APYA 2W6AA 2K16A 2KIZA 2XV5A 5AVWB 2Y1NA 5AVRB 1Z2QA 1Z60A 5AW7B 2WT7A 1X8YA 5APTA 1IYMA 1VFYA 1YYCA 4AUWA 1GU4A 4Q6FA 3ZPV1 4GT1A 3I2DA 3NG2A 1FP0A 5B77A 4DZOA 2L0BA 2M3HA 4AYCA 2M85A 2VJEA 1T1HA 1JM7B 4GKGA 5DINA 5AVUB 4UP0A 2KGIA 1MV8A 2VJFA 1E4UA 2N9BA 3P7KA 1JNMA 3KNVA 1WEEA 2JJLA 3O36A 3M0AA 3EB5A 2KYUA 1SLQA 5FERA 5B76A 4PPEA 3GV4A 4FIPA 1X4UA 4YC9A 3M06A 3NFQA 3A2AA 2P7JA 1S9KD 4GNEA 4YADA 1IO4A 2FSAA 2KWOA 4BBQA 4WZ0A 5LKZA 1V87A 3O37A 1CSBA 2YREA 2WTYA 1VYXA 5FEYA 2ZXEB 4LK9A 2LGGA 2WT7B 4XI1A 1X4JA 2OXQC 2G45A 3A5TA 1FAVA 3A7OA 4S3OC 2F6NA 4WA6A 2VNFA 1WEVA 3HE5B 4R7EA 4A0CD 2VPDA 3IHPA 2VJEB 3V4WA 3U5MA 2VPGA 3ASLA 2HDPA 4L7XA 5H1VA 2L80A 3ZVZB 5D1MB 2VJFB 1NAFA 2CT2A 2JMIA 1OXZA 5AW3B 2E6SA 3MHSA 2Q7CA 4LJNA 2YO2A 4AVXA 1GD2E 5APUA 1CZQA 5B78A 4X3GA 2XB1A 3L1XA 2C2LA 3FL2A 5TBNA 2ECGA 1T2KD 1GK6A 5CMZA 4W4UA 3M63A 4V3KC 3O34A 2MUMA 2QJ0A 3M9BA 1CHCA 5APXA 3SOWA 2K4DA 1WFKA 2VP7A 4AUQB 3L1ZB 2QIZA 2FUUA 4I7DA 3SHBA 2MT5A 3HCSA 3SOXA 2MNYA 3DPLR 3VMXA 3MHHA 2RSDA 4QF3A 3LQHA 5AW2B 1WENA 1HBWA 5TABA 5APWA 1N87A 4R2YA 4UI9B 3N9PA 4S3OB 4GNGA 2DX8A 1FBVA 4LADB 2P67A 4MVTA 3TNUA 4YBTA 5B79A 2ECJA 5H9MA 2CSYA 1MUUA 2YHNA 2K1JA 1WEPA 5C13A 2Z5HA 3L11A 5JG6A 4YBSA 3GL6A 5DKAA 2QM7A 1J2JB 2KWJA 2IPPA 3ZVYA 5AVZB 2H0DB 2LGLA 2ZETC 3PUQA 1G2CB 4YBMA 5D1LB 5APSA 4ZUXU 1GTWA 3HE5A 2M1RA 3V5BA 1A02F 2Y43A 4P5OB 2YURA 4A49A 4B86C 5H1TA 2FUIA 1HYIA 1WEMA 4EOTA 1X4IA 3M99A 2ECTA 1GU5A 2EA6A 2YW8A 4B86A 3O7AA 1F62A 5AVTB 3PURA 3KV5A 3VK6A 2F6JA 2ECNA 2MA6A 4IC2A 3TNUB 3ZTGA 3NXSA 2WWWA 1CI6A 2JRJA 3B8EB 2WPQA 1WEQA 4I6MC 1U6GB 2F42A 3T97A 2MA5A 3MGNA 5G04B 2WPRA 4I7CA 2KP8A 5AW4B 2AN6A 3V4QA 2LN0A 3MD0A 4LLBA 4KHXA 2YUCA 1OWAA 3V43A 3N9OA 1HYJA 3C6WA 2NAAA 3LRQA 2PUYA 3IR9A 2BAYA 5EYAF 3VMZA 5FB1A 1GZLA 5AVQB 4QF2A 3O70A 4XE5B 3I5CA 2LGKA 4C7NA 2KFTA 2YSJA 3VTPC 2ECIA 2YU4A 2IDAA 2PNXA 2KGGA 2KE1A 1VD4A 2M6MA 2LRIC 5AVYB 1WEUA 1WE9A 5B75A 3U5PA 2H0DA 5KH3A 1H89A 3ZNIA 2MD8C 2EODA 1CI6B 5AW1B 4C46A 4WZ2A 3KV6A 1LDKC 4C9ZA 2R3CA 4LC1A 2JMDA 2ECVA 4B7YC 4WZ3B 1WIMA 2KREA 3O33A 1HUCA 5APQA 2D8SA 5AITA 2ZFCA 3L36A 3M0DA 5AW9B 2I50A 5I3LA 2G6QA 2C9LY 1JOCA 3C5KA 5B8DA 3EB6A 2YSMA 4RESB 2H7HA 1HJBA 5FB0A 5TRBA 3SOUA 5LKUA 2XZRA 4C7NB 3ZYQA 5AW0B 3U5NA 3LIDA 5AVSB 4GNDA 1H88A 1JUNA 2E6RA 2VRSA 2MIQA 3O8ZA 2L43A 1WEWA 4F52B 5LKTA 4O64A 3HE4B 4BHWA 3A3YB 3VMYA 2C2VS 4JYCA 3L37A 2LGVA 4N3WA 2P2UA 4V3LC 1DH3A 2L75A 3PHDA 3T6RA 4TKPB 5LKXA 1MFZA 3NMDA 3HCUA 1K2FA 1RMDA 5G05B 2YNYA 1WESA 3KDPB 4GNFA 5J3XA 3RTRB 2LQ6A 4HYTB 3LIEA 4A4BA 2C9NY 1KQLA 2G43A 1MM3A 2KWKA 3QZVA 3U5OA 4LKAA 3LQJA 5C11A 2YHOA 4R8PK 1Z6UA 1SP4A 2R32A 3TK1A 4A4CA 2Z5IA 1WGMA 5TDWA 1GK4A 4GB0A 3M62A 3T7LA 2LDRA 2CSZA 1LDJB 3N9NA 2KU3A 2EGPA 3HTKC 4AP4A 4I7BA 2XEUA 3SWFA 2K17A 3NTNA 4CCGX 5AW8B 1FOSE 4M3LA 5TDRA 4MSXA 3N9MA 1FOSF 2JMJA 2YO3A 2XU6A 3UIAA 4NN2A 3HTKA 3O35A 2MD7B 4IC3A 2E43A 1BORA 1MM2A 2YQMA 5H1UA 1A02J 2KR4A 2Y1MA 5AW5B 2CKLA 3TYYA 4YAXA 3RPGB 2W27A 1WEOA 3M91A 5KH9A 5APVA 4N4FA 3KQIA 2HYED 2YYRA 5AW6B 2ECWA 2E42A 4YATA 1XWHA 4AYCB 3KQGA 1ZBDB 2KWNA 3ZPVE 3HE4A 3P8MC 5AVXB
chains in the Genus database with same CATH superfamily
1N7SB 4UP5A 2WSFH 3P32A 2GUVA 1GW3A 1U7JA 2FYNC 3HCTA 4FK5A 1M1JA 4K35A 1BE3G 2YMYA 2KS1A 3KZIE 4W80A 5AIUA 3KDEC 5DJTB 2CKLB 2QM8A 2VPEA 3VN0A 3PLNA 1XTCC 3L73J 3TSIA 3L72J 3LDYA 4HKZH 1AVOA 4JYBA 4OGQC 3CXHH 5CJ4A 4Y99C 3SFEC 2WSCJ 2P57A 4KJMA 3O6QA 2MNZA 5KH7A 2QJYB 3IN6A 3RPGC 1S1CX 3USSA 2WMMA 1YQ3C 2K16A 2E76C 3D70A 5AVWB 2Y1NA 1M7LA 4OH8B 4QQ4A 2HPCA 1GU4A 3I2DA 3NG2A 3L74J 4WY4D 1PPJD 1LGHB 1G1IA 4CPGA 2M85A 3CL3D 5TJHA 1JM7B 3L75G 1EQ7A 1JY3N 1EZVE 1NOHA 1VF5B 4L73A 2VJFA 1RF1A 1E4UA 1NAYA 2JDIH 4QMAA 2N9BA 1WEEA 3EB5A 5B76A 2HFED 4FIPA 3GG2A 2A06E 1ZLLA 3A2AA 2E74B 5GTIE 4GNEA 4YADA 2KWOA 4BBQA 4WZ0A 1V87A 1NTMG 2YREA 1Q90D 1VYXA 2EXUA 1SQBJ 2B0OE 1X4JA 3A5TA 3A7OA 1EXJA 2F6NA 3SUBA 1WEVA 4R7EA 2D2CB 2E5YA 3DWDA 2VJEB 3V4WA 5H1VA 2L80A 1ZOYC 1SQQG 1L0NJ 5CCHD 3CXHD 4PV1B 2CT2A 1OXZA 2JMIA 5AW3B 3E1IA 3MHSA 5KJ7A 2IDBA 4LJNA 3HD7B 1WMKA 1HTLC 5B66H 5KLVG 3KYQA 5B78A 2C2LA 3WU2E 2ECGA 3SSUA 1GW4A 2N1TD 3O34A 2BCCE 1YHQP 2MUMA 2QJ0A 2Q1KA 1LTJC 2MJZA 3CXHI 3CX5H 2K4DA 1SQXD 4I7DA 2QIZA 2FUUA 3H1HG 2MT5A 3HCSA 3SWKA 3IAOA 3VMXA 2RSDA 1FE6A 1RH5B 1GDTA 5EFWB 3TGUD 2HG5D 4UI9B 4S3OB 1P84E 1SQPD 2Y9ZA 1S5LE 1NKNA 4LADB 2IBZD 3T9KA 1URQA 2CSYA 3FM8C 4YPCA 1KQFB 5JG6A 1NJIQ 2K1JA 3GL6A 2FYUD 2PAJA 5SVXA 5KKZC 1L4AD 2QM7A 2IPPA 1NU1J 3PUQA 3HUSA 3CPWO 3LW5J 1GTWA 3CWBE 3HE5A 3WUUA 2IBZI 2Y43A 1RF1C 1BSNA 1KZUB 3L71E 4B86C 1HYIA 2NPSB 4HH2A 4EOTA 3MIWA 5E79H 1R5SA 2ECTA 3G71P 3EFFK 1Y9BA 3CCQP 1VQLP 2YW8A 3H1KG 3PURA 2GUSA 2ECNA 4IC2A 1JY2P 2XDJA 3ZTGA 2JRJA 4Y28J 1J1DC 2WPQA 3B8EB 4I6MC 4H0LB 3V2NA 4IFMA 3E2DA 2MA5A 4OGCA 2Q6QA 1SVFA 2AN6A 2B89A 4LLBA 3D71A 2YUCA 3FWLA 1PP9J 3C6WA 3L73E 1K05A 3CX5D 3IR9A 1LT1A 5EYAF 3L72E 2AEFA 4QF2A 1IC2A 2E5TA 3CCSP 2LGKA 3RK3D 4C7NA 2ECIA 2IDAA 1EDIA 2QEXP 2LRIC 2LXBA 1PFIA 4NPDA 5B75A 2M0BA 2HODB 2H0DA 3CX5I 1H89A 5GTHE 3ZNIA 2FD4A 2EODA 5AW1B 3RGUA 3M0DC 3O47A 2WSEH 2KIKA 3H1KE 1AA0A 2JMDA 3T97B 1JY2O 2XOCA 3H32B 2QSIA 1ZRTD 2D8SA 2Y9YA 3BCCJ 3L74E 3L36A 1OVUA 2DSMA 1RQUA 3JCUE 3C5KA 2YSMA 4RESB 2H7HA 3SOUA 5TRBA 2JKVA 3WUTA 2CK3H 3FXEA 3MUDC 4OVNF 3ZYQA 5AVSB 1H88A 4Z1MH 3Q3DA 2MIQA 1YIJP 3P8CD 2P1JA 3HE4B 3ABVC 2W6JH 4UB8E 1SQBE 3G9RA 2LR2A 5KAIE 4PD4H 5K5GB 1QVFO 4H9DA 3QH9A 1NO4A 2ZVOB 4TKPB 3HCUA 1W5CE 2ZVNB 3FANA 5J3XA 2JP3A 1VPCA 4I7ZB 2C9NY 1N7SC 2G43A 4ZKPA 1MM3A 1HJ0A 1FJPA 1FDMA 1L0NE 1NTZD 4ZNCA 3L70J 4KT0J 3TK1A 1BDCA 1K04A 4U3FG 2Z5IA 1WGMA 2CRRA 3N9NA 2KU3A 2EGPA 2OTLP 2ZXXA 2XEUA 5TDRA 2K9JA 2B88A 3H1IG 2YO3A 3UIAA 1IJDB 2MD7B 4O62A 3GHGB 1A02J 1KB9H 1RF0A 1W2BO 1T8ZA 4WY4B 1SQVD 3M91A 1EC5A 1RE4C 2QJYC 5AW6B 3LVRE 3SWYA 4BXLA 3A0HE 1DCQA 1SQBK 2E42A 3LVQE 1U7MA 1BCCJ 1DIPA 1L0LG 3KQGA 1FBMA 1ZBDB 3CCLP 2J5UA 1T2KC 5TISH 1YJ9P 3U1AA 1BGYJ 2BASA 1NU1E 2K3RA 1OW8A 4RO0A 1N73A 3H1JD 3AE9C 4IL6E 1PV3A 4GIFA 5LCWB 3RL0C 1L0NK 3EFGA 5G0FA 4EI2A 4D6TG 2ITAA 3HTKB 1VQMP 3M7KA 1S9KE 5K3QA 2E75D 3N7NA 5BU5A 4H44D 4PD4D 1VF5C 1USDA 3LJUX 2AEMA 3MTUE 2W6BA 3F5HA 2H43A 4TT3H 2K9YA 1FZCB 4JPZB 2RKLA 1BE3D 3BASA 2VPBA 2KSJA 1LP1B 2Q3IA 3FGAD 1M1KQ 2CPBA 4PD4I 4CA1A 4RKUJ 1E5WA 1YITP 4FJCA 1E79H 1KYOH 2R5DA 2LXHC 