4AYCA

Rnf8 ring domain structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
136
structure length
136
Chain Sequence
LGSMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
total genus 48
structure length 136
sequence length 136
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aycA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycA02
4X3GA 2I50A 2EODA 2M6MA 1H8AA 5DKAA 4KHXA 4LJNA 5B76A 3HTKC 2MNZA 2KWJA 2YSMA 3LIDA 2L5UA 3SWFA 1WFKA 2VJFB 2LN0A 5D1LB 5TDWA 1Z2QA 5AW3B 5LKXA 1WENA 5B79A 4HYTB 4R2YA 5CMZA 2R32A 5AITA 4L7XA 2ECJA 1G25A 1CSBA 4UI9B 4JYBA 3SOUA 1LDKC 5G04B 2ECGA 2Z5IA 3A2AA 5APVA 1T2KC 3LQJA 1GU4A 5B77A 5LKTA 2YU4A 2E43A 5C11A 3C6WA 2Z5HA 2MD8C 3M9BA 3KV6A 4V3LC 5TBNA 2YW8A 3N9QA 4GNFA 2IPPA 4WZ0A 2CSYA 3DPLR 5D1MB 1BORA 2G45A 3L1XA 4N4FA 2YO3A 2KWNA 1N87A 4AUQB 2KGIA 2EGPA 5AVZB 1MM2A 5LCWB 5AVQB 4QF3A 2YNYA 3O7AA 4I7BA 4GNEA 2ECVA 3O70A 1V87A 2YT5A 3KNVA 2DX8A 2KWKA 3M63A 4BBQA 3VYIA 3VMXA 3GL6A 2KU3A 2KR4A 2CSZA 2QIZA 3M62A 3O34A 1IYMA 2H7HA 5AW6B 4A4BA 2JMJA 2LRIC 2L43A 4YABA 3I5CA 2JMIA 2KYUA 1S9KE 1JM7B 1CHCA 3M0AA 2PUYA 1JOCA 1RMDA 3NMDA 3HCUA 5AVWB 5LKUA 2KP8A 3KDPB 1WILA 3PUQA 4YC9A 3P8MC 1WESA 1GK4A 3RPGB 4B7YC 1WEMA 3NG2A 1WEPA 3O36A 1HUCA 4AYCB 3LRQA 1H88A 3ZPV1 3T7LA 4Q6FA 3L1ZB 3O35A 3HCSA 3HE5A 3O8ZA 3P32A 1A02F 5AVVB 2VPGA 2QJ0A 4ZUXU 5APXA 4P5OB 3EB5A 4AP4A 2BAYA 2F42A 5TRBA 1WEQA 2LGKA 2CKLA 1HYIA 1VD4A 2EA6A 1GU5A 3N9MA 2YUCA 2VRSA 3TNUB 1WIMA 3UIAA 2ECIA 5FB0A 1KQLA 1GD2E 2C9LY 2W6AA 2M85A 4NN2A 4YBTA 1WE9A 3RTRB 2WPRA 3LIEA 5AW9B 3V4QA 2FUUA 1WEEA 2K16A 3L35A 1HWTC 2G43A 3VMZA 2LGVA 4PTBA 5AW5B 3V43A 5AW1B 1CI6A 1NWQA 1HYJA 4RESB 5AW0B 3TK1A 5AVUB 3C5KA 3MGNA 1K2FA 5AVSB 3NXSA 4S3OB 1JUNA 2K17A 4GB0A 5LKZA 2D8SA 2YHNA 1JM7A 4IC2A 4B86A 2MA6A 3ASLA 5FERA 3VK6A 2VPEA 4I6MC 4CCGX 2RSDA 2VJFA 4FK5A 5TABA 3M91A 5AVXB 1LDJB 1MUUA 2H0DA 2MT5A 2NAAA 1J2JB 1T2KD 4JYCA 5J3XA 1VFYA 2QM8A 2MNYA 5FEYA 3TNUA 4MSXA 2W27A 2CKLB 3O33A 3N9NA 4WZ2A 4YBMA 4WA6A 4UP0A 4LLBA 1FAVA 3P7KA 1H89A 3ZVZB 4CA1A 2WWWA 5APUA 4WZ3B 2H0DB 3SOXA 2IDAA 2FUIA 1FP0A 1DH3A 2E42A 2M3HA 2ZETC 3A5TA 5H9MA 3NFQA 5AVRB 2WT7B 2Q5UA 4AYCA 5KH3A 5APQA 2C2LA 3U5PA 2WPSA 4I2LC 2BASA 2M1RA 5I3LA 2Y1MA 1CZQA 5AIUA 4YAXA 2Y1NA 1X4IA 5H1UA 1ZBDB 4YATA 1GZLA 3V5BA 4B86C 1SLQA 2YSJA 2LXPC 2ZFCA 1WEOA 5APWA 3M0DA 4FJCA 4LKAA 2YQMA 1S9KD 1MFZA 3OAKA 4AUWA 2MD7B 5KH7A 4MVTA 4AVXA 2F6JA 5G05B 5H1VA 1FOSE 4A0CD 5B78A 3L36A 2YO2A 3A3YB 2ECNA 2KWOA 3PHDA 2JMDA 4QF2A 1E4UA 5G0FA 4ZDTA 3MHSA 3L11A 2KE1A 2YURA 2LV9A 3ZTGA 2L0BA 3IHPA 3L37A 1XWHA 5KH9A 2PNXA 4GNDA 3SHBA 2OXQC 2QM7A 3HCTA 4GKGA 3A7OA 2WTYA 1X8YA 3HTKA 4GNGA 2JRJA 5EYAF 2YYRA 5DINA 2WT7A 3T97A 2QICA 2HYED 4TKPB 3KQIA 1GK6A 4N3WA 3ZNIA 4XI1A 3MD0A 3MHHA 1FBVA 3GV4A 1Z6UA 2VP7A 5C13A 5APTA 4EOTA 1NAFA 1G2CB 2XEUA 3QZVA 4XE5B 4I7DA 2LQ6A 5AW8B 3N9PA 2YHOA 2FSAA 2UZGA 4L58A 4FIPA 2Y43A 2MIQA 2VJEA 3LQIA 2P67A 4W4UA 3M06A 1FOSF 5TDRA 2XU6A 1DVPA 1WEWA 2VNFA 2WPQA 3ZVYA 2C9NY 4UP5A 4C7NA 4C7NB 2AN6A 3N9LA 2L80A 1X4UA 2P2UA 1MM3A 3B8EB 3KQGA 2MA5A 5H1TA 3ZPVE 3PURA 3HE4B 2HDPA 4A49A 5AW7B 5AW4B 5B75A 2MUMA 2KGGA 4V3KC 5B8DA 3U5NA 2YREA 3N9OA 2C2VS 3DQVR 1YYCA 5APSA 2CT2A 2F6NA 2G6QA 1GTWA 2ZXEB 1HBWA 2KFTA 2JJLA 4I7CA 3NTNA 3VMYA 1VYXA 3I2DA 1X4JA 1SP4A 2ECWA 1OXZA 3HE5B 2K1JA 4F52B 4S3OC 4C9ZA 1WEVA 5AW2B 2E6SA 3O37A 3V4WA 3SOWA 3VN0A 2VPDA 2YQLA 2L75A 4YADA 3U5OA 4YBSA 3FL2A 4R7EA 3TYYA 3IR9A 4R8PK 4GT1A 1T1HA 2XZRA 1JNMA 4LC1A 5JG6A 4ZQLA 2K4DA 1MV8A 3ZYQA 3RPGC 3U5MA 1WGMA 3LQHA 4IC3A 4FO9A 3M99A 4O64A 2RI7A 2LXHC 1IO4A 4PPEA 3T6RA 4DZOA 2XB1A 4LK9A 5AVTB 3EB6A 5D1KB 2ECTA 2LGLA 2R3CA 4AQRD 2P7JA 2KREA 3KV5A 2LDRA 4BHWA 3VTPC 1A02J 5APYA 2VJEB 2E6RA 2LGGA 1Z60A 3HE4A 2R5DA 5FB1A 2KIZA 2N9BA 2Q7CA 1HJBA 2R5BA 2XV5A 4C46A 1U6GB 4A4CA 3M9HA 1CI6B 5AVYB 2VPBA 2Q3IA 1F62A 1OWAA 4LADB 4M3LA 1WEUA
chains in the Genus database with same CATH superfamily