2AXTH 3N9QA 2WQYC 2WPSA 3BVHA 5C39A 3QWOC 5CCGD 5APYA 4DJGA 1MFTA 2W6AA 3RL0g 1OVRA 2D2CC 1Z2QA 1NH4A 2WT7A 1X8YA 5APTA 1IYMA 2N1TB 4YXDC 1PP9E 1HH0A 2M8RA 1N86A 4Q6FA 2H89C 4GT1A 1MZ9A 1FZBA 1KB9D 3DDTA 4DZOA 1NU1K 2L0BA 1NTKJ 4PV1C 1JM0A 1RHZB 1N2DC 3VP8A 3HD7C 4GKGA 5AVUB 2KGIA 2HLOA 1JNMA 1LTIC 3G3ZA 4U7JA 3O36A 3L75D 2OQQA 2KYUA 1KB9I 2FFWA 1SFCD 2FBWC 3H1LJ 1X4UA 4YC9A 2KKYA 2KLUA 1KQSO 1IO4A 2FSAA 3C8VA 3HRNA 1L4AB 3V2RA 3BCCE 2WTYA 3S4RA 2ZJSE 4LLHA 4LK9A 1VQ9P 2LGGA 1IFMA 3S1KA 3CC2P 4S3OC 3RK2C 4WA6A 2VNFA 1NTMD 3HE5B 2A45G 1RY3A 2R44A 2JM3A 4K3AA 1X79B 4MN4C 2VPGA 2IFNA 3VP9A 1H0TA 4LGDE 2XOYA 1NAFA 1USEA 2E6SA 3B4SA 1LT9B 2YMKA 2YO2A 2ZT9D 5APUA 1CZQA 1KYOD 2XB1A 1SQQD 1G2CA 2PGDA 1EZVG 5CMZA 3M63A 3D6YA 2NPSC 1BCCG 2V7QJ 5KLVD 3M9BA 1CHCA 2OYHB 5APXA 3SOWA 4NPFX 1LWUB 1WFKA 4BRYB 3SHBA 2A06G 1KYOI 3L70E 1OVVA 1LTJA 1HVVA 3LQHA 4EIJA 1WENA 3RK3B 5TABA 4H0LC 1N87A 3H1HD 2C0XA 4MVTA 4YBTA 5DJUB 5B79A 3MHVA 1PIXA 4UB6E 5H9MA 1MUUA 2YHNA 5C13A 1WEPA 3Q5PA 3L11A 4YBSA 1PGQA 3EQ2A 4N78D 5DKAA 2H8PD 4XFJA 2Q9IA 3ZVYA 1FZFA 2H0DB 2ZETC 5APSA 2L5GB 3W68A 3II6A 1A02F 1OW7A 2WSFJ 2FXMA 2Y0DA 1K8AQ 2YKPA 2WITA 1WEMA 1BCCE 4F1PA 3M99A 1YJWP 2SPZA 2BCCG 1GU5A 3S9OA 1G1JA 2EA6A 5SVIA 4B86A 1F62A 1BGYE 5AVTB 3AE7C 3TNUB 3NXSA 4O9BA 1CI6A 1WEQA 1UIIA 2YVRA 1U6GB 2RN0A 5M1BA 2F42A 1KD1Q 1KILE 2WPRA 3AE8C 5AW4B 3AE4C 1SS1A 3V43A 2PUYA 4DOJA 2BAYA 2CPSA 1GZLA 1JCDA 1M57D 1GL2B 3CCRP 3K5BA 2YSJA 2YU4A 2KGGA 2KE1A 3CWBG 1KMIZ 1SQXJ 5CBOA 3L71G 3U5PA 5KJ7D 1YTZI 2FXPA 5H2FH 2QE7H 2MD8C 3TGUJ 3KV6A 1JTHB 1SQPJ 4PJ0H 4I7ZC 1WIMA 4OGEA 3I55P 1T3JA 3M0DA 2FYUJ 4WB4A 1NTKE 2OYIB 2JUNA 2G6QA 2EGMA 1W2EA 2KNCA 5AW0B 1YJNP 3LIDA 1JUNA 2E6RA 1VQ4P 3CI9A 1S5LX 3H1LE 1KC8Q 1URQD 3L73G 3GHGC 5LKTA 3MUDA 3L72G 3A0BE 3M9QA 3TF5A 3IFMA 4YTPC 2P2UA 4WY4C 4TLFA 3H6PA 4V3LC 1IFPA 1HGZA 3AE3C 2L75A 3PHDA 5LKXA 1EDKA 3CMAP 3KXDA 1R5LA 3G6EP 4JBZA 2J58A 2E75B 4H44B 3RTRB 3FX0A 2LQ6A 4HYTB 1FZAA 3LIEA 4A4BA 2YKOA 2KWKA 3U5OA 3AEEC 1SP4A 3L74G 1N7SA 1OZHA 1KILB 2CSZA 4I1LA 2LDRA 1NTKK 1Q2NA 1LDJB 3HTKC 4AP4A 2KXPB 1IFNA 4CCGX 5AW8B 2Q3EA 4U3FD 1JO5A 5KAFH 2JMJA 4NN2A 2XU6A 1FZCC 4IC3A 1AJYA 1GMJA 2OTKE 2YQMA 1IZNB 2KR4A 5AW5B 2CKLA 3TYYA 1JB0J 2RH0A 3GMAA 1DD3A 3RPGB 3H1ID 2FFDC 2W27A 2KZJA 5KH9A 3B5NB 4N4FA 2KSEA 5CCHC 2I1JA 1SQBG 2IQJA 1XWHA 1PPJE 2M5AB 3PJSK 2DW3A 2K1AA 4IFFA 2HR3A 2QVAA 1RE4A 1IFJA 1IK7A 2JWDA 1NYHA 2ZYGA 2N1TC 2Z4EA 2PP6A 1G25A 3VYIA 4FO9A 1NWQA 3LQIA 4PTBA 1MKMA 4L58A 2OWAA 1SFCB 1L0LD 1RE3C 1WILA 3U59A 1L0NG 1FS0E 2ZAEB 4ZDTA 2Q5UA 2IYOA 1T6AA 2KOGA 2NRGA 2GM4A 4GDOA 1VL2A 1YQ4C 4BWNA 4D6TD 2QICA 1JM7A 3RL0D 2LV9A 2CRWA 4YABA 1H8AA 1PGJA 1Y47A 1J1EC 2P10A 1M90Q 2A45H 2IBZG 2YT5A 2XP0A 1KTMA 1L4AC 1LTTC 2YQLA 3GLMA 1IFDA 3FJUB 1QL2A 3N4XA 4L76A 1NTZJ 2ZT9B 3CXHE 1QEXA 3BATA 1WRGA 5AVRB 1Z60A 1VFYA 1M1JB 1YYCA 2KS1B 4DT0A 4R4LA 1NVOA 5B77A 5CJ0A 1NU1G 4JQ0D 2M3HA 4AYCA 2WSEJ 5KTBA 2VJEA 1LT9C 1T1HA 2LAUA 2CSVA 1SQXE 1YBKA 4OWFA 5GTIH 2POHA 3U1CA 1KFMA 2FXOA 2QJKB 1SQVJ 3JSVC 3HD7A 2JJLA 3M0AA 3TGUE 3O6QB 4PV1D 3WUVA 3AECC 2OYHC 1KORA 1SQPE 3M06A 3HD7D 4H13D 2XNDH 2IBZE 1LWUC 3PH0A 3O37A 1CSBA 2O01N 2ZXEB 2B9BA 2FYUE 3V2PA 4L74A 2OXQC 2RMZA 3RK3C 2IZ1A 2HPCB 2FY8A 3PHLA 3H1JJ 1FAVA 4A0CD 2VPDA 1CW5A 1JY2N 3GF3A 3IHPA 3R2PA 2HDPA 4ASWA 2N9YB 3WU2H 3ZVZB 1PP9G 5D1MB 3OA7A 1DD4A 2VJFB 1RF1B 3RK2D 3V2QA 1BE3J 4WVZA 4AVXA 3CCUP 1VQ7P 2WVRA 2YXRB 4IL6X 1L2PA 1X0TA 1GK6A 1SQXK 4W4UA 4V3KC 2A45I 2NZ2A 2QJPB 5B66E 3B71A 1P84H 4AUQB 1EZVD 1S5LH 2G3AA 2NPSA 2MNYA 3DPLR 2K37A 2E74C 2XNXA 2WPVB 4QF3A 2NPSD 5AW2B 3AE2C 3BCCG 2I8DA 1PL5A 3CX5E 1N8RQ 2FYUK 2A06D 2DX8A 1FBVA 2P67A 3RK3E 1MBMA 2XOZA 1EZVI 4WWIA 4OGQD 1ZR2A 2Y0CA 1LTBC 3TDKA 1J2JB 2RR4A 1U57A 4GOFA 1HGVA 3AEDC 3CCEP 1DX7A 5D1LB 2O01H 1GL2C 3L75J 2E76D 1X9VA 1ZRTE 5H1TA 2FUIA 1Q82Q 5KLIB 1X4IA 4C7RA 4JF7A 1AQTA 1NTMJ 1VQNP 2F6JA 2HODA 1JEKA 2MA6A 3VOPA 1KQGB 3AE1C 2WWWA 1PGOA 3C1LA 3VMAA 5E79E 1URQB 1ZXGA 2BCCD 3L70G 2OYIC 1PZQA 3T97A 3MGNA 3Q1MA 3P8CE 1FU1A 4I7CA 3HUSB 2W90A 2KP8A 1QVGO 2LN0A 3AEGC 1JY3O 3MD0A 2K88A 2KI7B 2XKMA 2WSCH 1Q7YQ 1SQQJ 1AFOA 1VQ8P 1ZR4A 2NAAA 3VMZA 1P84D 4XE5B 1FZGA 5GTHH 3VTPC 5KLVJ 2KZIA 3RBXA 2JWAA 1Q81Q 4Z0OA 1WE9A 2JEEA 1NTZE 5KH3A 2QIWA 1P84I 3CWBD 1S3JA 2E75C 1LDKC 4H44C 4C9ZA 3JCUH 3H1HJ 2CONA 1Q86Q 3L71D 4WZ3B 3KPEA 3O33A 2KREA 3PLWA 5APQA 1BGYG 3IF4A 2ZFCA 1EDJA 4HB1A 1YI2P 3SFDC 5I3LA 1JOCA 1KILC 1OX3A 1X22A 2O3JA 3ZDMA 1HJBA 1NGMB 3ITKA 4C7NB 2HYNA 1Y8AA 4UB8H 1SQVE 5CCGC 5KAIH 1VQ5P 2L43A 4ZKUA 1WEWA 1KFNA 4HJGH 4O64A 4BHWA 3A3YB 3VMYA 1JMBA 3JUEA 4JYCA 3L37A 2LGVA 2WZ7A 2W83C 2QRXA 2Y0EA 3B5NC 3I56P 3L73D 3GHGA 3L72D 3H1JE 3KHUA 1MFZA 3NMDA 5G05B 1K73Q 1NTZK 3KDPB 3H1KJ 3RBZA 2JR8A 2QA4P 2KB7P 4WY4A 2M3EA 3G4SP 3H25A 1KQLA 4PD4E 1HF9A 3RL0B 1WT6A 3CCJP 4LKAA 2YHOA 1SFCC 4R8PK 2R32A 4A4CA 1BE3E 4GB0A 4A7PA 3T7LA 1NTKG 3H1KD 1LTAC 3PRJA 2K17A 2B87A 3NTNA 3L74D 2GA1A 4M3LA 4MSXA 3MZWB 4EDFA 2YIUB 3HTKA 3MP7B 3Q5SA 1N7LA 1SQVK 3A0HH 2E43A 1MM2A 3H1LG 1TU3F 1OMIA 1FZCA 1WEOA 3KQIA 2YYRA 3CCMP 2ECWA 1LP1A 1KB9E 1LNQA 2ZT9C 4IL6H 4AYCB 1QGKB 2FFDA 3LW5H 2KWNA 3P8MC 2KUBA 5CCHA 2KK7A 1SQBD 1M1JC 2UZGA 2RI7A 4DCKA 3L35A 2R5BA 2OYOA 3DQVR 4H13B 1HWTC 5B5EH 3L75E 2K9JB 5TISE 2N1TA 3GW6A 1S2EA 1ZV8A 3L4FA 1RE3A 4AQRD 1L0ND 3V6IA 2QJKC 4IFDK 5D1KB 3M9HA 4ZMDA 2PRRA 2KLVA 1NTME 1DVPA 5AVVB 4ZQLA 2L91A 3OAKA 2OARA 2L5UA 3N9LA 3AEAC 4I2LC 2D8UA 3RK2B 2LXPC 1FC2C 1L4AA 2LKMA 1N73B 2KIZA 2XV5A 3R4YA 1PPJG 4W7YA 5AW7B 2JO1A 1KYOE 5BVZA 1SQQE 3D6ZA 4AUWA 2AXTE 1ZP0C 1VQPP 3BRVB 3ZPV1 2IYPA 4GODA 1FP0A 4U3FJ 3OJAB 2IFMA 5KLVE 2FYNB 2R3SA 2WSSH 5DINA 4UP0A 1MV8A 1NU1D 2G8YA 4N6JA 1N7SD 2AEJA 1FZEA 3H1IJ 1LT9A 3P7KA 3KNVA 1DEEG 1SLQA 5FERA 4PPEA 2QJPC 3GV4A 2IX7C 3H1HE 3F89A 2KKXA 3NFQA 4OGQB 2P7JA 1S9KD 3FXDA 5LKZA 4Y99B 1ZN5A 1BDDA 1NTMK 1VDFA 5FEYA 2OGUA 2OYHA 2WT7B 4N78E 1AQ5A 4XI1A 1JCCA 2G45A 1LWUA 1VQKP 4IOIH 4BRYA 1L0LJ 2E76B 3E7KA 4N3YB 5KJ7C 3W67A 3U5MA 3ASLA 4L7XA 4Z0RA 2AXCA 1SQQK 3KZIH 1S72P 4D6TJ 1S4XA 2Q7CA 1GD2E 5KLVK 1LJ2A 3AE5C 4X3GA 3L1XA 3E1RA 1PP9D 3FL2A 5TBNA 1T2KD 1SQXG 1PGPA 1M56D 5KLIC 2H88C 1DEBA 4EYYQ 3CD6P 3H7HA 3TGUG 2VP7A 3L1ZB 2OTJP 1SQPG 3FWNA 4L75A 3SOXA 1R8EA 3MDBC 1T3UA 4UB6H 1BSHA 3BRTB 3MHHA 4NPEA 1UIXA 2ZYAA 1URQC 2QG4A 1VF5D 2ZYDA 2I1KA 2O1KA 1HBWA 1VQ6P 2FYUG 5APWA 4R2YA 3N9PA 4GNGA 1H0TB 1QX8A 3TNUA 3HUSC 1Z56A 2ECJA 3BCCD 2Z5HA 2E74D 1AVYA 3CLQA 2FKWB 2KWJA 1QL1A 1FJKA 5AVZB 2LGLA 4YBMA 1G2CB 3Q2YA 4ZUXU 5CBNA 2M1RA 3V5BA 4YXWH 3Q1DA 1OIPA 2L7PA 4P5OB 2YURA 2D2CD 4A49A 2P58A 1GL2A 3CCVP 5CHXA 1LTJB 1GL2D 1IK9A 4W7ZA 3Q5RA 2BEQD 3O7AA 1QLED 1K9MQ 3VK6A 3KV5A 1ZW0A 3FEHA 4RJTA 2V4HA 3C9IA 1JTHA 5G04B 2DJAA 3V4QA 1OFCX 2M3BA 2PFXA 2FYZA 4KHXA 2OYIA 3L70D 3PP5A 1OWAA 1FDOA 3N9OA 5KKZB 1HYJA 1EDLA 3LRQA 5FB1A 5AVQB 3O70A 3I5CA 2KFTA 2PNXA 4XA4A 1VD4A 1LTGC 2M6MA 1YTZT 5AVYB 5L8RJ 1WEUA 2MKEA 5SVIB 1AV1A 1CI6B 4C46A 4WZ2A 1KV4A 2R3CA 2MKVA 3OW2O 4LC1A 1M8OB 3JC22 2ECVA 4B7YC 3AEFC 2W8ZA 2BEZF 1HUCA 2B87B 5AITA 1VQOP 1J1DB 4U3FE 5H2FE 5AW9B 1SQPK 2I50A 1BCCD 2YKQA 1ZMEC 3AEBC 2C9LY 5B8DA 3EB6A 4PJ0E 5LKUA 5FB0A 1BGYD 2XZRA 1EXIA 2YXQB 2M13A 5B5EE 3FAOA 3A0BH 1FDIA 3H1IE 3U5NA 3CMEP 4GNDA 1XTGB 1KILA 1JY3P 2VRSA 2YIUC 3O8ZA 5SVYA 1OW6A 1KILD 4F52B 2IZ0A 2FFDB 4H0LD 1IFIA 2C2VS 3CC7P 5CCGA 3PTZA 2E61A 1LTSC 4N3WA 1DH3A 4ASVA 3T6RA 1L0LE 1K2FA 1RMDA 2BCCJ 2YNYA 1NTZG 1WESA 4GNFA 4WBAA 3CC4P 3B5NA 3QZVA 3B5ND 2M5AA 1NKZB 2KNCB 3LQJA 5C11A 3GF7A 1Z6UA 4D6TE 2C0WA 4H13C 1KN7A 2V7QH 5TDWA 1GK4A 3M62A 4R4MA 1RQVA 1JMMA 4I7BA 1SFCA 3SWFA 3H32A 1FOSE 3AE6C 5BU8B 3EWKA 1NHLA 1RF0C 3N9MA 2J59M 1J1EB 1NTKD 1FOSF 3O35A 2LXCB 1SQVG 1BORA 5H1UA 2Y1MA 3CWBJ 4GOEA 2O1JA 1D7MA 4YAXA 5KAFE 3L71J 5APVA 2HYED 3H1LD 4YATA 2UWJE 2O01J 2KYVA 3WMM0 3H1JG 1N73C 3ZPVE 1L0LK 3HE4A 5AVXB
chains in the Genus database with same CATH topology
1T2KC 5CCHA 1N7SB 4UP5A 3U1AA 1M1JC 2UZGA 2N1TC 2RI7A 2Z4EA 2PP6A 2WSFH 2BASA 3P32A 1G25A 3L35A 3VYIA 4FO9A 2R5BA 2GUVA 1NWQA 3LQIA 3DQVR 1GW3A 4L58A 1N73A 1SFCB 1WILA 1RE3C 4PTBA 4GIFA 3U59A 5LCWB 1HWTC 3RL0C 1L0NK 3EFGA 5G0FA 3HCTA 4FK5A 1M1JA 4ZDTA 2N1TA 3HTKB 1ZV8A 2YMYA 2Q5UA 1S9KE 3L4FA 3N7NA 4W80A 5BU5A 1RE3A 5AIUA 4AQRD 2KOGA 2GM4A 2CKLB 2QM8A 2VPEA 3VN0A 3MTUE 2W6BA 2QICA 4IFDK 5D1KB 3M9HA 2H43A 1FZCB 1XTCC 1JM7A 3RL0D 2LV9A 3TSIA 4YABA 3BASA 1H8AA 1J1EC 2A45H 4JYBA 2KLVA 2KSJA 2VPBA 2YT5A 2Q3IA 1DVPA 5CJ4A 5AVVB 4ZQLA 3OAKA 4Y99C 1L4AC 2CPBA 2OARA 1LTTC 2YQLA 2L5UA 4CA1A 3N9LA 1E5WA 4FJCA 4I2LC 2MNZA 5KH7A 3RK2B 1IFDA 2R5DA 2LXHC 2LXPC 1QL2A 3N9QA 3RPGC 2WPSA 3BVHA 3N4XA 5CCGD 5APYA 2W6AA 2K16A 1L4AA 2LKMA 1N73B 2KIZA 2XV5A 5AVWB 3BATA 1WRGA 4W7YA 5AVRB 1M7LA 1Z2QA 1Z60A 2Y1NA 1NH4A 5AW7B 2WT7A 1X8YA 5APTA 1IYMA 1VFYA 1M1JB 4OH8B 5BVZA 2N1TB 2HPCA 1YYCA 4AUWA 1HH0A 2M8RA 3BRVB 1N86A 1GU4A 4Q6FA 3ZPV1 4GT1A 3I2DA 1MZ9A 1FP0A 3NG2A 5B77A 5CJ0A 1FZBA 4WY4D 4DZOA 1LGHB 1G1IA 1NU1K 3OJAB 2IFMA 2L0BA 2M3HA 4AYCA 5KTBA 2M85A 1N2DC 3CL3D 1LT9C 2VJEA 1T1HA 3VP8A 3HD7C 1JM7B 4GKGA 5DINA 1EQ7A 1JY3N 5AVUB 4UP0A 1NOHA 2KGIA 1MV8A 2POHA 3U1CA 2VJFA 1KFMA 1RF1A 4N6JA 1N7SD 2HLOA 1FZEA 1E4UA 2N9BA 1LT9A 3P7KA 1JNMA 1LTIC 3G3ZA 3KNVA 3HD7A 1WEEA 2JJLA 3O36A 3M0AA 3EB5A 2KYUA 1SLQA 5FERA 5B76A 4PPEA 1SFCD 2HFED 3GV4A 4FIPA 2IX7C 2OYHC 1X4UA 4YC9A 3M06A 3NFQA 1ZLLA 3HD7D 3A2AA 2P7JA 1S9KD 4GNEA 1LWUC 4YADA 1IO4A 2FSAA 2KWOA 4BBQA 4WZ0A 5LKZA 1V87A 3HRNA 4Y99B 3O37A 1CSBA 1L4AB 3V2RA 2YREA 1ZN5A 2WTYA 1NTMK 1VDFA 1VYXA 4LLHA 5FEYA 2ZXEB 4LK9A 3V2PA 2OYHA 2LGGA 2WT7B 4N78E 1AQ5A 4XI1A 1JCCA 1X4JA 1IFMA 2G45A 3RK3C 2OXQC 3A5TA 2HPCB 1LWUA 1FAVA 3A7OA 4S3OC 2F6NA 3RK2C 4WA6A 2VNFA 1WEVA 3HE5B 2A45G 4R7EA 1RY3A 4A0CD 2VPDA 4N3YB 1CW5A 1JY2N 1X79B 3IHPA 5KJ7C 2VJEB 3V4WA 3R2PA 3U5MA 2VPGA 3ASLA 2IFNA 2HDPA 4L7XA 5H1VA 3VP9A 2L80A 3ZVZB 1SQQK 4LGDE 5D1MB 3OA7A 2VJFB 1RF1B 5CCHD 1NAFA 3RK2D 2CT2A 1OXZA 2JMIA 5AW3B 3E1IA 3V2QA 2E6SA 3MHSA 5KJ7A 1LT9B 2Q7CA 4LJNA 3HD7B 2YO2A 4AVXA 1GD2E 1HTLC 5APUA 5KLVK 3KYQA 1CZQA 5B78A 4X3GA 2XB1A 3L1XA 2C2LA 1G2CA 3FL2A 5TBNA 2ECGA 1T2KD 1GK6A 1SQXK 5CMZA 4W4UA 3M63A 1GW4A 2NPSC 4V3KC 2N1TD 3O34A 2MUMA 2QJ0A 2A45I 3M9BA 1LTJC 1CHCA 2MJZA 2OYHB 1DEBA 5APXA 3SOWA 2K4DA 1LWUB 1WFKA 2VP7A 4AUQB 3L1ZB 2QIZA 2FUUA 4I7DA 3SHBA 2MT5A 3HCSA 2NPSA 3SOXA 2MNYA 1T3UA 3DPLR 3VMXA 3BRTB 3MHHA 1LTJA 2XNXA 2RSDA 1HVVA 3LQHA 4QF3A 2NPSD 1URQC 5AW2B 1GDTA 4EIJA 1WENA 3RK3B 2I1KA 2O1KA 1HBWA 2HG5D 5TABA 5APWA 1N87A 4R2YA 2FYUK 4UI9B 3N9PA 4S3OB 4GNGA 2C0XA 2DX8A 1NKNA 1FBVA 4LADB 2P67A 4MVTA 3TNUA 4YBTA 3HUSC 5B79A 1Z56A 2ECJA 1URQA 2CSYA 5H9MA 1MUUA 2YHNA 1ZR2A 1WEPA 2K1JA 2Z5HA 3L11A 5C13A 5JG6A 4YBSA 3GL6A 1LTBC 2PAJA 3CLQA 3EQ2A 4N78D 5DKAA 2FKWB 2QM7A 1L4AD 1J2JB 1QL1A 2IPPA 2H8PD 2Q9IA 2KWJA 1HGVA 1FZFA 3ZVYA 1FJKA 5AVZB 2H0DB 2LGLA 2ZETC 3PUQA 1G2CB 3HUSA 1DX7A 5D1LB 4YBMA 5APSA 2L5GB 2O01H 4ZUXU 1GL2C 1GTWA 3HE5A 2M1RA 3V5BA 3II6A 1A02F 2Y43A 1RF1C 1KZUB 1X9VA 4P5OB 2YURA 2FXMA 4A49A 4B86C 5H1TA 2FUIA 2YKPA 1GL2A 1HYIA 5CHXA 2NPSB 2WITA 4HH2A 1WEMA 4EOTA 3MIWA 1X4IA 3M99A 1LTJB 2ECTA 1GL2D 1IK9A 4W7ZA 4C7RA 1GU5A 1G1JA 4JF7A 2EA6A 2YW8A 4B86A 3O7AA 1F62A 5AVTB 3PURA 3KV5A 2GUSA 2F6JA 2HODA 2ECNA 3VK6A 2MA6A 4IC2A 3VOPA 1JY2P 2XDJA 3TNUB 3ZTGA 3NXSA 4O9BA 2WWWA 1CI6A 2JRJA 1J1DC 2WPQA 1URQB 3B8EB 1WEQA 4I6MC 3C9IA 1U6GB 2OYIC 2F42A 1JTHA 3V2NA 4IFMA 3T97A 2MA5A 3MGNA 3P8CE 1FU1A 5G04B 2WPRA 4I7CA 3HUSB 1SVFA 2KP8A 5AW4B 2AN6A 3V4QA 2M3BA 2LN0A 1JY3O 3MD0A 2FYZA 4LLBA 4KHXA 2XKMA 2OYIA 3PP5A 2YUCA 1OWAA 3V43A 2WSCH 3N9OA 1HYJA 1AFOA 3C6WA 1ZR4A 2NAAA 2PUYA 3LRQA 4DOJA 3IR9A 2BAYA 2CPSA 5EYAF 3VMZA 5FB1A 1GZLA 1JCDA 5AVQB 4QF2A 3O70A 1IC2A 4XE5B 3I5CA 1GL2B 2LGKA 3RK3D 4C7NA 2KFTA 2YSJA 1FZGA 3VTPC 2ECIA 2YU4A 2IDAA 2PNXA 2KGGA 4XA4A 2KE1A 1VD4A 1LTGC 2M6MA 1YTZT 2LRIC 5AVYB 1PFIA 1WEUA 1WE9A 5B75A 2JEEA 3U5PA 5KJ7D 1YTZI 2HODB 2H0DA 5KH3A 1H89A 3ZNIA 2MD8C 2EODA 1CI6B 5AW1B 4C46A 4WZ2A 3M0DC 3KV6A 1LDKC 4C9ZA 2WSEH 2R3CA 1JTHB 4LC1A 2JMDA 1JY2O 2ECVA 4B7YC 3H32B 4WZ3B 3KPEA 1WIMA 2KREA 3O33A 1HUCA 5APQA 2D8SA 5AITA 2ZFCA 1J1DB 1T3JA 3L36A 3M0DA 5AW9B 1SQPK 2I50A 4WB4A 2OYIB 5I3LA 2YKQA 2G6QA 2C9LY 1JOCA 3C5KA 5B8DA 3EB6A 2YSMA 4RESB 1KILC 2H7HA 1HJBA 5FB0A 5TRBA 1W2EA 3SOUA 5LKUA 2XZRA 4C7NB 2HYNA 3ZYQA 5AW0B 3U5NA 3LIDA 5AVSB 4GNDA 5CCGC 1H88A 1JUNA 2E6RA 1XTGB 1KILA 3CI9A 1JY3P 2VRSA 2MIQA 3O8ZA 2L43A 4ZKUA 1URQD 1WEWA 1KFNA 3GHGC 1KILD 3P8CD 4F52B 3MUDA 5LKTA 2P1JA 2FFDB 4O64A 3HE4B 4BHWA 3M9QA 3A3YB 1IFIA 3VMYA 2C2VS 3IFMA 5CCGA 1LTSC 3L37A 4JYCA 2WZ7A 2LGVA 2P2UA 4N3WA 4WY4C 3B5NC 3H6PA 4V3LC 1DH3A 3GHGA 1HGZA 2L75A 3PHDA 3T6RA 1NO4A 4TKPB 5LKXA 1MFZA 3NMDA 3HCUA 