2PAJA 2O01N 2KLUA 2J5UA 4LLHA 1ZR2A 2ZXXA 2V7QJ 3T97B 1SQVJ 1M8OB 5B76A 3TF5A 2KWJA 1PP9G 3SWFA 2IQJA 3FXEA 1Z2QA 2W8ZA 2KNCA 3AEBC 2A45I 1G1JA 1N73C 4IL6X 1FDMA 4L7XA 1JY3P 1NTZG 1CSBA 3SOUA 2HPCB 1Q7YQ 1BCCD 2Z5IA 2K3RA 2HFED 3RBXA 5APVA 1T2KC 1GU4A 3L72E 2YU4A 2E43A 5C11A 2FD4A 3C6WA 3HUSA 3M9BA 4RJTA 4ASVA 2IPPA 3CCUP 1QEXA 2AXTE 1BORA 2KZIA 2MKEA 2G45A 3L1XA 3D6ZA 1MM2A 3MP7B 5CJ4A 1NH4A 3O7AA 4I7BA 1E5WA 3AE4C 2DX8A 1L0NJ 3VYIA 4Z0RA 3GL6A 2QIZA 3O34A 2P10A 4ZMDA 4A4BA 2JMJA 4YABA 1L0LK 3I5CA 1SQQE 1JM7B 1CHCA 3RK3C 1KMIZ 5AVWB 1BSHA 4XFJA 1FZAA 4OGQD 4B7YC 4UB8H 3L70J 1WEMA 1YTZI 2JR8A 3NG2A 3O36A 4AYCB 1KQSO 3LRQA 2IFMA 3ZPV1 1KFMA 4H13D 3BCCD 3HE5A 5AVVB 2VPGA 3L73D 1RH5B 4OGQC 4BRYA 5APXA 3BCCJ 4AP4A 1WEQA 2CKLA 1HYIA 3AEAC 4U3FJ 3GW6A 3PRJA 5FB0A 1RE3A 2RR4A 2C9LY 2W6AA 4K35A 1WRGA 5KJ7D 4YBTA 2A06D 1GW3A 3V4QA 2FUUA 1WEEA 5KLVJ 1VQ5P 5TISE 4PTBA 5AW5B 3V43A 3RGUA 2Y0CA 1HYJA 1DIPA 4GIFA 4S3OB 1NU1G 1PV3A 1Y47A 1IFNA 1LTBC 3CCRP 1JM7A 2FBWC 4W7YA 3ASLA 5FERA 3VK6A 2K9YA 4CCGX 2RSDA 2VJFA 4FK5A 3L72G 4BXLA 1MUUA 1L0NK 2MT5A 1PP9E 1EDLA 4PV1B 1KB9D 1T2KD 5CCGC 1SQXG 3QWOC 1VF5C 1VFYA 1NTMK 3H6PA 2W27A 1NU1E 1IK9A 2KI7B 3HD7C 2K9JA 2N1TD 1LGHB 3CXHE 3P7KA 1H89A 5KAIH 4CA1A 2H0DB 3BCCE 1KB9E 1FP0A 2E74D 2E42A 2M3HA 3FM8C 3NFQA 5AVRB 4UB6E 2PRRA 1OX3A 2WT7B 3AE9C 4AYCA 5KH3A 1IZNB 3WUUA 3U5PA 3RL0C 2Y1MA 1CZQA 3AE2C 5AIUA 4YAXA 3JCUH 1JMBA 1M1JA 4OWFA 1ZBDB 4D6TD 2CSVA 4B86C 2NPSC 2M3BA 3I55P 2LXPC 1VQOP 1PGPA 4A7PA 3AE6C 2YQMA 1S9KD 1SQQD 4MVTA 5CBNA 4A0CD 2B0OE 2KWOA 2WQYC 3PHDA 2CPBA 3S1KA 2OTLP 3M9QA 2HR3A 1H0TA 4QF2A 2C0XA 1X79B 2Q6QA 4O9BA 2NPSB 3HUSC 2KE1A 2YURA 2LV9A 1SQBK 4L75A 3ABVC 1YBKA 5KH9A 3SFDC 1N8RQ 3H1JD 2O1KA 3SHBA 2Q9IA 4D6TJ 2AEJA 5BU5A 3G3ZA 1YJ9P 3A7OA 2M5AA 2WTYA 1NTMD 3WU2E 2JRJA 1NTKD 2QJKC 4IOIH 1NVOA 4DOJA 3L73G 3ZNIA 2P58A 1SFCC 2WSEH 4PJ0H 3JCUE 1Z6UA 2VP7A 5APTA 4IFFA 1SQBD 2UWJE 2FFDC 1N86A 4IFMA 2LQ6A 3PLNA 2B89A 2V7QH 2UZGA 1SQBJ 3CI9A 2H8PD 1GL2B 3TGUE 2HODA 1WT6A 1IFPA 1PZQA 3Q2YA 1ZN5A 3U59A 4W4UA 5KAIE 5TDRA 2YXQB 2RN0A 1DVPA 1FJKA 2WPQA 3GLMA 1MBMA 3B5NA 1YTZT 4EYYQ 2L7PA 2G3AA 4UP5A 1UIIA 2HPCA 1AQTA 1DEBA 4C7NB 2AN6A 2FYNC 1X4UA 2P2UA 3L75G 2P1JA 3MTUE 1H0TB 1KB9H 1AVOA 1FZEA 1SQVG 3LW5H 5BU8B 2MJZA 1Y8AA 1XTCC 5B8DA 3SFEC 3MZWB 1BCCE 3G9RA 3H25A 3DQVR 1ZRTD 1L0LE 2G6QA 2ZVOB 4N6JA 4JBZA 3CCVP 1VDFA 1VYXA 2OYIC 1NTZJ 3I2DA 2IYOA 4N3YB 2K1JA 2QJPB 4F52B 1P84E 1J1DB 2JWAA 3O37A 5KJ7C 3VN0A 2YQLA 1RF0A 3RK3B 1FJPA 2E76D 3IR9A 1FU1A 4U3FD 2XZRA 5JG6A 4H0LD 5L8RJ 3LDYA 1T3JA 2WSEJ 2ZYGA 4PD4H 2QIWA 2D2CB 2RI7A 2LXHC 3T6RA 3H1HE 2XB1A 1N73B 1YHQP 2WITA 2ECTA 3USSA 2GM4A 1KORA 2GUSA 2P7JA 1BCCJ 2JO1A 3VTPC 1KV4A 2ZT9D 2E6RA 2KXPB 2K1AA 2KIZA 2N9BA 2Q7CA 3MUDC 1NTZK 3KHUA 2R5BA 4C46A 3L74D 3M9HA 1N7SC 1CI6B 1JY2N 2VPBA 2Q3IA 4M3LA 3GG2A 4X3GA 3L74J 3A0BE 2SPZA 1KYOH 4KHXA 4H44C 3LW5J 2I1JA 4RO0A 2YSMA 3V2RA 1SQXK 2L5UA 1S4XA 2LN0A 5D1LB 5TDWA 4YXWH 2A45G 4K3AA 5AW3B 4HJGH 1JY2P 1WENA 4R2YA 3PTZA 5CMZA 1AJYA 4WY4D 2NRGA 2ECJA 1M1JB 4UI9B 5G04B 2LR2A 4JPZB 5B77A 2IBZI 3P8CE 5LKTA 1RF1C 2OTJP 4GODA 1FZGA 2Z5HA 1K9MQ 2MD8C 2PGDA 3KV6A 5TBNA 3N9QA 1YIJP 4GNFA 1EZVI 2L91A 1NTKK 5D1MB 2KIKA 3H1JJ 2YO3A 3CCLP 1M1JC 1N87A 2KGIA 3E2DA 2EGPA 3L72D 2I8DA 2NPSA 5H2FH 4QF3A 1L2PA 4GNEA 3O70A 1QLED 1SQVE 1X22A 1KQFB 4BBQA 1NGMB 3VMXA 4NPEA 5BVZA 1KFNA 3M62A 5AW6B 3PJSK 3O47A 1NYHA 1FZBA 2POHA 2JMIA 3RL0g 3RL0D 4JF7A 2R3SA 2BCCJ 2PUYA 1SQPJ 3HCUA 3KDPB 1Q2NA 2GA1A 1WILA 3W68A 3SUBA 3CC4P 1WESA 1PL5A 1GK4A 3L71J 3DWDA 3SWYA 2H43A 1BGYE 3PLWA 1IFIA 1HVVA 1FZCA 3L1ZB 3O35A 4OGCA 3O8ZA 3P32A 1A02F 2PFXA 1PPJD 1WMKA 4O62A 2QJ0A 1JCCA 3VMAA 1KILC 1RE3C 3CXHI 2JKVA 3AE5C 3TSIA 4ZKUA 1EXJA 1KQLA 1BDCA 2YKPA 1SVFA 1BE3G 3PH0A 2M85A 1LNQA 1ZOYC 3LIEA 5AW9B 1E79H 1HWTC 4OVNF 2G43A 3VMZA 2FFWA 2ZT9C 4L73A 2NZ2A 3MGNA 1K2FA 4WBAA 5KJ7A 1K05A 1BDDA 3EFFK 2VPEA 1R5SA 5TABA 3M91A 5AVXB 2WSFJ 2XNDH 2NAAA 1MZ9A 1KD1Q 3V2NA 3G6EP 4MSXA 2CKLB 2WSCJ 2OYOA 2IBZG 3O33A 3WU2H 2JM3A 4WA6A 1W5CE 1DX7A 1FAVA 3AEDC 3AE7C 2QRXA 2JP3A 3ZVZB 2WWWA 3HUSB 4WVZA 3ZDMA 2IDAA 3OJAB 2FUIA 4IFDK 2ZETC 3CX5H 2Q5UA 3G71P 1JY3O 2C2LA 2WPSA 3Q5PA 2M1RA 5B5EE 5I3LA 2XNXA 1GZLA 2QSIA 1SFCB 1SLQA 2ZFCA 1PP9J 3IAOA 1BSNA 2BEZF 1KB9I 3GHGA 2XKMA 3OAKA 4NPDA 5KH7A 2Y9YA 2ECNA 1LWUC 2OYHA 1L0LD 4ASWA 2IFNA 5G0FA 5SVYA 3B5NC 1NO4A 2YIUB 3H32B 2HLOA 1LT9A 1XWHA 2IZ1A 1VQPP 5KAFE 1PGOA 5EYAF 3CX5I 2WT7A 3T97A 3Q5SA 1VQKP 2HYED 4TKPB 2W6BA 3WMM0 4N3WA 2WMMA 1JY3N 5C13A 1NAFA 3L72J 3QZVA 4I7DA 2HYNA 1OVUA 2ZT9B 4L58A 4FIPA 2VJEA 2O01J 2QJYC 5KTBA 2P67A 1FOSF 2PP6A 1JTHA 1ZMEC 2OYIB 2D2CD 1FZCB 1WEWA 2Q3EA 3CX5D 2DJAA 2C9NY 3KXDA 2J59M 4DJGA 4ZKPA 1N7LA 3B71A 3V6IA 3L71E 3PP5A 2QE7H 3H1KG 2Y9ZA 2M8RA 2JUNA 1SQPK 1LTTC 3KQGA 4GOEA 5E79E 1KILA 1JEKA 3M0DC 3CMEP 3ZPVE 5H1TA 2AEMA 3CCJP 4H0LB 3BCCG 3SWKA 4A49A 5K5GB 5AW7B 1JY2O 2D2CC 2J58A 2QJPC 4N78D 2DW3A 2MUMA 2KGGA 4V3KC 1SQPD 1PPJE 1QL1A 2YREA 2RMZA 