1K2FA 1RMDA 2J58A 2YNYA 1WESA 5G05B 1NTZK 3KDPB 4GNFA 4WBAA 5J3XA 1VPCA 3RTRB 2KB7P 4WY4A 3B5NA 2LQ6A 4HYTB 1FZAA 3LIEA 4A4BA 2C9NY 1KQLA 1N7SC 2YKOA 2G43A 4ZKPA 1MM3A 2KWKA 3QZVA 3B5ND 3U5OA 1FJPA 3RL0B 1WT6A 1NKZB 1FDMA 4LKAA 3LQJA 5C11A 2YHOA 1SFCC 4R8PK 1Z6UA 1SP4A 2R32A 3TK1A 2C0WA 4A4CA 2Z5IA 1WGMA 5TDWA 1GK4A 4GB0A 3M62A 3T7LA 1N7SA 1KILB 2CSZA 4I1LA 2LDRA 1NTKK 1LDJB 3N9NA 2KU3A 2EGPA 3HTKC 1JMMA 1LTAC 4AP4A 4I7BA 2XEUA 1SFCA 3SWFA 2K17A 3H32A 3NTNA 1IFNA 4CCGX 5AW8B 1FOSE 5BU8B 4M3LA 5TDRA 1NHLA 1RF0C 4MSXA 3N9MA 2J59M 1J1EB 1JO5A 1FOSF 2JMJA 2YO3A 2XU6A 3UIAA 4NN2A 1IJDB 3HTKA 1FZCC 3O35A 2MD7B 4IC3A 1N7LA 1SQVK 2E43A 1BORA 3GHGB 1MM2A 2YQMA 5H1UA 1A02J 2KR4A 2Y1MA 5AW5B 2CKLA 3TYYA 1RF0A 2O1JA 4YAXA 3RPGB 1T8ZA 2FFDC 1FZCA 2W27A 4WY4B 1WEOA 3M91A 5KH9A 3B5NB 5APVA 4N4FA 1RE4C 3KQIA 2HYED 2YYRA 5AW6B 5CCHC 3SWYA 2I1JA 1SQBK 2ECWA 2E42A 4YATA 1XWHA 4AYCB 2KYVA 3WMM0 1N73C 3KQGA 1FBMA 3LW5H 2FFDA 1L0LK 1ZBDB 3HE4A 2KWNA 3P8MC 3ZPVE 4IFFA 1RE4A 5AVXB 1IFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K C;  4UP5 A;  2UZG A;  2RI7 A;  1G25 A;  2BAS A;  3P32 A;  3L35 A;  3VYI A;  4FO9 A;  2R5B A;  1NWQ A;  3LQI A;  3DQV R;  4PTB A;  4L58 A;  1WIL A;  5LCW B;  1HWT C;  5G0F A;  3HCT A;  4FK5 A;  4ZDT A;  2Q5U A;  1S9K E;  5AIU A;  4AQR D;  2CKL B;  2QM8 A;  2VPE A;  3VN0 A;  2QIC A;  5D1K B;  3M9H A;  1JM7 A;  2LV9 A;  4YAB A;  1H8A A;  4JYB A;  2VPB A;  2YT5 A;  2Q3I A;  1DVP A;  5AVV B;  4ZQL A;  3OAK A;  2YQL A;  2L5U A;  4CA1 A;  3N9L A;  4FJC A;  4I2L C;  2MNZ A;  5KH7 A;  2LXP C;  2R5D A;  2LXH C;  3RPG C;  3N9Q A;  2WPS A;  5APY A;  2W6A A;  2K16 A;  2KIZ A;  2XV5 A;  5AVW B;  2Y1N A;  5AVR B;  1Z2Q A;  1Z60 A;  5AW7 B;  2WT7 A;  1X8Y A;  5APT A;  1IYM A;  1VFY A;  1YYC A;  4AUW A;  1GU4 A;  4Q6F A;  3ZPV 1;  4GT1 A;  3I2D A;  3NG2 A;  1FP0 A;  5B77 A;  4DZO A;  2L0B A;  2M3H A;  4AYC A;  2M85 A;  2VJE A;  1T1H A;  1JM7 B;  4GKG A;  5DIN A;  5AVU B;  4UP0 A;  2KGI A;  1MV8 A;  2VJF A;  1E4U A;  2N9B A;  3P7K A;  1JNM A;  3KNV A;  1WEE A;  2JJL A;  3O36 A;  3M0A A;  3EB5 A;  2KYU A;  1SLQ A;  5FER A;  5B76 A;  4PPE A;  3GV4 A;  4FIP A;  1X4U A;  4YC9 A;  3M06 A;  3NFQ A;  3A2A A;  2P7J A;  1S9K D;  4GNE A;  4YAD A;  1IO4 A;  2FSA A;  2KWO A;  4BBQ A;  4WZ0 A;  5LKZ A;  1V87 A;  3O37 A;  1CSB A;  2YRE A;  2WTY A;  1VYX A;  5FEY A;  2ZXE B;  4LK9 A;  2LGG A;  2WT7 B;  4XI1 A;  1X4J A;  2OXQ C;  2G45 A;  3A5T A;  1FAV A;  3A7O A;  4S3O C;  2F6N A;  4WA6 A;  2VNF A;  1WEV A;  3HE5 B;  4R7E A;  4A0C D;  2VPD A;  3IHP A;  2VJE B;  3V4W A;  3U5M A;  2VPG A;  3ASL A;  2HDP A;  4L7X A;  5H1V A;  2L80 A;  3ZVZ B;  5D1M B;  2VJF B;  1NAF A;  2CT2 A;  2JMI A;  1OXZ A;  5AW3 B;  2E6S A;  3MHS A;  2Q7C A;  4LJN A;  2YO2 A;  4AVX A;  1GD2 E;  5APU A;  1CZQ A;  5B78 A;  4X3G A;  2XB1 A;  3L1X A;  2C2L A;  3FL2 A;  5TBN A;  2ECG A;  1T2K D;  1GK6 A;  5CMZ A;  4W4U A;  3M63 A;  4V3K C;  3O34 A;  2MUM A;  2QJ0 A;  3M9B A;  1CHC A;  5APX A;  3SOW A;  2K4D A;  1WFK A;  2VP7 A;  4AUQ B;  3L1Z B;  2QIZ A;  2FUU A;  4I7D A;  3SHB A;  2MT5 A;  3HCS A;  3SOX A;  2MNY A;  3DPL R;  3VMX A;  3MHH A;  2RSD A;  4QF3 A;  3LQH A;  5AW2 B;  1WEN A;  1HBW A;  5TAB A;  5APW A;  1N87 A;  4R2Y A;  4UI9 B;  3N9P A;  4S3O B;  4GNG A;  2DX8 A;  1FBV A;  4LAD B;  2P67 A;  4MVT A;  3TNU A;  4YBT A;  5B79 A;  2ECJ A;  5H9M A;  2CSY A;  1MUU A;  2YHN A;  2K1J A;  1WEP A;  5C13 A;  2Z5H A;  3L11 A;  5JG6 A;  4YBS A;  3GL6 A;  5DKA A;  2QM7 A;  1J2J B;  2KWJ A;  2IPP A;  3ZVY A;  5AVZ B;  2H0D B;  2LGL A;  2ZET C;  3PUQ A;  1G2C B;  4YBM A;  5D1L B;  5APS A;  4ZUX U;  1GTW A;  3HE5 A;  2M1R A;  3V5B A;  1A02 F;  2Y43 A;  4P5O B;  2YUR A;  4A49 A;  4B86 C;  5H1T A;  2FUI A;  1HYI A;  1WEM A;  4EOT A;  1X4I A;  3M99 A;  2ECT A;  1GU5 A;  2EA6 A;  2YW8 A;  4B86 A;  3O7A A;  1F62 A;  5AVT B;  3PUR A;  3KV5 A;  3VK6 A;  2F6J A;  2ECN A;  2MA6 A;  4IC2 A;  3TNU B;  3ZTG A;  3NXS A;  2WWW A;  1CI6 A;  2JRJ A;  3B8E B;  2WPQ A;  1WEQ A;  4I6M C;  1U6G B;  2F42 A;  3T97 A;  2MA5 A;  3MGN A;  5G04 B;  2WPR A;  4I7C A;  2KP8 A;  5AW4 B;  2AN6 A;  3V4Q A;  2LN0 A;  3MD0 A;  4LLB A;  4KHX A;  2YUC A;  1OWA A;  3V43 A;  3N9O A;  1HYJ A;  3C6W A;  2NAA A;  3LRQ A;  2PUY A;  3IR9 A;  2BAY A;  5EYA F;  3VMZ A;  5FB1 A;  1GZL A;  5AVQ B;  4QF2 A;  3O70 A;  4XE5 B;  3I5C A;  2LGK A;  4C7N A;  2KFT A;  2YSJ A;  3VTP C;  2ECI A;  2YU4 A;  2IDA A;  2PNX A;  2KGG A;  2KE1 A;  1VD4 A;  2M6M A;  2LRI C;  5AVY B;  1WEU A;  1WE9 A;  5B75 A;  3U5P A;  2H0D A;  5KH3 A;  1H89 A;  3ZNI A;  2MD8 C;  2EOD A;  1CI6 B;  5AW1 B;  4C46 A;  4WZ2 A;  3KV6 A;  1LDK C;  4C9Z A;  2R3C A;  4LC1 A;  2JMD A;  2ECV A;  4B7Y C;  4WZ3 B;  1WIM A;  2KRE A;  3O33 A;  1HUC A;  5APQ A;  2D8S A;  5AIT A;  2ZFC A;  3L36 A;  3M0D A;  5AW9 B;  2I50 A;  5I3L A;  2G6Q A;  2C9L Y;  1JOC A;  3C5K A;  5B8D A;  3EB6 A;  2YSM A;  4RES B;  2H7H A;  1HJB A;  5FB0 A;  5TRB A;  3SOU A;  5LKU A;  2XZR A;  4C7N B;  3ZYQ A;  5AW0 B;  3U5N A;  3LID A;  5AVS B;  4GND A;  1H88 A;  1JUN A;  2E6R A;  2VRS A;  2MIQ A;  3O8Z A;  2L43 A;  1WEW A;  4F52 B;  5LKT A;  4O64 A;  3HE4 B;  4BHW A;  3A3Y B;  3VMY A;  2C2V S;  4JYC A;  3L37 A;  2LGV A;  4N3W A;  2P2U A;  4V3L C;  1DH3 A;  2L75 A;  3PHD A;  3T6R A;  4TKP B;  5LKX A;  1MFZ A;  3NMD A;  3HCU A;  1K2F A;  1RMD A;  5G05 B;  2YNY A;  1WES A;  3KDP B;  4GNF A;  5J3X A;  3RTR B;  2LQ6 A;  4HYT B;  3LIE A;  4A4B A;  2C9N Y;  1KQL A;  2G43 A;  1MM3 A;  2KWK A;  3QZV A;  3U5O A;  4LKA A;  3LQJ A;  5C11 A;  2YHO A;  4R8P K;  1Z6U A;  1SP4 A;  2R32 A;  3TK1 A;  4A4C A;  2Z5I A;  1WGM A;  5TDW A;  1GK4 A;  4GB0 A;  3M62 A;  3T7L A;  2LDR A;  2CSZ A;  1LDJ B;  3N9N A;  2KU3 A;  2EGP A;  3HTK C;  4AP4 A;  4I7B A;  2XEU A;  3SWF A;  2K17 A;  3NTN A;  4CCG X;  5AW8 B;  1FOS E;  4M3L A;  5TDR A;  4MSX A;  3N9M A;  1FOS F;  2JMJ A;  2YO3 A;  2XU6 A;  3UIA A;  4NN2 A;  3HTK A;  3O35 A;  2MD7 B;  4IC3 A;  2E43 A;  1BOR A;  1MM2 A;  2YQM A;  5H1U A;  1A02 J;  2KR4 A;  2Y1M A;  5AW5 B;  2CKL A;  3TYY A;  4YAX A;  3RPG B;  2W27 A;  1WEO A;  3M91 A;  5KH9 A;  5APV A;  4N4F A;  3KQI A;  2HYE D;  2YYR A;  5AW6 B;  2ECW A;  2E42 A;  4YAT A;  1XWH A;  4AYC B;  3KQG A;  1ZBD B;  2KWN A;  3ZPV E;  3HE4 A;  3P8M C;  5AVX B; 