1T3UA 4W7ZA 1YYCA 3Q1MA 5APSA 2F6NA 4F1PA 1GTWA 1HBWA 3CWBG 1BGYD 2K37A 3VMYA 1X4JA 1CW5A 2GUVA 2WSSH 1RF1A 3AEGC 1S72P 4S3OC 2HG5D 2E6SA 3V4WA 4KT0J 1ZXGA 3IF4A 1OZHA 4R7EA 5SVIB 4R8PK 2M13A 4HKZH 4PD4I 1OFCX 1MV8A 3TDKA 3CMAP 3RPGC 1QVGO 3U5MA 1PGJA 3LQHA 2AEFA 2A06E 2CRRA 2H88C 1VQMP 3B4SA 4BWNA 2FXMA 3L75E 3F89A 4IL6H 3FGAD 1VF5B 3D6YA 5D1KB 2LGLA 2R3CA 3L74E 3BRVB 2KREA 3KV5A 1GL2D 2LAUA 2LDRA 2V4HA 3EWKA 1A02J 3QH9A 3V2PA 1Z60A 1RHZB 1KILB 1GMJA 2XDJA 1QGKB 1U6GB 1VQLP 1KYOI 2EODA 3TGUG 3A0HE 1KQGB 1H8AA 5DKAA 4LJNA 3HTKC 2MNZA 4I7ZC 2LXCB 4U3FE 2VJFB 3B5ND 1GL2A 1GDTA 1DD4A 4TLFA 1LWUA 1HGZA 5LKXA 5B79A 4HYTB 3N7NA 3K5BA 3HRNA 3LVRE 1OW6A 2BCCD 3E1IA 2D8UA 4JYBA 3W67A 5H2FE 2ECGA 5KLVD 3F5HA 3H1IG 2N1TA 3EFGA 1JMMA 1FBMA 4H0LC 2OYIA 3JUEA 1JCDA 4GDOA 2CSYA 4KJMA 2JWDA 2KWNA 1URQD 3L70E 4AUQB 3JC22 3H1HG 5AVZB 4YPCA 2O3JA 5AVQB 5LCWB 2ECVA 4W80A 1KYOE 2KWKA 5KLVK 2KR4A 1SQBG 2CSZA 1AV1A 2FYUK 1IYMA 3Q1DA 4DCKA 2L43A 1EC5A 1G1IA 3CCEP 1M90Q 5EFWB 2KSJA 3IFMA 1N2DC 4Y99C 3L4FA 2E74B 1SQXE 3NMDA 2KP8A 3CCSP 1KILD 3PUQA 4PV1D 3RPGB 3C8VA 1LWUB 3CD6P 1HH0A 4I1LA 3MUDA 3KYQA 1S5LH 2LXBA 1H88A 3R2PA 4Q6FA 3PHLA 3FX0A 1SQBE 2E75C 1KYOD 3GF7A 4RKUJ 5SVXA 5B5EH 4ZUXU 2BAYA 1L4AA 4PV1C 2EXUA 5TRBA 1NOHA 2OTKE 1TU3F 3BRTB 1D7MA 3N9MA 2YUCA 2VRSA 3S4RA 1QVFO 1WIMA 2ECIA 2G8YA 1R8EA 4NN2A 1IFMA 2K16A 1SQVK 3L35A 3V2QA 1LTIC 5KLIB 2LGVA 2QG4A 1RE4A 2M5AB 5AW1B 2BCCE 3CX5E 1J1EB 3N4XA 3TK1A 5AVUB 3C5KA 4PD4D 4H13B 2K17A 2OARA 1IJDB 3L71G 1RF0C 3C1LA 1Q86Q 5LKZA 1FZCC 1FC2C 2MA6A 4I6MC 4U3FG 2KKXA 1LDJB 2H0DA 4EI2A 1LTJB 2IX7C 4H9DA 5J3XA 3FAOA 2E76C 1S5LE 2O01H 2N9YB 3H1LD 4UB6H 3N9NA 5SVIA 2L5GB 4IL6E 1NJIQ 4UP0A 1LT9C 5KAFH 5APUA 4WZ3B 1U57A 3SOXA 1JTHB 1DH3A 2WSFH 1M1KQ 5CJ0A 1NU1D 3L74G 3BATA 3H1HD 2AXTH 4I2LC 2BASA 1R5LA 2JDIH 5H1UA 1ZV8A 1X4IA 3FANA 2I1KA 4YATA 2QVAA 1Y9BA 3A0BH 2KNCB 1LT1A 1WEOA 2E74C 4H44B 3M0DA 1SQXD 2Z4EA 3H1LJ 1NTMJ 1VQNP 4Z0OA 1L0NG 5TJHA 1MFZA 1AQ5A 4AUWA 1DD3A 4AVXA 4WY4A 2F6JA 1SQXJ 5GTHE 1FOSE 4D6TE 5B78A 1ZR4A 2KS1B 1BCCG 2QJYB 3VP8A 1E4UA 1FDOA 4ZDTA 4YXDC 2Q1KA 3MHSA 3GHGB 3L11A 1NTZD 1HJ0A 2A06G 1ZW0A 2YXRB 2L0BA 3IHPA 4BRYB 2QA4P 4H44D 4U7JA 4GNDA 3CWBE 2OXQC 3FWLA 1YJNP 3HCTA 1T8ZA 1X8YA 2YYRA 4D6TG 1LTAC 1PPJG 3TGUJ 3H1KJ 5K3QA 3M7KA 1GK6A 3L75D 2RKLA 3H7HA 4L74A 3GV4A 1SFCD 4EOTA 2XEUA 1PP9D 4QMAA 4XE5B 1X0TA 5AW8B 2YHOA 5GTHH 4XA4A 2FFDA 1G2CA 3H1KE 1BE3J 3CPWO 3LQIA 1HF9A 1RQUA 1RQVA 3M06A 3CC2P 2XU6A 3CXHH 4EIJA 2EGMA 3I56P 2C0WA 1AVYA 3L70G 1AA0A 1W2BO 2IDBA 4QQ4A 4C7NA 1L4AB 2HODB 2FKWB 2ITAA 3G4SP 1MM3A 1NU1K 2MA5A 3PURA 3HE4B 3KZIH 3DDTA 3KDEC 4ZNCA 5B66H 5B75A 3HD7A 3N9OA 5KLVE 2FYUE 3H1JE 2C2VS 1LP1B 4PJ0E 2CT2A 1PFIA 2JJLA 4I7CA 1FS0E 3KPEA 1K73Q 1EDIA 2N1TC 1NKNA 3HE5B 4WB4A 1WEVA 3D71A 2OWAA 4PD4E 1HTLC 3SOWA 2OYHB 4YBSA 2VPDA 3L73J 2L75A 3CCQP 4Y99B 2AXCA 3FL2A 1P84D 3BVHA 1LTSC 3CLQA 4WWIA 3VP9A 4GT1A 1T1HA 3MDBC 4LC1A 3ZYQA 4FO9A 1X9VA 3E1RA 4DZOA 1M56D 1OMIA 4LK9A 1L0LJ 2OYHC 3FWNA 3HD7B 1RY3A 1USDA 1SQPE 2E75B 2KKYA 4AQRD 1M57D 3IN6A 2OGUA 5APYA 3HTKB 1EXIA 3HE4A 2R5DA 2WPVB 1YITP 3CXHD 5DJTB 1HJBA 1ZP0C 2ZVNB 3P8CD 1KTMA 3RL0B 2FXOA 5B66E 4LADB 3AE1C 1IFDA 3Q5RA 1DCQA 1URQB 2I50A 2E61A 2M6MA 5KKZC 2KS1A 1SQQK 5KLIC 3RK2B 1EDKA 3H1HJ 1KILE 3LIDA 1J1EC 1OW7A 1WFKA 1VL2A 1OVVA 3MHVA 3AEFC 4CPGA 3JSVC 4HB1A 1FZFA 1LJ2A 1S3JA 1T6AA 4WY4C 3WUTA 1URQC 2R32A 4L76A 5AITA 3H1IJ 1G25A 1LDKC 2FYUD 2B87A 1P84I 1JB0J 3A2AA 3RK3E 1FDIA 3LQJA 1LTJC 4C7RA 2JEEA 3B5NB 3H1IE 3L70D 2KSEA 2LKMA 1RE4C 3L73E 2YMKA 4V3LC 1GW4A 2YW8A 1NTKG 4WY4B 1NU1J 4WZ0A 2QJKB 3DPLR 3H1JG 4N4FA 1KZUB 2QEXP 5TISH 3FJUB 1SFCA 2FXPA 2YNYA 3E7KA 3II6A 1V87A 2YT5A 4OH8B 1NKZB 3KNVA 3M63A 1K8AQ 2FYUJ 1VQ8P 1GL2C 2KU3A 2Y0DA 2RH0A 2H7HA 1SQQG 5CCHC 2XOYA 2LRIC 5CCGA 1URQA 2KYUA 1EZVG 1VF5D 1S9KE 1N73A 5CCGD 3M0AA 1YJWP 1IC2A 1JOCA 1RMDA 1QX8A 1BE3D 2Y0EA 1N7SD 5LKUA 4R4MA 4GOFA 1LP1A 3Q3DA 2XP0A 4YC9A 3P8MC 1NTKJ 3H32A 1K04A 1NAYA 1P84H 2KZJA 3AE8C 2FYNB 1WEPA 2KOGA 3H1KD 3LJUX 1HUCA 3L75J 3VOPA 1YQ4C 1JO5A 1ZRTE 3T7LA 1NTMG 2CONA 2YVRA 3HCSA 2W83C 4JQ0D 3D70A 2E5YA 4P5OB 3EB5A 1MKMA 2F42A 3KZIE 2O1JA 2LGKA 3O6QA 1VD4A 2EA6A 3GF3A 1GU5A 2E76B 1NTZE 3RK3D 3TNUB 1SS1A 1BGYJ 3UIAA 1GD2E 3CWBD 1SQPG 5CHXA 2M3EA 2MKVA 5CCHA 1WE9A 2WPRA 3RTRB 3CWBJ 1VQ9P 3EQ2A 3T9KA 1CI6A 4TT3H 1NWQA 1YQ3C 4RESB 5AW0B 1FE6A 1Q81Q 5AVSB 3NXSA 1JUNA 1J1DC 3O6QB 1VPCA 1S2EA 3OW2O 4MN4C 4GB0A 1M7LA 5GTIE 2D8SA 2YHNA 1OVRA 2KYVA 3WUVA 4IC2A 4B86A 2E5TA 5E79H 3S9OA 2CK3H 3AECC 4DT0A 1J2JB 1L4AC 3AEEC 1SQVD 4JYCA 3SSUA 3CCMP 2QM8A 1VQ4P 2MNYA 2W90A 2IBZE 5FEYA 3TNUA 5CCHD 2FYUG 4N78E 4WZ2A 3H1LE 4YBMA 4OGEA 4LLBA 2ZJSE 1ZLLA 1LTJA 2YIUC 1N7SB 3A5TA 5H9MA 3OA7A 2P57A 3L71D 5APQA 2IYPA 2Y1NA 3R4YA 2K9JB 3V5BA 2YSJA 3GHGC 3A0HH 5APWA 4FJCA 4LKAA 4I7ZB 3ITKA 2MD7B 2M0BA 5G05B 4R4LA 5CBOA 5H1VA 3L36A 2YO2A 4Z1MH 2XOCA 3A3YB 1LTGC 2IZ0A 2JMDA 1NHLA 2XOZA 1PGQA 1RF1B 1EDJA 1OIPA 3MIWA 2FYZA 4NPFX 4Y28J 3ZTGA 2NPSD 3L37A 1YI2P 2PNXA 4UB8E 2QM7A 3RK2D 4GKGA 3GMAA 2B88A 3U1AA 2FY8A 3HTKA 4GNGA 1MFTA 1XTGB 5DINA 1PIXA 5M1BA 2QICA 3FXDA 3KQIA 1KN7A 1L0ND 4XI1A 3MD0A 3MHHA 1FBVA 1Q90D 1U7MA 1G2CB 1UIXA 1USEA 3N9PA 1L0LG 2FSAA 3C9IA 2Y43A 2MIQA 5KKZB 1JM0A 3RK2C 1EQ7A 4HH2A 5C39A 1N7SA 2VNFA 1HGVA 3ZVYA 2YKOA 2N1TB 2H89C 4YTPC 1S5LX 1S1CX 2E75D 1AFOA 3HD7D 3N9LA 2L80A 2B9BA 3B8EB 1L0NE 2HDPA 5GTIH 2DSMA 2ZYDA 1SQQJ 1W2EA 5AW4B 1NTME 3U5NA 2KUBA 4LGDE 1EZVE 5KLVG 3LVQE 3H1ID 2ZXEB 2KK7A 2WSCH 2KFTA 2W6JH 3CL3D 3NTNA 1IFJA 3U1CA 5DJUB 1DEEG 2YKQA 1SP4A 2ECWA 1OXZA 2KB7P 2KLVA 4H13C 4C9ZA 2BEQD 5AW2B 2ZAEB 1QL2A 1BE3E 3FEHA 4YADA 3U5OA 3TYYA 1IK7A 1L4AD 3CC7P 1KC8Q 3TGUD 1JNMA 4ZQLA 1Q82Q 2K4DA 1U7JA 3AE3C 1WGMA 4IC3A 2CRWA 3M99A 4O64A 2WVRA 1IO4A 4PPEA 3BASA 3H1LG 1EZVD 2K88A 5AVTB 3EB6A 1BGYG 1VQ7P 1OW8A 3RBZA 2ZYAA 1NTKE 2WZ7A 4BHWA 2A45H 4OGQB 2B87B 2IBZD 2BCCG 2VJEB 2LGGA 5FB1A 1LT9B 2R44A 4EDFA 2XV5A 2CPSA 4A4CA 2OQQA 2YMYA 5AVYB 2FFDB 1VQ6P 1F62A 1OWAA 1Z56A 1WEUA
chains in the Genus database with same CATH topology
2PAJA 1URQB 4X3GA 4LLHA 2I50A 2EODA 1ZR2A 2M6MA 1H8AA 5DKAA 4KHXA 1SQQK 4LJNA 3RK2B 5B76A 3HTKC 2MNZA 2I1JA 2KWJA 2YSMA 3V2RA 1SQXK 3LIDA 2L5UA 1J1EC 3SWFA 1WFKA 2VJFB 2LN0A 5D1LB 5TDWA 3B5ND 1GL2A 2A45G 1GDTA 1Z2QA 1LWUA 1FZFA 5AW3B 1HGZA 5LKXA 1JY2P 2A45I 1WENA 5B79A 4HYTB 1G1JA 4R2YA 3N7NA 1N73C 4WY4C 1URQC 3HRNA 5CMZA 1FDMA 4WY4D 2R32A 5AITA 3E1IA 4L7XA 2ECJA 1JY3P 1M1JB 1CSBA 4UI9B 4JYBA 3SOUA 1G25A 1LDKC 2HPCB 5G04B 2ECGA 2Z5IA 2HFED 3A2AA 5APVA 1T2KC 3LQJA 1GU4A 1LTJC 4C7RA 5B77A 2JEEA 3P8CE 5LKTA 2N1TA 3B5NB 1RF1C 2YU4A 3EFGA 2E43A 1JMMA 5C11A 2LKMA 1FBMA 3C6WA 1FZGA 2Z5HA 2OYIA 1RE4C 3HUSA 2MD8C 3M9BA 3KV6A 4V3LC 1GW4A 5TBNA 2YW8A 1N73A 3N9QA 4WY4B 1JCDA 4GNFA 2IPPA 4WZ0A 2CSYA 1NTKK 3DPLR 5D1MB 1BORA 2G45A 3L1XA 4N4FA 1KZUB 2YO3A 1M1JC 2KWNA 1N87A 1URQD 2KGIA 4AUQB 2EGPA 5AVZB 1MM2A 2NPSA 5CJ4A 1SFCA 5LCWB 5AVQB 4QF3A 1NH4A 2YNYA 3O7AA 4I7BA 1E5WA 4GNEA 3II6A 2ECVA 3O70A 4W80A 1V87A 2YT5A 4OH8B 1NKZB 3KNVA 2DX8A 2KWKA 3M63A 4BBQA 3VYIA 3VMXA 5KLVK 1GL2C 5BVZA 2KR4A 2KU3A 1KFNA 2CSZA 2QIZA 3GL6A 3M62A 3O34A 2FYUK 1IYMA 2H7HA 5AW6B 4A4BA 5CCHC 2JMJA 2LRIC 5CCGA 2L43A 4YABA 1L0LK 1URQA 3I5CA 1FZBA 1G1IA 2POHA 2JMIA 2KYUA 3RL0D 1S9KE 1JM7B 2KSJA 3IFMA 4JF7A 1N2DC 5CCGD 3M0AA 4Y99C 1IC2A 3L4FA 3RK3C 1CHCA 1JOCA 1RMDA 2PUYA 3NMDA 3HCUA 5AVWB 1N7SD 5LKUA 2KP8A 3KDPB 1KILD 1WILA 3PUQA 4YC9A 1FZAA 3P8MC 3H32A 1WESA 1GK4A 3RPGB 4B7YC 1WEMA 1YTZI 1LWUB 3NG2A 1WEPA 3O36A 2KOGA 1HH0A 4I1LA 3MUDA 3SWYA 1HUCA 2H43A 3VOPA 4AYCB 3KYQA 3LRQA 1IFIA 1JO5A 2IFMA 1H88A 3ZPV1 3R2PA 1HVVA 1FZCA 4Q6FA 3T7LA 1KFMA 3L1ZB 3O35A 3HCSA 3HE5A 3O8ZA 3P32A 1A02F 5AVVB 2VPGA 2QJ0A 4ZUXU 1JCCA 5APXA 4P5OB 3EB5A 4AP4A 2BAYA 1L4AA 2F42A 2O1JA 1WEQA 5TRBA 2LGKA 2CKLA 1HYIA 1KILC 1NOHA 1VD4A 1RE3C 2EA6A 3BRTB 1GU5A 3N9MA 3RK3D 2YUCA 2VRSA 3TNUB 3TSIA 1WIMA 4ZKUA 3UIAA 2ECIA 5FB0A 1KQLA 1RE3A 1GD2E 2YKPA 1SVFA 2C9LY 2W6AA 2M85A 4NN2A 1WRGA 5CHXA 5KJ7D 4YBTA 5CCHA 1WE9A 2WPRA 1GW3A 3LIEA 5AW9B 3V4QA 2FUUA 3RTRB 1IFMA 1WEEA 1SQVK 2K16A 3L35A 1HWTC 3V2QA 1LTIC 2G43A 3VMZA 2LGVA 4PTBA 3EQ2A 5AW5B 3V43A 1RE4A 5AW1B 1CI6A 1J1EB 3N4XA 1NWQA 1HYJA 4RESB 5AW0B 3TK1A 5AVUB 3C5KA 3MGNA 1K2FA 4GIFA 4WBAA 5AVSB 3NXSA 4S3OB 1JUNA 1J1DC 2K17A 2OARA 5KJ7A 1IJDB 1VPCA 1RF0C 1IFNA 1LTBC 4GB0A 5LKZA 1M7LA 2D8SA 2YHNA 2KYVA 1FZCC 1JM7A 4IC2A 4B86A 4W7YA 2MA6A 3ASLA 5FERA 3VK6A 2VPEA 4I6MC 4CCGX 2RSDA 2VJFA 4FK5A 5TABA 3M91A 5AVXB 1LDJB 1MUUA 2H0DA 1L0NK 2MT5A 2NAAA 1J2JB 1T2KD 1LTJB 1L4AC 1MZ9A 5CCGC 2IX7C 4JYCA 5J3XA 1VFYA 3V2NA 2QM8A 2MNYA 1NTMK 3H6PA 5FEYA 3TNUA 2O01H 2W27A 5CCHD 2CKLB 4MSXA 4N78E 3O33A 3N9NA 1IK9A 4WZ2A 3HD7C 4YBMA 2L5GB 4WA6A 4UP0A 1DX7A 2N1TD 1LGHB 1FAVA 4LLBA 3P7KA 1LT9C 1H89A 1ZLLA 1LTJA 3ZVZB 4CA1A 2WWWA 3HUSB 5APUA 4WZ3B 2H0DB 1N7SB 3SOXA 2IDAA 3OJAB 2FUIA 4IFDK 1FP0A 1JTHB 1DH3A 2WSFH 2E42A 2M3HA 2ZETC 3A5TA 