#chains in the Genus database with same CATH topology
 1N7S B;  4UP5 A;  2WSF H;  3P32 A;  2GUV A;  1GW3 A;  1U7J A;  2FYN C;  3HCT A;  4FK5 A;  1M1J A;  4K35 A;  1BE3 G;  2YMY A;  2KS1 A;  3KZI E;  4W80 A;  5AIU A;  3KDE C;  5DJT B;  2CKL B;  2QM8 A;  2VPE A;  3VN0 A;  3PLN A;  1XTC C;  3L73 J;  3TSI A;  3L72 J;  3LDY A;  4HKZ H;  1AVO A;  4JYB A;  4OGQ C;  3CXH H;  5CJ4 A;  4Y99 C;  3SFE C;  2WSC J;  2P57 A;  4KJM A;  3O6Q A;  2MNZ A;  5KH7 A;  2QJY B;  3IN6 A;  3RPG C;  1S1C X;  3USS A;  2WMM A;  1YQ3 C;  2K16 A;  2E76 C;  3D70 A;  5AVW B;  2Y1N A;  1M7L A;  4OH8 B;  4QQ4 A;  2HPC A;  1GU4 A;  3I2D A;  3NG2 A;  3L74 J;  4WY4 D;  1PPJ D;  1LGH B;  1G1I A;  4CPG A;  2M85 A;  3CL3 D;  5TJH A;  1JM7 B;  3L75 G;  1EQ7 A;  1JY3 N;  1EZV E;  1NOH A;  1VF5 B;  4L73 A;  2VJF A;  1RF1 A;  1E4U A;  1NAY A;  2JDI H;  4QMA A;  2N9B A;  1WEE A;  3EB5 A;  5B76 A;  2HFE D;  4FIP A;  3GG2 A;  2A06 E;  1ZLL A;  3A2A A;  2E74 B;  5GTI E;  4GNE A;  4YAD A;  2KWO A;  4BBQ A;  4WZ0 A;  1V87 A;  1NTM G;  2YRE A;  1Q90 D;  1VYX A;  2EXU A;  1SQB J;  2B0O E;  1X4J A;  3A5T A;  3A7O A;  1EXJ A;  2F6N A;  3SUB A;  1WEV A;  4R7E A;  2D2C B;  2E5Y A;  3DWD A;  2VJE B;  3V4W A;  5H1V A;  2L80 A;  1ZOY C;  1SQQ G;  1L0N J;  5CCH D;  3CXH D;  4PV1 B;  2CT2 A;  1OXZ A;  2JMI A;  5AW3 B;  3E1I A;  3MHS A;  5KJ7 A;  2IDB A;  4LJN A;  3HD7 B;  1WMK A;  1HTL C;  5B66 H;  5KLV G;  3KYQ A;  5B78 A;  2C2L A;  3WU2 E;  2ECG A;  3SSU A;  1GW4 A;  2N1T D;  3O34 A;  2BCC E;  1YHQ P;  2MUM A;  2QJ0 A;  2Q1K A;  1LTJ C;  2MJZ A;  3CXH I;  3CX5 H;  2K4D A;  1SQX D;  4I7D A;  2QIZ A;  2FUU A;  3H1H G;  2MT5 A;  3HCS A;  3SWK A;  3IAO A;  3VMX A;  2RSD A;  1FE6 A;  1RH5 B;  1GDT A;  5EFW B;  3TGU D;  2HG5 D;  4UI9 B;  4S3O B;  1P84 E;  1SQP D;  2Y9Z A;  1S5L E;  1NKN A;  4LAD B;  2IBZ D;  3T9K A;  1URQ A;  2CSY A;  3FM8 C;  4YPC A;  1KQF B;  5JG6 A;  1NJI Q;  2K1J A;  3GL6 A;  2FYU D;  2PAJ A;  5SVX A;  5KKZ C;  1L4A D;  2QM7 A;  2IPP A;  1NU1 J;  3PUQ A;  3HUS A;  3CPW O;  3LW5 J;  1GTW A;  3CWB E;  3HE5 A;  3WUU A;  2IBZ I;  2Y43 A;  1RF1 C;  1BSN A;  1KZU B;  3L71 E;  4B86 C;  1HYI A;  2NPS B;  4HH2 A;  4EOT A;  3MIW A;  5E79 H;  1R5S A;  2ECT A;  3G71 P;  3EFF K;  1Y9B A;  3CCQ P;  1VQL P;  2YW8 A;  3H1K G;  3PUR A;  2GUS A;  2ECN A;  4IC2 A;  1JY2 P;  2XDJ A;  3ZTG A;  2JRJ A;  4Y28 J;  1J1D C;  2WPQ A;  3B8E B;  4I6M C;  4H0L B;  3V2N A;  4IFM A;  3E2D A;  2MA5 A;  4OGC A;  2Q6Q A;  1SVF A;  2AN6 A;  2B89 A;  4LLB A;  3D71 A;  2YUC A;  3FWL A;  1PP9 J;  3C6W A;  3L73 E;  1K05 A;  3CX5 D;  3IR9 A;  1LT1 A;  5EYA F;  3L72 E;  2AEF A;  4QF2 A;  1IC2 A;  2E5T A;  3CCS P;  2LGK A;  3RK3 D;  4C7N A;  2ECI A;  2IDA A;  1EDI A;  2QEX P;  2LRI C;  2LXB A;  1PFI A;  4NPD A;  5B75 A;  2M0B A;  2HOD B;  2H0D A;  3CX5 I;  1H89 A;  5GTH E;  3ZNI A;  2FD4 A;  2EOD A;  5AW1 B;  3RGU A;  3M0D C;  3O47 A;  2WSE H;  2KIK A;  3H1K E;  1AA0 A;  2JMD A;  3T97 B;  1JY2 O;  2XOC A;  3H32 B;  2QSI A;  1ZRT D;  2D8S A;  2Y9Y A;  3BCC J;  3L74 E;  3L36 A;  1OVU A;  2DSM A;  1RQU A;  3JCU E;  3C5K A;  2YSM A;  4RES B;  2H7H A;  3SOU A;  5TRB A;  2JKV A;  3WUT A;  2CK3 H;  3FXE A;  3MUD C;  4OVN F;  3ZYQ A;  5AVS B;  1H88 A;  4Z1M H;  3Q3D A;  2MIQ A;  1YIJ P;  3P8C D;  2P1J A;  3HE4 B;  3ABV C;  2W6J H;  4UB8 E;  1SQB E;  3G9R A;  2LR2 A;  5KAI E;  4PD4 H;  5K5G B;  1QVF O;  4H9D A;  3QH9 A;  1NO4 A;  2ZVO B;  4TKP B;  3HCU A;  1W5C E;  2ZVN B;  3FAN A;  5J3X A;  2JP3 A;  1VPC A;  4I7Z B;  2C9N Y;  1N7S C;  2G43 A;  4ZKP A;  1MM3 A;  1HJ0 A;  1FJP A;  1FDM A;  1L0N E;  1NTZ D;  4ZNC A;  3L70 J;  4KT0 J;  3TK1 A;  1BDC A;  1K04 A;  4U3F G;  2Z5I A;  1WGM A;  2CRR A;  3N9N A;  2KU3 A;  2EGP A;  2OTL P;  2ZXX A;  2XEU A;  5TDR A;  2K9J A;  2B88 A;  3H1I G;  2YO3 A;  3UIA A;  1IJD B;  2MD7 B;  4O62 A;  3GHG B;  1A02 J;  1KB9 H;  1RF0 A;  1W2B O;  1T8Z A;  4WY4 B;  1SQV D;  3M91 A;  1EC5 A;  1RE4 C;  2QJY C;  5AW6 B;  3LVR E;  3SWY A;  4BXL A;  3A0H E;  1DCQ A;  1SQB K;  2E42 A;  3LVQ E;  1U7M A;  1BCC J;  1DIP A;  1L0L G;  3KQG A;  1FBM A;  1ZBD B;  3CCL P;  2J5U A;  1T2K C;  5TIS H;  1YJ9 P;  3U1A A;  1BGY J;  2BAS A;  1NU1 E;  2K3R A;  1OW8 A;  4RO0 A;  1N73 A;  3H1J D;  3AE9 C;  4IL6 E;  1PV3 A;  4GIF A;  5LCW B;  3RL0 C;  1L0N K;  3EFG A;  5G0F A;  4EI2 A;  4D6T G;  2ITA A;  3HTK B;  1VQM P;  3M7K A;  1S9K E;  5K3Q A;  2E75 D;  3N7N A;  5BU5 A;  4H44 D;  4PD4 D;  1VF5 C;  1USD A;  3LJU X;  2AEM A;  3MTU E;  2W6B A;  3F5H A;  2H43 A;  4TT3 H;  2K9Y A;  1FZC B;  4JPZ B;  2RKL A;  1BE3 D;  3BAS A;  2VPB A;  2KSJ A;  1LP1 B;  2Q3I A;  3FGA D;  1M1K Q;  2CPB A;  4PD4 I;  4CA1 A;  4RKU J;  1E5W A;  1YIT P;  4FJC A;  1E79 H;  1KYO H;  2R5D A;  2LXH C;  2AXT H;  3N9Q A;  2WQY C;  2WPS A;  3BVH A;  5C39 A;  3QWO C;  5CCG D;  5APY A;  4DJG A;  1MFT A;  2W6A A;  3RL0 g;  1OVR A;  2D2C C;  1Z2Q A;  1NH4 A;  2WT7 A;  1X8Y A;  5APT A;  1IYM A;  2N1T B;  4YXD C;  1PP9 E;  1HH0 A;  2M8R A;  1N86 A;  4Q6F A;  2H89 C;  4GT1 A;  1MZ9 A;  1FZB A;  1KB9 D;  3DDT A;  4DZO A;  1NU1 K;  2L0B A;  1NTK J;  4PV1 C;  1JM0 A;  1RHZ B;  1N2D C;  3VP8 A;  3HD7 C;  4GKG A;  5AVU B;  2KGI A;  2HLO A;  1JNM A;  1LTI C;  3G3Z A;  4U7J A;  3O36 A;  3L75 D;  2OQQ A;  2KYU A;  1KB9 I;  2FFW A;  1SFC D;  2FBW C;  3H1L J;  1X4U A;  4YC9 A;  2KKY A;  2KLU A;  1KQS O;  1IO4 A;  2FSA A;  3C8V A;  3HRN A;  1L4A B;  3V2R A;  3BCC E;  2WTY A;  3S4R A;  2ZJS E;  4LLH A;  4LK9 A;  1VQ9 P;  2LGG A;  1IFM A;  3S1K A;  3CC2 P;  4S3O C;  3RK2 C;  4WA6 A;  2VNF A;  1NTM D;  3HE5 B;  2A45 G;  1RY3 A;  2R44 A;  2JM3 A;  4K3A A;  1X79 B;  4MN4 C;  2VPG A;  2IFN A;  3VP9 A;  1H0T A;  4LGD E;  2XOY A;  1NAF A;  1USE A;  2E6S A;  3B4S A;  1LT9 B;  2YMK A;  2YO2 A;  2ZT9 D;  5APU A;  1CZQ A;  1KYO D;  2XB1 A;  1SQQ D;  1G2C A;  2PGD A;  1EZV G;  5CMZ A;  3M63 A;  3D6Y A;  2NPS C;  1BCC G;  2V7Q J;  5KLV D;  3M9B A;  1CHC A;  2OYH B;  5APX A;  3SOW A;  4NPF X;  1LWU B;  1WFK A;  4BRY B;  3SHB A;  2A06 G;  1KYO I;  3L70 E;  1OVV A;  1LTJ A;  1HVV A;  3LQH A;  4EIJ A;  1WEN A;  3RK3 B;  5TAB A;  4H0L C;  1N87 A;  3H1H D;  2C0X A;  4MVT A;  4YBT A;  5DJU B;  5B79 A;  3MHV A;  1PIX A;  4UB6 E;  5H9M A;  1MUU A;  2YHN A;  5C13 A;  1WEP A;  3Q5P A;  3L11 A;  4YBS A;  