5H9MA 3OA7A 5CJ0A 3NFQA 5AVRB 2WT7B 2Q5UA 4AYCA 5KH3A 5APQA 1JY3O 2C2LA 3BATA 3U5PA 3RL0C 2WPSA 4I2LC 2BASA 2M1RA 5I3LA 2Y1MA 1CZQA 1ZV8A 5AIUA 2Y1NA 1X4IA 4YAXA 5H1UA 1M1JA 2XNXA 2I1KA 1ZBDB 4YATA 1GZLA 3V5BA 4B86C 1SFCB 1SLQA 2NPSC 2M3BA 3GHGC 2LXPC 2YSJA 2ZFCA 1WEOA 5APWA 3M0DA 4FJCA 4LKAA 2Z4EA 2YQMA 1S9KD 3GHGA 2XKMA 1MFZA 1AQ5A 3OAKA 4AUWA 2MD7B 5KH7A 4MVTA 4AVXA 4WY4A 2F6JA 5G05B 5H1VA 1FOSE 4A0CD 5B78A 3L36A 2YO2A 1ZR4A 3A3YB 2ECNA 1LWUC 2OYHA 1LTGC 2KWOA 3PHDA 2CPBA 2JMDA 3M9QA 2IFNA 3VP8A 1NHLA 4QF2A 1E4UA 2C0XA 5G0FA 1X79B 4ZDTA 3B5NC 4O9BA 1RF1B 3MHSA 2NPSB 3MIWA 3GHGB 3L11A 1NO4A 2FYZA 3HUSC 2KE1A 2YURA 2LV9A 3ZTGA 1SQBK 2L0BA 3H32B 2NPSD 3IHPA 3L37A 2HLOA 1LT9A 1XWHA 5KH9A 2PNXA 4GNDA 3SHBA 2O1KA 2OXQC 2Q9IA 2QM7A 3RK2D 3HCTA 4GKGA 5BU5A 3G3ZA 1T8ZA 3A7OA 2WTYA 3U1AA 1X8YA 3HTKA 4GNGA 2JRJA 5EYAF 2YYRA 1XTGB 5DINA 1LTAC 2WT7A 3T97A 4DOJA 2QICA 2HYED 4TKPB 2W6BA 3KQIA 3WMM0 1GK6A 4N3WA 3ZNIA 4XI1A 1SFCC 2WSEH 3MD0A 3MHHA 1FBVA 1JY3N 1Z6UA 1SFCD 2VP7A 5APTA 4IFFA 4EOTA 1NAFA 1G2CB 2XEUA 3QZVA 2FFDC 1N86A 4XE5B 4I7DA 4IFMA 2LQ6A 2HYNA 5AW8B 3N9PA 2YHOA 2FSAA 3C9IA 4XA4A 2FFDA 1G2CA 3CI9A 2UZGA 4L58A 2H8PD 4FIPA 2Y43A 1GL2B 2MIQA 2HODA 2VJEA 1WT6A 3RK2C 3LQIA 5KTBA 1EQ7A 2P67A 1ZN5A 3U59A 4W4UA 3M06A 1FOSF 2PP6A 1JTHA 5TDRA 2XU6A 4HH2A 2OYIB 1DVPA 4EIJA 1FZCB 1N7SA 1WEWA 2VNFA 1FJKA 1HGVA 2WPQA 2YKOA 3ZVYA 2N1TB 3B5NA 1YTZT 2C9NY 2J59M 2C0WA 4ZKPA 1N7LA 1AFOA 4UP5A 2HPCA 4C7NA 1DEBA 1L4AB 2HODB 3HD7D 3PP5A 4C7NB 2AN6A 3N9LA 2L80A 2FKWB 1X4UA 2M8RA 1SQPK 2P2UA 1LTTC 3GV4A 2P1JA 3MTUE 1MM3A 3B8EB 1NU1K 3KQGA 2MA5A 1KILA 3M0DC 5H1TA 3ZPVE 1FZEA 3PURA 3HE4B 2HDPA 3LW5H 5BU8B 4A49A 5AW7B 5AW4B 1JY2O 1W2EA 2J58A 1XTCC 2MJZA 5B75A 4N78D 2MUMA 2KGGA 4V3KC 5B8DA 3U5NA 1QL1A 4LGDE 2YREA 3HD7A 3N9OA 2C2VS 3DQVR 1T3UA 4W7ZA 1YYCA 5APSA 2CT2A 2F6NA 2G6QA 1GTWA 2ZXEB 1HBWA 2WSCH 4N6JA 2KFTA 3CL3D 1PFIA 2JJLA 4I7CA 1VDFA 1IFJA 3NTNA 3U1CA 3KPEA 3VMYA 1VYXA 2OYIC 3I2DA 1X4JA 2YKQA 1CW5A 2GUVA 4N3YB 1SP4A 2N1TC 1NKNA 1RF1A 1OXZA 2KB7P 3HE5B 2ECWA 2K1JA 4F52B 2KLVA 4S3OC 2HG5D 1J1DB 4WB4A 4C9ZA 1WEVA 5AW2B 2E6SA 3O37A 3V4WA 1QL2A 3SOWA 1HTLC 5KJ7C 2OYHB 3VN0A 2VPDA 2YQLA 2L75A 4YADA 1RF0A 3U5OA 4Y99B 4YBSA 3RK3B 1FJPA 3FL2A 4R7EA 3BVHA 1LTSC 3TYYA 3IR9A 1L4AD 3CLQA 3VP9A 4R8PK 4GT1A 1T1HA 1FU1A 2XZRA 1JNMA 4LC1A 5JG6A 4ZQLA 2K4DA 1MV8A 3ZYQA 3RPGC 3U5MA 1WGMA 3LQHA 4IC3A 4FO9A 1T3JA 1X9VA 3M99A 4O64A 2RI7A 2FXMA 2LXHC 1IO4A 4PPEA 3T6RA 4DZOA 3BASA 2XB1A 1N73B 4LK9A 2OYHC 3HD7B 1RY3A 2WITA 5AVTB 3EB6A 5D1KB 2ECTA 2GM4A 2R3CA 2LGLA 4AQRD 2GUSA 2P7JA 3BRVB 2KREA 3KV5A 1GL2D 2LDRA 2WZ7A 4BHWA 3VTPC 2A45H 1A02J 5APYA 2VJEB 2E6RA 3HTKB 2LGGA 3V2PA 1Z60A 3HE4A 2R5DA 5FB1A 1KILB 2XDJA 2KIZA 2N9BA 2Q7CA 1LT9B 1NTZK 1HJBA 2R5BA 2XV5A 4C46A 1U6GB 2CPSA 4A4CA 3M9HA 3P8CD 2YMYA 1N7SC 1CI6B 5AVYB 1JY2N 3RL0B 2VPBA 5C13A 2Q3IA 2FFDB 1F62A 1OWAA 1Z56A 4M3LA 4LADB 1IFDA 1WEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3G A;  2I50 A;  2EOD A;  2M6M A;  1H8A A;  5DKA A;  4KHX A;  4LJN A;  5B76 A;  3HTK C;  2MNZ A;  2KWJ A;  2YSM A;  3LID A;  2L5U A;  3SWF A;  1WFK A;  2VJF B;  2LN0 A;  5D1L B;  5TDW A;  1Z2Q A;  5AW3 B;  5LKX A;  1WEN A;  5B79 A;  4HYT B;  4R2Y A;  5CMZ A;  2R32 A;  5AIT A;  4L7X A;  2ECJ A;  1G25 A;  1CSB A;  4UI9 B;  4JYB A;  3SOU A;  1LDK C;  5G04 B;  2ECG A;  2Z5I A;  3A2A A;  5APV A;  1T2K C;  3LQJ A;  1GU4 A;  5B77 A;  5LKT A;  2YU4 A;  2E43 A;  5C11 A;  3C6W A;  2Z5H A;  2MD8 C;  3M9B A;  3KV6 A;  4V3L C;  5TBN A;  2YW8 A;  3N9Q A;  4GNF A;  2IPP A;  4WZ0 A;  2CSY A;  3DPL R;  5D1M B;  1BOR A;  2G45 A;  3L1X A;  4N4F A;  2YO3 A;  2KWN A;  1N87 A;  4AUQ B;  2KGI A;  2EGP A;  5AVZ B;  1MM2 A;  5LCW B;  5AVQ B;  4QF3 A;  2YNY A;  3O7A A;  4I7B A;  4GNE A;  2ECV A;  3O70 A;  1V87 A;  2YT5 A;  3KNV A;  2DX8 A;  2KWK A;  3M63 A;  4BBQ A;  3VYI A;  3VMX A;  3GL6 A;  2KU3 A;  2KR4 A;  2CSZ A;  2QIZ A;  3M62 A;  3O34 A;  1IYM A;  2H7H A;  5AW6 B;  4A4B A;  2JMJ A;  2LRI C;  2L43 A;  4YAB A;  3I5C A;  2JMI A;  2KYU A;  1S9K E;  1JM7 B;  1CHC A;  3M0A A;  2PUY A;  1JOC A;  1RMD A;  3NMD A;  3HCU A;  5AVW B;  5LKU A;  2KP8 A;  3KDP B;  1WIL A;  3PUQ A;  4YC9 A;  3P8M C;  1WES A;  1GK4 A;  3RPG B;  4B7Y C;  1WEM A;  3NG2 A;  1WEP A;  3O36 A;  1HUC A;  4AYC B;  3LRQ A;  1H88 A;  3ZPV 1;  3T7L A;  4Q6F A;  3L1Z B;  3O35 A;  3HCS A;  3HE5 A;  3O8Z A;  3P32 A;  1A02 F;  5AVV B;  2VPG A;  2QJ0 A;  4ZUX U;  5APX A;  4P5O B;  3EB5 A;  4AP4 A;  2BAY A;  2F42 A;  5TRB A;  1WEQ A;  2LGK A;  2CKL A;  1HYI A;  1VD4 A;  2EA6 A;  1GU5 A;  3N9M A;  2YUC A;  2VRS A;  3TNU B;  1WIM A;  3UIA A;  2ECI A;  5FB0 A;  1KQL A;  1GD2 E;  2C9L Y;  2W6A A;  2M85 A;  4NN2 A;  4YBT A;  1WE9 A;  3RTR B;  2WPR A;  3LIE A;  5AW9 B;  3V4Q A;  2FUU A;  1WEE A;  2K16 A;  3L35 A;  1HWT C;  2G43 A;  3VMZ A;  2LGV A;  4PTB A;  5AW5 B;  3V43 A;  5AW1 B;  1CI6 A;  1NWQ A;  1HYJ A;  4RES B;  5AW0 B;  3TK1 A;  5AVU B;  3C5K A;  3MGN A;  1K2F A;  5AVS B;  3NXS A;  4S3O B;  1JUN A;  2K17 A;  4GB0 A;  5LKZ A;  2D8S A;  2YHN A;  1JM7 A;  4IC2 A;  4B86 A;  2MA6 A;  3ASL A;  5FER A;  3VK6 A;  2VPE A;  4I6M C;  4CCG X;  2RSD A;  2VJF A;  4FK5 A;  5TAB A;  3M91 A;  5AVX B;  1LDJ B;  1MUU A;  2H0D A;  2MT5 A;  2NAA A;  1J2J B;  1T2K D;  4JYC A;  5J3X A;  1VFY A;  2QM8 A;  2MNY A;  5FEY A;  3TNU A;  4MSX A;  2W27 A;  2CKL B;  3O33 A;  3N9N A;  4WZ2 A;  4YBM A;  4WA6 A;  4UP0 A;  4LLB A;  1FAV A;  3P7K A;  1H89 A;  3ZVZ B;  4CA1 A;  2WWW A;  5APU A;  4WZ3 B;  2H0D B;  3SOX A;  2IDA A;  2FUI A;  1FP0 A;  1DH3 A;  2E42 A;  2M3H A;  2ZET C;  3A5T A;  5H9M A;  3NFQ A;  5AVR B;  2WT7 B;  2Q5U A;  4AYC A;  5KH3 A;  5APQ A;  2C2L A;  3U5P A;  2WPS A;  4I2L C;  2BAS A;  2M1R A;  5I3L A;  2Y1M A;  1CZQ A;  5AIU A;  4YAX A;  2Y1N A;  1X4I A;  5H1U A;  1ZBD B;  4YAT A;  1GZL A;  3V5B A;  4B86 C;  1SLQ A;  2YSJ A;  2LXP C;  2ZFC A;  1WEO A;  5APW A;  3M0D A;  4FJC A;  4LKA A;  2YQM A;  1S9K D;  1MFZ A;  3OAK A;  4AUW A;  2MD7 B;  5KH7 A;  4MVT A;  4AVX A;  2F6J A;  5G05 B;  5H1V A;  1FOS E;  4A0C D;  5B78 A;  3L36 A;  2YO2 A;  3A3Y B;  2ECN A;  2KWO A;  3PHD A;  2JMD A;  4QF2 A;  1E4U A;  5G0F A;  4ZDT A;  3MHS A;  3L11 A;  2KE1 A;  2YUR A;  2LV9 A;  3ZTG A;  2L0B A;  3IHP A;  3L37 A;  1XWH A;  5KH9 A;  2PNX A;  4GND A;  3SHB A;  2OXQ C;  2QM7 A;  3HCT A;  4GKG A;  3A7O A;  2WTY A;  1X8Y A;  3HTK A;  4GNG A;  2JRJ A;  5EYA F;  2YYR A;  5DIN A;  2WT7 A;  3T97 A;  2QIC A;  2HYE D;  4TKP B;  3KQI A;  1GK6 A;  4N3W A;  3ZNI A;  4XI1 A;  3MD0 A;  3MHH A;  1FBV A;  3GV4 A;  1Z6U A;  2VP7 A;  5C13 A;  5APT A;  4EOT A;  1NAF A;  1G2C B;  2XEU A;  3QZV A;  4XE5 B;  4I7D A;  2LQ6 A;  5AW8 B;  3N9P A;  2YHO A;  2FSA A;  2UZG A;  4L58 A;  4FIP A;  2Y43 A;  2MIQ A;  2VJE A;  3LQI A;  2P67 A;  4W4U A;  3M06 A;  1FOS F;  5TDR A;  2XU6 A;  1DVP A;  1WEW A;  2VNF A;  2WPQ A;  3ZVY A;  2C9N Y;  4UP5 A;  4C7N A;  4C7N B;  2AN6 A;  3N9L A;  2L80 A;  1X4U A;  2P2U A;  1MM3 A;  3B8E B;  3KQG A;  2MA5 A;  5H1T A;  3ZPV E;  3PUR A;  3HE4 B;  2HDP A;  4A49 A;  5AW7 B;  5AW4 B;  5B75 A;  2MUM A;  2KGG A;  4V3K C;  5B8D A;  3U5N A;  2YRE A;  3N9O A;  2C2V S;  3DQV R;  1YYC A;  5APS A;  2CT2 A;  2F6N A;  2G6Q A;  1GTW A;  2ZXE B;  1HBW A;  2KFT A;  2JJL A;  4I7C A;  3NTN A;  3VMY A;  1VYX A;  3I2D A;  1X4J A;  1SP4 A;  2ECW A;  1OXZ A;  3HE5 B;  2K1J A;  4F52 B;  4S3O C;  4C9Z A;  1WEV A;  5AW2 B;  2E6S A;  3O37 A;  3V4W A;  3SOW A;  3VN0 A;  2VPD A;  2YQL A;  2L75 A;  4YAD A;  3U5O A;  4YBS A;  3FL2 A;  4R7E A;  3TYY A;  3IR9 A;  4R8P K;  4GT1 A;  1T1H A;  2XZR A;  1JNM A;  4LC1 A;  5JG6 A;  4ZQL A;  2K4D A;  1MV8 A;  3ZYQ A;  3RPG C;  3U5M A;  1WGM A;  3LQH A;  4IC3 A;  4FO9 A;  3M99 A;  4O64 A;  2RI7 A;  2LXH C;  1IO4 A;  4PPE A;  3T6R A;  4DZO A;  2XB1 A;  4LK9 A;  5AVT B;  3EB6 A;  5D1K B;  2ECT A;  2LGL A;  2R3C A;  4AQR D;  2P7J A;  2KRE A;  3KV5 A;  2LDR A;  4BHW A;  3VTP C;  1A02 J;  5APY A;  2VJE B;  2E6R A;  2LGG A;  1Z60 A;  3HE4 A;  2R5D A;  5FB1 A;  2KIZ A;  2N9B A;  2Q7C A;  1HJB A;  2R5B A;  2XV5 A;  4C46 A;  1U6G B;  4A4C A;  3M9H A;  1CI6 B;  5AVY B;  2VPB A;  2Q3I A;  1F62 A;  1OWA A;  4LAD B;  4M3L A;  1WEU A; 
#chains in the Genus database with same CATH topology