1PGQ A;  3EQ2 A;  4N78 D;  5DKA A;  2H8P D;  4XFJ A;  2Q9I A;  3ZVY A;  1FZF A;  2H0D B;  2ZET C;  5APS A;  2L5G B;  3W68 A;  3II6 A;  1A02 F;  1OW7 A;  2WSF J;  2FXM A;  2Y0D A;  1K8A Q;  2YKP A;  2WIT A;  1WEM A;  1BCC E;  4F1P A;  3M99 A;  1YJW P;  2SPZ A;  2BCC G;  1GU5 A;  3S9O A;  1G1J A;  2EA6 A;  5SVI A;  4B86 A;  1F62 A;  1BGY E;  5AVT B;  3AE7 C;  3TNU B;  3NXS A;  4O9B A;  1CI6 A;  1WEQ A;  1UII A;  2YVR A;  1U6G B;  2RN0 A;  5M1B A;  2F42 A;  1KD1 Q;  1KIL E;  2WPR A;  3AE8 C;  5AW4 B;  3AE4 C;  1SS1 A;  3V43 A;  2PUY A;  4DOJ A;  2BAY A;  2CPS A;  1GZL A;  1JCD A;  1M57 D;  1GL2 B;  3CCR P;  3K5B A;  2YSJ A;  2YU4 A;  2KGG A;  2KE1 A;  3CWB G;  1KMI Z;  1SQX J;  5CBO A;  3L71 G;  3U5P A;  5KJ7 D;  1YTZ I;  2FXP A;  5H2F H;  2QE7 H;  2MD8 C;  3TGU J;  3KV6 A;  1JTH B;  1SQP J;  4PJ0 H;  4I7Z C;  1WIM A;  4OGE A;  3I55 P;  1T3J A;  3M0D A;  2FYU J;  4WB4 A;  1NTK E;  2OYI B;  2JUN A;  2G6Q A;  2EGM A;  1W2E A;  2KNC A;  5AW0 B;  1YJN P;  3LID A;  1JUN A;  2E6R A;  1VQ4 P;  3CI9 A;  1S5L X;  3H1L E;  1KC8 Q;  1URQ D;  3L73 G;  3GHG C;  5LKT A;  3MUD A;  3L72 G;  3A0B E;  3M9Q A;  3TF5 A;  3IFM A;  4YTP C;  2P2U A;  4WY4 C;  4TLF A;  3H6P A;  4V3L C;  1IFP A;  1HGZ A;  3AE3 C;  2L75 A;  3PHD A;  5LKX A;  1EDK A;  3CMA P;  3KXD A;  1R5L A;  3G6E P;  4JBZ A;  2J58 A;  2E75 B;  4H44 B;  3RTR B;  3FX0 A;  2LQ6 A;  4HYT B;  1FZA A;  3LIE A;  4A4B A;  2YKO A;  2KWK A;  3U5O A;  3AEE C;  1SP4 A;  3L74 G;  1N7S A;  1OZH A;  1KIL B;  2CSZ A;  4I1L A;  2LDR A;  1NTK K;  1Q2N A;  1LDJ B;  3HTK C;  4AP4 A;  2KXP B;  1IFN A;  4CCG X;  5AW8 B;  2Q3E A;  4U3F D;  1JO5 A;  5KAF H;  2JMJ A;  4NN2 A;  2XU6 A;  1FZC C;  4IC3 A;  1AJY A;  1GMJ A;  2OTK E;  2YQM A;  1IZN B;  2KR4 A;  5AW5 B;  2CKL A;  3TYY A;  1JB0 J;  2RH0 A;  3GMA A;  1DD3 A;  3RPG B;  3H1I D;  2FFD C;  2W27 A;  2KZJ A;  5KH9 A;  3B5N B;  4N4F A;  2KSE A;  5CCH C;  2I1J A;  1SQB G;  2IQJ A;  1XWH A;  1PPJ E;  2M5A B;  3PJS K;  2DW3 A;  2K1A A;  4IFF A;  2HR3 A;  2QVA A;  1RE4 A;  1IFJ A;  1IK7 A;  2JWD A;  1NYH A;  2ZYG A;  2N1T C;  2Z4E A;  2PP6 A;  1G25 A;  3VYI A;  4FO9 A;  1NWQ A;  3LQI A;  4PTB A;  1MKM A;  4L58 A;  2OWA A;  1SFC B;  1L0L D;  1RE3 C;  1WIL A;  3U59 A;  1L0N G;  1FS0 E;  2ZAE B;  4ZDT A;  2Q5U A;  2IYO A;  1T6A A;  2KOG A;  2NRG A;  2GM4 A;  4GDO A;  1VL2 A;  1YQ4 C;  4BWN A;  4D6T D;  2QIC A;  1JM7 A;  3RL0 D;  2LV9 A;  2CRW A;  4YAB A;  1H8A A;  1PGJ A;  1Y47 A;  1J1E C;  2P10 A;  1M90 Q;  2A45 H;  2IBZ G;  2YT5 A;  2XP0 A;  1KTM A;  1L4A C;  1LTT C;  2YQL A;  3GLM A;  1IFD A;  3FJU B;  1QL2 A;  3N4X A;  4L76 A;  1NTZ J;  2ZT9 B;  3CXH E;  1QEX A;  3BAT A;  1WRG A;  5AVR B;  1Z60 A;  1VFY A;  1M1J B;  1YYC A;  2KS1 B;  4DT0 A;  4R4L A;  1NVO A;  5B77 A;  5CJ0 A;  1NU1 G;  4JQ0 D;  2M3H A;  4AYC A;  2WSE J;  5KTB A;  2VJE A;  1LT9 C;  1T1H A;  2LAU A;  2CSV A;  1SQX E;  1YBK A;  4OWF A;  5GTI H;  2POH A;  3U1C A;  1KFM A;  2FXO A;  2QJK B;  1SQV J;  3JSV C;  3HD7 A;  2JJL A;  3M0A A;  3TGU E;  3O6Q B;  4PV1 D;  3WUV A;  3AEC C;  2OYH C;  1KOR A;  1SQP E;  3M06 A;  3HD7 D;  4H13 D;  2XND H;  2IBZ E;  1LWU C;  3PH0 A;  3O37 A;  1CSB A;  2O01 N;  2ZXE B;  2B9B A;  2FYU E;  3V2P A;  4L74 A;  2OXQ C;  2RMZ A;  3RK3 C;  2IZ1 A;  2HPC B;  2FY8 A;  3PHL A;  3H1J J;  1FAV A;  4A0C D;  2VPD A;  1CW5 A;  1JY2 N;  3GF3 A;  3IHP A;  3R2P A;  2HDP A;  4ASW A;  2N9Y B;  3WU2 H;  3ZVZ B;  1PP9 G;  5D1M B;  3OA7 A;  1DD4 A;  2VJF B;  1RF1 B;  3RK2 D;  3V2Q A;  1BE3 J;  4WVZ A;  4AVX A;  3CCU P;  1VQ7 P;  2WVR A;  2YXR B;  4IL6 X;  1L2P A;  1X0T A;  1GK6 A;  1SQX K;  4W4U A;  4V3K C;  2A45 I;  2NZ2 A;  2QJP B;  5B66 E;  3B71 A;  1P84 H;  4AUQ B;  1EZV D;  1S5L H;  2G3A A;  2NPS A;  2MNY A;  3DPL R;  2K37 A;  2E74 C;  2XNX A;  2WPV B;  4QF3 A;  2NPS D;  5AW2 B;  3AE2 C;  3BCC G;  2I8D A;  1PL5 A;  3CX5 E;  1N8R Q;  2FYU K;  2A06 D;  2DX8 A;  1FBV A;  2P67 A;  3RK3 E;  1MBM A;  2XOZ A;  1EZV I;  4WWI A;  4OGQ D;  1ZR2 A;  2Y0C A;  1LTB C;  3TDK A;  1J2J B;  2RR4 A;  1U57 A;  4GOF A;  1HGV A;  3AED C;  3CCE P;  1DX7 A;  5D1L B;  2O01 H;  1GL2 C;  3L75 J;  2E76 D;  1X9V A;  1ZRT E;  5H1T A;  2FUI A;  1Q82 Q;  5KLI B;  1X4I A;  4C7R A;  4JF7 A;  1AQT A;  1NTM J;  1VQN P;  2F6J A;  2HOD A;  1JEK A;  2MA6 A;  3VOP A;  1KQG B;  3AE1 C;  2WWW A;  1PGO A;  3C1L A;  3VMA A;  5E79 E;  1URQ B;  1ZXG A;  2BCC D;  3L70 G;  2OYI C;  1PZQ A;  3T97 A;  3MGN A;  3Q1M A;  3P8C E;  1FU1 A;  4I7C A;  3HUS B;  2W90 A;  2KP8 A;  1QVG O;  2LN0 A;  3AEG C;  1JY3 O;  3MD0 A;  2K88 A;  2KI7 B;  2XKM A;  2WSC H;  1Q7Y Q;  1SQQ J;  1AFO A;  1VQ8 P;  1ZR4 A;  2NAA A;  3VMZ A;  1P84 D;  4XE5 B;  1FZG A;  5GTH H;  3VTP C;  5KLV J;  2KZI A;  3RBX A;  2JWA A;  1Q81 Q;  4Z0O A;  1WE9 A;  2JEE A;  1NTZ E;  5KH3 A;  2QIW A;  1P84 I;  3CWB D;  1S3J A;  2E75 C;  1LDK C;  4H44 C;  4C9Z A;  3JCU H;  3H1H J;  2CON A;  1Q86 Q;  3L71 D;  4WZ3 B;  3KPE A;  3O33 A;  2KRE A;  3PLW A;  5APQ A;  1BGY G;  3IF4 A;  2ZFC A;  1EDJ A;  4HB1 A;  1YI2 P;  3SFD C;  5I3L A;  1JOC A;  1KIL C;  1OX3 A;  1X22 A;  2O3J A;  3ZDM A;  1HJB A;  1NGM B;  3ITK A;  4C7N B;  2HYN A;  1Y8A A;  4UB8 H;  1SQV E;  5CCG C;  5KAI H;  1VQ5 P;  2L43 A;  4ZKU A;  1WEW A;  1KFN A;  4HJG H;  4O64 A;  4BHW A;  3A3Y B;  3VMY A;  1JMB A;  3JUE A;  4JYC A;  3L37 A;  2LGV A;  2WZ7 A;  2W83 C;  2QRX A;  2Y0E A;  3B5N C;  3I56 P;  3L73 D;  3GHG A;  3L72 D;  3H1J E;  3KHU A;  1MFZ A;  3NMD A;  5G05 B;  1K73 Q;  1NTZ K;  3KDP B;  3H1K J;  3RBZ A;  2JR8 A;  2QA4 P;  2KB7 P;  4WY4 A;  2M3E A;  3G4S P;  3H25 A;  1KQL A;  4PD4 E;  1HF9 A;  3RL0 B;  1WT6 A;  3CCJ P;  4LKA A;  2YHO A;  1SFC C;  4R8P K;  2R32 A;  4A4C A;  1BE3 E;  4GB0 A;  4A7P A;  3T7L A;  1NTK G;  3H1K D;  1LTA C;  3PRJ A;  2K17 A;  2B87 A;  3NTN A;  3L74 D;  2GA1 A;  4M3L A;  4MSX A;  3MZW B;  4EDF A;  2YIU B;  3HTK A;  3MP7 B;  3Q5S A;  1N7L A;  1SQV K;  3A0H H;  2E43 A;  1MM2 A;  3H1L G;  1TU3 F;  1OMI A;  1FZC A;  1WEO A;  3KQI A;  2YYR A;  3CCM P;  2ECW A;  1LP1 A;  1KB9 E;  1LNQ A;  2ZT9 C;  4IL6 H;  4AYC B;  1QGK B;  2FFD A;  3LW5 H;  2KWN A;  3P8M C;  2KUB A;  5CCH A;  2KK7 A;  1SQB D;  1M1J C;  2UZG A;  2RI7 A;  4DCK A;  3L35 A;  2R5B A;  2OYO A;  3DQV R;  4H13 B;  1HWT C;  5B5E H;  3L75 E;  2K9J