 2PAJ A;  2O01 N;  2KLU A;  2J5U A;  4LLH A;  1ZR2 A;  2ZXX A;  2V7Q J;  3T97 B;  1SQV J;  1M8O B;  5B76 A;  3TF5 A;  2KWJ A;  1PP9 G;  3SWF A;  2IQJ A;  3FXE A;  1Z2Q A;  2W8Z A;  2KNC A;  3AEB C;  2A45 I;  1G1J A;  1N73 C;  4IL6 X;  1FDM A;  4L7X A;  1JY3 P;  1NTZ G;  1CSB A;  3SOU A;  2HPC B;  1Q7Y Q;  1BCC D;  2Z5I A;  2K3R A;  2HFE D;  3RBX A;  5APV A;  1T2K C;  1GU4 A;  3L72 E;  2YU4 A;  2E43 A;  5C11 A;  2FD4 A;  3C6W A;  3HUS A;  3M9B A;  4RJT A;  4ASV A;  2IPP A;  3CCU P;  1QEX A;  2AXT E;  1BOR A;  2KZI A;  2MKE A;  2G45 A;  3L1X A;  3D6Z A;  1MM2 A;  3MP7 B;  5CJ4 A;  1NH4 A;  3O7A A;  4I7B A;  1E5W A;  3AE4 C;  2DX8 A;  1L0N J;  3VYI A;  4Z0R A;  3GL6 A;  2QIZ A;  3O34 A;  2P10 A;  4ZMD A;  4A4B A;  2JMJ A;  4YAB A;  1L0L K;  3I5C A;  1SQQ E;  1JM7 B;  1CHC A;  3RK3 C;  1KMI Z;  5AVW B;  1BSH A;  4XFJ A;  1FZA A;  4OGQ D;  4B7Y C;  4UB8 H;  3L70 J;  1WEM A;  1YTZ I;  2JR8 A;  3NG2 A;  3O36 A;  4AYC B;  1KQS O;  3LRQ A;  2IFM A;  3ZPV 1;  1KFM A;  4H13 D;  3BCC D;  3HE5 A;  5AVV B;  2VPG A;  3L73 D;  1RH5 B;  4OGQ C;  4BRY A;  5APX A;  3BCC J;  4AP4 A;  1WEQ A;  2CKL A;  1HYI A;  3AEA C;  4U3F J;  3GW6 A;  3PRJ A;  5FB0 A;  1RE3 A;  2RR4 A;  2C9L Y;  2W6A A;  4K35 A;  1WRG A;  5KJ7 D;  4YBT A;  2A06 D;  1GW3 A;  3V4Q A;  2FUU A;  1WEE A;  5KLV J;  1VQ5 P;  5TIS E;  4PTB A;  5AW5 B;  3V43 A;  3RGU A;  2Y0C A;  1HYJ A;  1DIP A;  4GIF A;  4S3O B;  1NU1 G;  1PV3 A;  1Y47 A;  1IFN A;  1LTB C;  3CCR P;  1JM7 A;  2FBW C;  4W7Y A;  3ASL A;  5FER A;  3VK6 A;  2K9Y A;  4CCG X;  2RSD A;  2VJF A;  4FK5 A;  3L72 G;  4BXL A;  1MUU A;  1L0N K;  2MT5 A;  1PP9 E;  1EDL A;  4PV1 B;  1KB9 D;  1T2K D;  5CCG C;  1SQX G;  3QWO C;  1VF5 C;  1VFY A;  1NTM K;  3H6P A;  2W27 A;  1NU1 E;  1IK9 A;  2KI7 B;  3HD7 C;  2K9J A;  2N1T D;  1LGH B;  3CXH E;  3P7K A;  1H89 A;  5KAI H;  4CA1 A;  2H0D B;  3BCC E;  1KB9 E;  1FP0 A;  2E74 D;  2E42 A;  2M3H A;  3FM8 C;  3NFQ A;  5AVR B;  4UB6 E;  2PRR A;  1OX3 A;  2WT7 B;  3AE9 C;  4AYC A;  5KH3 A;  1IZN B;  3WUU A;  3U5P A;  3RL0 C;  2Y1M A;  1CZQ A;  3AE2 C;  5AIU A;  4YAX A;  3JCU H;  1JMB A;  1M1J A;  4OWF A;  1ZBD B;  4D6T D;  2CSV A;  4B86 C;  2NPS C;  2M3B A;  3I55 P;  2LXP C;  1VQO P;  1PGP A;  4A7P A;  3AE6 C;  2YQM A;  1S9K D;  1SQQ D;  4MVT A;  5CBN A;  4A0C D;  2B0O E;  2KWO A;  2WQY C;  3PHD A;  2CPB A;  3S1K A;  2OTL P;  3M9Q A;  2HR3 A;  1H0T A;  4QF2 A;  2C0X A;  1X79 B;  2Q6Q A;  4O9B A;  2NPS B;  3HUS C;  2KE1 A;  2YUR A;  2LV9 A;  1SQB K;  4L75 A;  3ABV C;  1YBK A;  5KH9 A;  3SFD C;  1N8R Q;  3H1J D;  2O1K A;  3SHB A;  2Q9I A;  4D6T J;  2AEJ A;  5BU5 A;  3G3Z A;  1YJ9 P;  3A7O A;  2M5A A;  2WTY A;  1NTM D;  3WU2 E;  2JRJ A;  1NTK D;  2QJK C;  4IOI H;  1NVO A;  4DOJ A;  3L73 G;  3ZNI A;  2P58 A;  1SFC C;  2WSE H;  4PJ0 H;  3JCU E;  1Z6U A;  2VP7 A;  5APT A;  4IFF A;  1SQB D;  2UWJ E;  2FFD C;  1N86 A;  4IFM A;  2LQ6 A;  3PLN A;  2B89 A;  2V7Q H;  2UZG A;  1SQB J;  3CI9 A;  2H8P D;  1GL2 B;  3TGU E;  2HOD A;  1WT6 A;  1IFP A;  1PZQ A;  3Q2Y A;  1ZN5 A;  3U59 A;  4W4U A;  5KAI E;  5TDR A;  2YXQ B;  2RN0 A;  1DVP A;  1FJK A;  2WPQ A;  3GLM A;  1MBM A;  3B5N A;  1YTZ T;  4EYY Q;  2L7P A;  2G3A A;  4UP5 A;  1UII A;  2HPC A;  1AQT A;  1DEB A;  4C7N B;  2AN6 A;  2FYN C;  1X4U A;  2P2U A;  3L75 G;  2P1J A;  3MTU E;  1H0T B;  1KB9 H;  1AVO A;  1FZE A;  1SQV G;  3LW5 H;  5BU8 B;  2MJZ A;  1Y8A A;  1XTC C;  5B8D A;  3SFE C;  3MZW B;  1BCC E;  3G9R A;  3H25 A;  3DQV R;  1ZRT D;  1L0L E;  2G6Q A;  2ZVO B;  4N6J A;  4JBZ A;  3CCV P;  1VDF A;  1VYX A;  2OYI C;  1NTZ J;  3I2D A;  2IYO A;  4N3Y B;  2K1J A;  2QJP B;  4F52 B;  1P84 E;  1J1D B;  2JWA A;  3O37 A;  5KJ7 C;  3VN0 A;  2YQL A;  1RF0 A;  3RK3 B;  1FJP A;  2E76 D;  3IR9 A;  1FU1 A;  4U3F D;  2XZR A;  5JG6 A;  4H0L D;  5L8R J;  3LDY A;  1T3J A;  2WSE J;  2ZYG A;  4PD4 H;  2QIW A;  2D2C B;  2RI7 A;  2LXH C;  3T6R A;  3H1H E;  2XB1 A;  1N73 B;  1YHQ P;  2WIT A;  2ECT A;  3USS A;  2GM4 A;  1KOR A;  2GUS A;  2P7J A;  1BCC J;  2JO1 A;  3VTP C;  1KV4 A;  2ZT9 D;  2E6R A;  2KXP B;  2K1A A;  2KIZ A;  2N9B A;  2Q7C A;  3MUD C;  1NTZ K;  3KHU A;  2R5B A;  4C46 A;  3L74 D;  3M9H A;  1N7S C;  1CI6 B;  1JY2 N;  2VPB A;  2Q3I A;  4M3L A;  3GG2 A;  4X3G A;  3L74 J;  3A0B E;  2SPZ A;  1KYO H;  4KHX A;  4H44 C;  3LW5 J;  2I1J A;  4RO0 A;  2YSM A;  3V2R A;  1SQX K;  2L5U A;  1S4X A;  2LN0 A;  5D1L B;  5TDW A;  4YXW H;  2A45 G;  4K3A A;  5AW3 B;  4HJG H;  1JY2 P;  1WEN A;  4R2Y A;  3PTZ A;  5CMZ A;  1AJY A;  4WY4 D;  2NRG A;  2ECJ A;  1M1J B;  4UI9 B;  5G04 B;  2LR2 A;  4JPZ B;  5B77 A;  2IBZ I;  3P8C E;  5LKT A;  1RF1 C;  2OTJ P;  4GOD A;  1FZG A;  2Z5H A;  1K9M Q;  2MD8 C;  2PGD A;  3KV6 A;  5TBN A;  3N9Q A;  1YIJ P;  4GNF A;  1EZV I;  2L91 A;  1NTK K;  5D1M B;  2KIK A;  3H1J J;  2YO3 A;  3CCL P;  1M1J C;  1N87 A;  2KGI A;  3E2D A;  2EGP A;  3L72 D;  2I8D A;  2NPS A;  5H2F H;  4QF3 A;  1L2P A;  4GNE A;  3O70 A;  1QLE D;  1SQV E;  1X22 A;  1KQF B;  4BBQ A;  1NGM B;  3VMX A;  4NPE A;  5BVZ A;  1KFN