B;  5TIS E;  2N1T A;  3GW6 A;  1S2E A;  1ZV8 A;  3L4F A;  1RE3 A;  4AQR D;  1L0N D;  3V6I A;  2QJK C;  4IFD K;  5D1K B;  3M9H A;  4ZMD A;  2PRR A;  2KLV A;  1NTM E;  1DVP A;  5AVV B;  4ZQL A;  2L91 A;  3OAK A;  2OAR A;  2L5U A;  3N9L A;  3AEA C;  4I2L C;  2D8U A;  3RK2 B;  2LXP C;  1FC2 C;  1L4A A;  2LKM A;  1N73 B;  2KIZ A;  2XV5 A;  3R4Y A;  1PPJ G;  4W7Y A;  5AW7 B;  2JO1 A;  1KYO E;  5BVZ A;  1SQQ E;  3D6Z A;  4AUW A;  2AXT E;  1ZP0 C;  1VQP P;  3BRV B;  3ZPV 1;  2IYP A;  4GOD A;  1FP0 A;  4U3F J;  3OJA B;  2IFM A;  5KLV E;  2FYN B;  2R3S A;  2WSS H;  5DIN A;  4UP0 A;  1MV8 A;  1NU1 D;  2G8Y A;  4N6J A;  1N7S D;  2AEJ A;  1FZE A;  3H1I J;  1LT9 A;  3P7K A;  3KNV A;  1DEE G;  1SLQ A;  5FER A;  4PPE A;  2QJP C;  3GV4 A;  2IX7 C;  3H1H E;  3F89 A;  2KKX A;  3NFQ A;  4OGQ B;  2P7J A;  1S9K D;  3FXD A;  5LKZ A;  4Y99 B;  1ZN5 A;  1BDD A;  1NTM K;  1VDF A;  5FEY A;  2OGU A;  2OYH A;  2WT7 B;  4N78 E;  1AQ5 A;  4XI1 A;  1JCC A;  2G45 A;  1LWU A;  1VQK P;  4IOI H;  4BRY A;  1L0L J;  2E76 B;  3E7K A;  4N3Y B;  5KJ7 C;  3W67 A;  3U5M A;  3ASL A;  4L7X A;  4Z0R A;  2AXC A;  1SQQ K;  3KZI H;  1S72 P;  4D6T J;  1S4X A;  2Q7C A;  1GD2 E;  5KLV K;  1LJ2 A;  3AE5 C;  4X3G A;  3L1X A;  3E1R A;  1PP9 D;  3FL2 A;  5TBN A;  1T2K D;  1SQX G;  1PGP A;  1M56 D;  5KLI C;  2H88 C;  1DEB A;  4EYY Q;  3CD6 P;  3H7H A;  3TGU G;  2VP7 A;  3L1Z B;  2OTJ P;  1SQP G;  3FWN A;  4L75 A;  3SOX A;  1R8E A;  3MDB C;  1T3U A;  4UB6 H;  1BSH A;  3BRT B;  3MHH A;  4NPE A;  1UIX A;  2ZYA A;  1URQ C;  2QG4 A;  1VF5 D;  2ZYD A;  2I1K A;  2O1K A;  1HBW A;  1VQ6 P;  2FYU G;  5APW A;  4R2Y A;  3N9P A;  4GNG A;  1H0T B;  1QX8 A;  3TNU A;  3HUS C;  1Z56 A;  2ECJ A;  3BCC D;  2Z5H A;  2E74 D;  1AVY A;  3CLQ A;  2FKW B;  2KWJ A;  1QL1 A;  1FJK A;  5AVZ B;  2LGL A;  4YBM A;  1G2C B;  3Q2Y A;  4ZUX U;  5CBN A;  2M1R A;  3V5B A;  4YXW H;  3Q1D A;  1OIP A;  2L7P A;  4P5O B;  2YUR A;  2D2C D;  4A49 A;  2P58 A;  1GL2 A;  3CCV P;  5CHX A;  1LTJ B;  1GL2 D;  1IK9 A;  4W7Z A;  3Q5R A;  2BEQ D;  3O7A A;  1QLE D;  1K9M Q;  3VK6 A;  3KV5 A;  1ZW0 A;  3FEH A;  4RJT A;  2V4H A;  3C9I A;  1JTH A;  5G04 B;  2DJA A;  3V4Q A;  1OFC X;  2M3B A;  2PFX A;  2FYZ A;  4KHX A;  2OYI A;  3L70 D;  3PP5 A;  1OWA A;  1FDO A;  3N9O A;  5KKZ B;  1HYJ A;  1EDL A;  3LRQ A;  5FB1 A;  5AVQ B;  3O70 A;  3I5C A;  2KFT A;  2PNX A;  4XA4 A;  1VD4 A;  1LTG C;  2M6M A;  1YTZ T;  5AVY B;  5L8R J;  1WEU A;  2MKE A;  5SVI B;  1AV1 A;  1CI6 B;  4C46 A;  4WZ2 A;  1KV4 A;  2R3C A;  2MKV A;  3OW2 O;  4LC1 A;  1M8O B;  3JC2 2;  2ECV A;  4B7Y C;  3AEF C;  2W8Z A;  2BEZ F;  1HUC A;  2B87 B;  5AIT A;  1VQO P;  1J1D B;  4U3F E;  5H2F E;  5AW9 B;  1SQP K;  2I50 A;  1BCC D;  2YKQ A;  1ZME C;  3AEB C;  2C9L Y;  5B8D A;  3EB6 A;  4PJ0 E;  5LKU A;  5FB0 A;  1BGY D;  2XZR A;  1EXI A;  2YXQ B;  2M13 A;  5B5E E;  3FAO A;  3A0B H;  1FDI A;  3H1I E;  3U5N A;  3CME P;  4GND A;  1XTG B;  1KIL A;  1JY3 P;  2VRS A;  2YIU C;  3O8Z A;  5SVY A;  1OW6 A;  1KIL D;  4F52 B;  2IZ0 A;  2FFD B;  4H0L D;  1IFI A;  2C2V S;  3CC7 P;  5CCG A;  3PTZ A;  2E61 A;  1LTS C;  4N3W A;  1DH3 A;  4ASV A;  3T6R A;  1L0L E;  1K2F A;  1RMD A;  2BCC J;  2YNY A;  1NTZ G;  1WES A;  4GNF A;  4WBA A;  3CC4 P;  3B5N A;  3QZV A;  3B5N D;  2M5A A;  1NKZ B;  2KNC B;  3LQJ A;  5C11 A;  3GF7 A;  1Z6U A;  4D6T E;  2C0W A;  4H13 C;  1KN7 A;  2V7Q H;  5TDW A;  1GK4 A;  3M62 A;  4R4M A;  1RQV A;  1JMM A;  4I7B A;  1SFC A;  3SWF A;  3H32 A;  1FOS E;  3AE6 C;  5BU8 B;  3EWK A;  1NHL A;  1RF0 C;  3N9M A;  2J59 M;  1J1E B;  1NTK D;  1FOS F;  3O35 A;  2LXC B;  1SQV G;  1BOR A;  5H1U A;  2Y1M A;  3CWB J;  4GOE A;  2O1J A;  1D7M A;  4YAX A;  5KAF E;  3L71 J;  5APV A;  2HYE D;  3H1L D;  4YAT A;  2UWJ E;  2O01 J;  2KYV A;  3WMM 0;  3H1J G;  1N73 C;  3ZPV E;  1L0L K;  3HE4 A;  5AVX B; 
#chains in the Genus database with same CATH homology
 1T2K C;  5CCH A;  1N7S B;  4UP5 A;  3U1A A;  1M1J C;  2UZG A;  2N1T C;  2RI7 A;  2Z4E A;  2PP6 A;  2WSF H;  2BAS A;  3P32 A;  1G25 A;  3L35 A;  3VYI A;  4FO9 A;  2R5B A;  2GUV A;  1NWQ A;  3LQI A;  3DQV R;  1GW3 A;  4L58 A;  1N73 A;  1SFC B;  1WIL A;  1RE3 C;  4PTB A;  4GIF A;  3U59 A;  5LCW B;  1HWT C;  3RL0 C;  1L0N K;  3EFG A;  5G0F A;  3HCT A;  4FK5 A;  1M1J A;  4ZDT A;  2N1T A;  3HTK B;  1ZV8 A;  2YMY A;  2Q5U A;  1S9K E;  3L4F A;  3N7N A;  4W80 A;  5BU5 A;  1RE3 A;  5AIU A;  4AQR D;  2KOG A;  2GM4 A;  2CKL B;  2QM8 A;  2VPE A;  3VN0 A;  3MTU E;  2W6B A;  2QIC A;  4IFD K;  5D1K B;  3M9H A;  2H43 A;  1FZC B;  1XTC C;  1JM7 A;  3RL0 D;  2LV9 A;  3TSI A;  4YAB A;  3BAS A;  1H8A A;  1J1E C;  2A45 H;  4JYB A;  2KLV A;  2KSJ A;  2VPB A;  2YT5 A;  2Q3I A;  1DVP A;  5CJ4 A;  5AVV B;  4ZQL A;  3OAK A;  4Y99 C;  1L4A C;  2CPB A;  2OAR A;  1LTT C;  2YQL A;  2L5U A;  4CA1 A;  3N9L A;  1E5W A;  4FJC A;  4I2L C;  2MNZ A;  5KH7 A;  3RK2 B;  1IFD A;  2R5D A;  2LXH C;  2LXP C;  1QL2 A;  3N9Q A;  3RPG C;  2WPS A;  3BVH A;  3N4X A;  5CCG D;  5APY A;  2W6A A;  2K16 A;  1L4A A;  2LKM A;  1N73 B;  2KIZ A;  2XV5 A;  5AVW B;  3BAT A;  1WRG A;  4W7Y A;  5AVR B;  1M7L A;  1Z2Q A;  1Z60 A;  2Y1N A;  1NH4 A;  5AW7 B;  2WT7 A;  1X8Y A;  5APT A;  1IYM A;  1VFY A;  1M1J B;  4OH8 B;  5BVZ A;  2N1T B;  2HPC A;  1YYC A;  4AUW A;  1HH0 A;  2M8R A;  3BRV B;  1N86 A;  1GU4 A;  4Q6F A;  3ZPV 1;  4GT1 A;  3I2D A;  1MZ9 A;  1FP0 A;  3NG2 A;  5B77 A;  5CJ0 A;  1FZB A;  4WY4 D;  4DZO A;  1LGH B;  1G1I A;  1NU1 K;  3OJA B;  2IFM A;  2L0B A;  2M3H A;  4AYC A;  5KTB A;  2M85 A;  1N2D C;  3CL3 D;  1LT9 C;  2VJE A;  1T1H A;  3VP8 A;  3HD7 C;  1JM7 B;  4GKG A;  5DIN A;  1EQ7 A;  1JY3 N;  5AVU B;  4UP0 A;  1NOH A;  2KGI A;  1MV8 A;  2POH A;  3U1C A;  2VJF A;  1KFM A;  1RF1 A;  4N6J A;  1N7S D;  2HLO A;  1FZE A;  1E4U A;  2N9B A;  1LT9 A;  3P7K A;  1JNM A;  1LTI C;  3G3Z A;  3KNV A;  3HD7 A;  1WEE A;  2JJL A;  3O36 A;  3M0A A;  3EB5 A;  2KYU A;  1SLQ A;  5FER A;  5B76 A;  4PPE A;  1SFC D;  2HFE D;  3GV4 A;  4FIP A;  2IX7 C;  2OYH C;  1X4U A;  4YC9 A;  3M06 A;  3NFQ A;  1ZLL A;  3HD7 D;  3A2A A;  2P7J A;  1S9K D;  4GNE A;  1LWU C;  4YAD A;  1IO4 A;  2FSA A;  2KWO A;  4BBQ A;  4WZ0 A;  5LKZ A;  1V87 A;  3HRN A;  4Y99 B;  3O37 A;  1CSB A;  1L4A B;  3V2R A;  2YRE A;  1ZN5 A;  2WTY A;  1NTM K;  1VDF A;  1VYX A;  4LLH A;  5FEY A;  2ZXE B;  4LK9 A;  3V2P A;  2OYH A;  2LGG A;  2WT7 B;  4N78 E;  1AQ5 A;  4XI1 A;  1JCC A;  1X4J A;  1IFM A;  2G45 A;  3RK3 C;  2OXQ C;  3A5T A;  2HPC B;  1LWU A;  1FAV A;  3A7O A;  4S3O C;  2F6N A;  3RK2 C;  4WA6 A;  2VNF A;  1WEV A;  3HE5 B;  2A45 G;  4R7E A;  1RY3 A;  4A0C D;  2VPD A;  4N3Y B;  1CW5 A;  1JY2 N;  1X79 B;  3IHP A;  5KJ7 C;  2VJE B;  3V4W A;  3R2P A;  3U5M A;  2VPG A;  3ASL A;  2IFN A;  2HDP A;  4L7X A;  5H1V A;  3VP9 A;  2L80 A;  3ZVZ B;  1SQQ K;  4LGD E;  5D1M B;  3OA7 A;  2VJF B;  1RF1 B;  5CCH D;  1NAF A;  3RK2 D;  2CT2 A;  1OXZ A;  2JMI A;  5AW3 B;  3E1I A;  3V2Q A;  2E6S A;  3MHS A;  5KJ7 A;  1LT9 B;  2Q7C A;  4LJN A;  3HD7 B;  2YO2 A;  4AVX A;  1GD2 E;  1HTL C;  5APU A;  5KLV K;  3KYQ A;  1CZQ A;  5B78 A;  4X3G A;  2XB1 A;  3L1X A;  2C2L A;  1G2C A;  3FL2 A;  5TBN A;  2ECG A;  1T2K D;  1GK6 A;  1SQX K;  5CMZ A;  4W4U A;  3M63 A;  1GW4 A;  2NPS C;  4V3K C;  2N1T D;  3O34 A;  2MUM A;  2QJ0 A;  2A45 I;  3M9B A;  1LTJ C;  1CHC A;  2MJZ A;  2OYH B;  1DEB A;  5APX A;  3SOW A;  2K4D A;  1LWU B;  1WFK A;  2VP7 A;  4AUQ B;  3L1Z B;  2QIZ A;  2FUU A;  4I7D A;  3SHB A;  2MT5 A;  3HCS A;  2NPS A;  3SOX A;  2MNY A;  1T3U A;  3DPL R;  3VMX A;  3BRT B;  3MHH A;  1LTJ A;  2XNX A;  2RSD A;  1HVV A;  3LQH A;  4QF3 A;  2NPS D;  1URQ C;  5AW2 B;  1GDT A;  4EIJ A;  1WEN A;  3RK3 B;  2I1K A;  2O1K A;  1HBW A;  2HG5 D;  5TAB A;  5APW A;  1N87 A;  4R2Y A;  2FYU K;  4UI9 B;  3N9P A;  4S3O B;  4GNG A;  2C0X A;  2DX8 A;  1NKN A;  1FBV A;  4LAD B;  2P67 A;  4MVT A;  3TNU A;  4YBT A;  3HUS C;  5B79 A;  1Z56 A;  2ECJ A;  1URQ A;  2CSY A;  5H9M A;  1MUU A;  2YHN A;  1ZR2 A;  1WEP A;  2K1J A;  2Z5H A;  3L11 A;  5C13 A;  5JG6 A;  4YBS A;  3GL6 A;  1LTB C;  2PAJ A;  3CLQ A;  3EQ2 A;  4N78 D;  5DKA A;  2FKW B;  2QM7 A;  1L4A D;  1J2J B;  1QL1 A;  2IPP A;  2H8P D;  2Q9I A;  2KWJ A;  1HGV A;  1FZF A;  3ZVY A;  1FJK A;  5AVZ B;  2H0D B;  2LGL A;  2ZET C;  3PUQ A;  1G2C B;  3HUS A;  1DX7 A;  5D1L B;  4YBM A;  5APS A;  2L5G B;  2O01 H;  4ZUX U;  1GL2 C;  1GTW A;  3HE5 A;  2M1R A;  3V5B A;  3II6 A;  1A02 F;  2Y43 A;  1RF1 C;  1KZU B;  1X9V A;  4P5O B;  2YUR A;  2FXM A;  4A49 A;  4B86 C;  5H1T A;  2FUI A;  2YKP A;  1GL2 A;  1HYI A;  5CHX A;  2NPS B;  2WIT A;  4HH2 A;  1WEM A;  4EOT A;  3MIW A;  1X4I A;  3M99 A;  1LTJ B;  2ECT A;  1GL2 D;  1IK9 A;  4W7Z A;  4C7R A;  1GU5 A;  1G1J A;  4JF7 A;  2EA6 A;  2YW8 A;  4B86 A;  3O7A A;  1F62 A;  5AVT B;  3PUR A;  3KV5 A;  2GUS A;  2F6J A;  2HOD A;  2ECN A;  3VK6 A;  2MA6 A;  4IC2 A;  3VOP A;  1JY2 P;  2XDJ A;  3TNU B;  3ZTG A;  3NXS A;  4O9B A;  2WWW A;  1CI6 A;  2JRJ A;  1J1D C;  2WPQ A;  1URQ B;  3B8E B;  1WEQ A;  4I6M C;  3C9I A;  1U6G B;  2OYI C;  2F42 A;  1JTH A;  3V2N A;  4IFM A;  3T97 A;  2MA5 A;  3MGN A;  3P8C E;  1FU1 A;  5G04 B;  2WPR A;  4I7C A;  3HUS B;  1SVF A;  2KP8 A;  5AW4 B;  2AN6 A;  3V4Q A;  2M3B A;  2LN0 A;  1JY3 O;  3MD0 A;  2FYZ A;  4LLB A;  4KHX A;  2XKM A;  2OYI A;  3PP5 A;  2YUC A;  1OWA A;  3V43 A;  2WSC H;  3N9O A;  1HYJ A;  1AFO A;  3C6W A;  1ZR4 A;  2NAA A;  2PUY A;  3LRQ A;  4DOJ A;  3IR9 A;  2BAY A;  2CPS A;  5EYA F;  3VMZ A;  5FB1 A;  1GZL A;  1JCD A;  5AVQ B;  4QF2 A;  3O70 A;  1IC2 A;  4XE5 B;  3I5C A;  1GL2 B;  2LGK A;  3RK3 D;  4C7N A;  2KFT A;  2YSJ A;  1FZG A;  3VTP C;  2ECI A;  2YU4 A;  2IDA A;  2PNX A;  2KGG A;  4XA4 A;  2KE1 A;  1VD4 A;  1LTG C;  2M6M A;  1YTZ T;  2LRI C;  5AVY B;  1PFI A;  1WEU A;  1WE9 A;  5B75 A;  2JEE A;  3U5P A;  5KJ7 D;  1YTZ I;  2HOD B;  2H0D A;  5KH3 A;  1H89 A;  3ZNI A;  2MD8 C;  2EOD A;  1CI6 B;  5AW1 B;  4C46 A;  4WZ2 A;  3M0D C;  3KV6 A;  1LDK C;  4C9Z A;  2WSE H;  2R3C A;  1JTH B;  4LC1 A;  2JMD A;  1JY2 O;  2ECV A;  4B7Y C;  3H32 B;  4WZ3 B;  3KPE A;  1WIM A;  2KRE A;  3O33 A;  1HUC A;  5APQ A;  2D8S A;  5AIT A;  2ZFC A;  1J1D B;  1T3J A;  3L36 A;  3M0D A;  5AW9 B;  1SQP K;  2I50 A;  4WB4 A;  2OYI B;  5I3L A;  2YKQ A;  2G6Q A;  2C9L Y;  1JOC A;  3C5K A;  5B8D A;  3EB6 A;  2YSM A;  4RES B;  1KIL C;  2H7H A;  1HJB A;  5FB0 A;  5TRB A;  1W2E A;  3SOU A;  5LKU A;  2XZR A;  4C7N B;  2HYN A;  3ZYQ A;  5AW0 B;  3U5N A;  3LID A;  5AVS B;  4GND A;  5CCG C;  1H88 A;  1JUN A;  2E6R A;  1XTG B;  1KIL A;  3CI9 A;  1JY3 P;  2VRS A;  2MIQ A;  3O8Z A;  2L43 A;  4ZKU A;  1URQ D;  1WEW A;  1KFN A;  3GHG C;  1KIL D;  3P8C D;  4F52 B;  3MUD A;  5LKT A;  2P1J A;  2FFD B;  4O64 A;  3HE4 B;  4BHW A;  3M9Q A;  3A3Y B;  1IFI A;  3VMY A;  2C2V S;  3IFM A;  5CCG A;  1LTS C;  3L37 A;  4JYC A;  2WZ7 A;  2LGV A;  2P2U A;  4N3W A;  4WY4 C;  3B5N C;  3H6P A;  4V3L C;  1DH3 A;  3GHG A;  1HGZ A;  2L75 A;  3PHD A;  3T6R A;  1NO4 A;  4TKP B;  5LKX A;  1MFZ A;  3NMD A;  3HCU A;  1K2F A;  1RMD A;  2J58 A;  2YNY A;  1WES A;  5G05 B;  1NTZ K;  3KDP B;  4GNF A;  4WBA A;  5J3X A;  1VPC A;  3RTR B;  2KB7 P;  4WY4 A;  3B5N A;  2LQ6 A;  4HYT B;  1FZA A;  3LIE A;  4A4B A;  2C9N Y;  1KQL A;  1N7S C;  2YKO A;  2G43 A;  4ZKP A;  1MM3 A;  2KWK A;  3QZV A;  3B5N D;  3U5O A;  1FJP A;  3RL0 B;  1WT6 A;  1NKZ B;  1FDM A;  4LKA A;  3LQJ A;  5C11 A;  2YHO A;  1SFC C;  4R8P K;  1Z6U A;  1SP4 A;  2R32 A;  3TK1 A;  2C0W A;  4A4C A;  2Z5I A;  1WGM A;  5TDW A;  1GK4 A;  4GB0 A;  3M62 A;  3T7L A;  1N7S A;  1KIL B;  2CSZ A;  4I1L A;  2LDR A;  1NTK K;  1LDJ B;  3N9N A;  2KU3 A;  2EGP A;  3HTK C;  1JMM A;  1LTA C;  4AP4 A;  4I7B A;  2XEU A;  1SFC A;  3SWF A;  2K17 A;  3H32 A;  3NTN A;  1IFN A;  4CCG X;  5AW8 B;  1FOS E;  5BU8 B;  4M3L A;  5TDR A;  1NHL A;  1RF0 C;  4MSX A;  3N9M A;  2J59 M;  1J1E B;  1JO5 A;  1FOS F;  2JMJ A;  2YO3 A;  2XU6 A;  3UIA A;  4NN2 A;  1IJD B;  3HTK A;  1FZC C;  3O35 A;  2MD7 B;  4IC3 A;  1N7L A;  1SQV K;  2E43 A;  1BOR A;  3GHG B;  1MM2 A;  2YQM A;  5H1U A;  1A02 J;  2KR4 A;  2Y1M A;  5AW5 B;  2CKL A;  3TYY A;  1RF0 A;  2O1J A;  4YAX A;  3RPG B;  1T8Z A;  2FFD C;  1FZC A;  2W27 A;  4WY4 B;  1WEO A;  3M91 A;  5KH9 A;  3B5N B;  5APV A;  4N4F A;  1RE4 C;  3KQI A;  2HYE D;  2YYR A;  5AW6 B;  5CCH C;  3SWY A;  2I1J A;  1SQB K;  2ECW A;  2E42 A;  4YAT A;  1XWH A;  4AYC B;  2KYV A;  3WMM 0;  1N73 C;  3KQG A;  1FBM A;  3LW5 H;  2FFD A;  1L0L K;  1ZBD B;  3HE4 A;  2KWN A;  3P8M C;  3ZPV E;  4IFF A;  1RE4 A;  5AVX B;  1IFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...