A;  3M62 A;  5AW6 B;  3PJS K;  3O47 A;  1NYH A;  1FZB A;  2POH A;  2JMI A;  3RL0 g;  3RL0 D;  4JF7 A;  2R3S A;  2BCC J;  2PUY A;  1SQP J;  3HCU A;  3KDP B;  1Q2N A;  2GA1 A;  1WIL A;  3W68 A;  3SUB A;  3CC4 P;  1WES A;  1PL5 A;  1GK4 A;  3L71 J;  3DWD A;  3SWY A;  2H43 A;  1BGY E;  3PLW A;  1IFI A;  1HVV A;  1FZC A;  3L1Z B;  3O35 A;  4OGC A;  3O8Z A;  3P32 A;  1A02 F;  2PFX A;  1PPJ D;  1WMK A;  4O62 A;  2QJ0 A;  1JCC A;  3VMA A;  1KIL C;  1RE3 C;  3CXH I;  2JKV A;  3AE5 C;  3TSI A;  4ZKU A;  1EXJ A;  1KQL A;  1BDC A;  2YKP A;  1SVF A;  1BE3 G;  3PH0 A;  2M85 A;  1LNQ A;  1ZOY C;  3LIE A;  5AW9 B;  1E79 H;  1HWT C;  4OVN F;  2G43 A;  3VMZ A;  2FFW A;  2ZT9 C;  4L73 A;  2NZ2 A;  3MGN A;  1K2F A;  4WBA A;  5KJ7 A;  1K05 A;  1BDD A;  3EFF K;  2VPE A;  1R5S A;  5TAB A;  3M91 A;  5AVX B;  2WSF J;  2XND H;  2NAA A;  1MZ9 A;  1KD1 Q;  3V2N A;  3G6E P;  4MSX A;  2CKL B;  2WSC J;  2OYO A;  2IBZ G;  3O33 A;  3WU2 H;  2JM3 A;  4WA6 A;  1W5C E;  1DX7 A;  1FAV A;  3AED C;  3AE7 C;  2QRX A;  2JP3 A;  3ZVZ B;  2WWW A;  3HUS B;  4WVZ A;  3ZDM A;  2IDA A;  3OJA B;  2FUI A;  4IFD K;  2ZET C;  3CX5 H;  2Q5U A;  3G71 P;  1JY3 O;  2C2L A;  2WPS A;  3Q5P A;  2M1R A;  5B5E E;  5I3L A;  2XNX A;  1GZL A;  2QSI A;  1SFC B;  1SLQ A;  2ZFC A;  1PP9 J;  3IAO A;  1BSN A;  2BEZ F;  1KB9 I;  3GHG A;  2XKM A;  3OAK A;  4NPD A;  5KH7 A;  2Y9Y A;  2ECN A;  1LWU C;  2OYH A;  1L0L D;  4ASW A;  2IFN A;  5G0F A;  5SVY A;  3B5N C;  1NO4 A;  2YIU B;  3H32 B;  2HLO A;  1LT9 A;  1XWH A;  2IZ1 A;  1VQP P;  5KAF E;  1PGO A;  5EYA F;  3CX5 I;  2WT7 A;  3T97 A;  3Q5S A;  1VQK P;  2HYE D;  4TKP B;  2W6B A;  3WMM 0;  4N3W A;  2WMM A;  1JY3 N;  5C13 A;  1NAF A;  3L72 J;  3QZV A;  4I7D A;  2HYN A;  1OVU A;  2ZT9 B;  4L58 A;  4FIP A;  2VJE A;  2O01 J;  2QJY C;  5KTB A;  2P67 A;  1FOS F;  2PP6 A;  1JTH A;  1ZME C;  2OYI B;  2D2C D;  1FZC B;  1WEW A;  2Q3E A;  3CX5 D;  2DJA A;  2C9N Y;  3KXD A;  2J59 M;  4DJG A;  4ZKP A;  1N7L A;  3B71 A;  3V6I A;  3L71 E;  3PP5 A;  2QE7 H;  3H1K G;  2Y9Z A;  2M8R A;  2JUN A;  1SQP K;  1LTT C;  3KQG A;  4GOE A;  5E79 E;  1KIL A;  1JEK A;  3M0D C;  3CME P;  3ZPV E;  5H1T A;  2AEM A;  3CCJ P;  4H0L B;  3BCC G;  3SWK A;  4A49 A;  5K5G B;  5AW7 B;  1JY2 O;  2D2C C;  2J58 A;  2QJP C;  4N78 D;  2DW3 A;  2MUM A;  2KGG A;  4V3K C;  1SQP D;  1PPJ E;  1QL1 A;  2YRE A;  2RMZ A;  1T3U A;  4W7Z A;  1YYC A;  3Q1M A;  5APS A;  2F6N A;  4F1P A;  1GTW A;  1HBW A;  3CWB G;  1BGY D;  2K37 A;  3VMY A;  1X4J A;  1CW5 A;  2GUV A;  2WSS H;  1RF1 A;  3AEG C;  1S72 P;  4S3O C;  2HG5 D;  2E6S A;  3V4W A;  4KT0 J;  1ZXG A;  3IF4 A;  1OZH A;  4R7E A;  5SVI B;  4R8P K;  2M13 A;  4HKZ H;  4PD4 I;  1OFC X;  1MV8 A;  3TDK A;  3CMA P;  3RPG C;  1QVG O;  3U5M A;  1PGJ A;  3LQH A;  2AEF A;  2A06 E;  2CRR A;  2H88 C;  1VQM P;  3B4S A;  4BWN A;  2FXM A;  3L75 E;  3F89 A;  4IL6 H;  3FGA D;  1VF5 B;  3D6Y A;  5D1K B;  2LGL A;  2R3C A;  3L74 E;  3BRV B;  2KRE A;  3KV5 A;  1GL2 D;  2LAU A;  2LDR A;  2V4H A;  3EWK A;  1A02 J;  3QH9 A;  3V2P A;  1Z60 A;  1RHZ B;  1KIL B;  1GMJ A;  2XDJ A;  1QGK B;  1U6G B;  1VQL P;  1KYO I;  2EOD A;  3TGU G;  3A0H E;  1KQG B;  1H8A A;  5DKA A;  4LJN A;  3HTK C;  2MNZ A;  4I7Z C;  2LXC B;  4U3F E;  2VJF B;  3B5N D;  1GL2 A;  1GDT A;  1DD4 A;  4TLF A;  1LWU A;  1HGZ A;  5LKX A;  5B79 A;  4HYT B;  3N7N A;  3K5B A;  3HRN A;  3LVR E;  1OW6 A;  2BCC D;  3E1I A;  2D8U A;  4JYB A;  3W67 A;  5H2F E;  2ECG A;  5KLV D;  3F5H A;  3H1I G;  2N1T A;  3EFG A;  1JMM A;  1FBM A;  4H0L C;  2OYI A;  3JUE A;  1JCD A;  4GDO A;  2CSY A;  4KJM A;  2JWD A;  2KWN A;  1URQ D;  3L70 E;  4AUQ B;  3JC2 2;  3H1H G;  5AVZ B;  4YPC A;  2O3J A;  5AVQ B;  5LCW B;  2ECV A;  4W80 A;  1KYO E;  2KWK A;  5KLV K;  2KR4 A;  1SQB G;  2CSZ A;  1AV1 A;  2FYU K;  1IYM A;  3Q1D A;  4DCK A;  2L43 A;  1EC5 A;  1G1I A;  3CCE P;  1M90 Q;  5EFW B;  2KSJ A;  3IFM A;  1N2D C;  4Y99 C;  3L4F A;  2E74 B;  1SQX E;  3NMD A;  2KP8 A;  3CCS P;  1KIL D;  3PUQ A;  4PV1 D;  3RPG B;  3C8V A;  1LWU B;  3CD6 P;  1HH0 A;  4I1L A;  3MUD A;  3KYQ A;  1S5L H;  2LXB A;  1H88 A;  3R2P A;  4Q6F A;  3PHL A;  3FX0 A;  1SQB E;  2E75 C;  1KYO D;  3GF7 A;  4RKU J;  5SVX A;  5B5E H;  4ZUX U;  2BAY A;  1L4A A;  4PV1 C;  2EXU A;  5TRB A;  1NOH A;  2OTK E;  1TU3 F;  3BRT B;  1D7M A;  3N9M A;  2YUC A;  2VRS A;  3S4R A;  1QVF O;  1WIM A;  2ECI A;  2G8Y A;  1R8E A;  4NN2 A;  1IFM A;  2K16 A;  1SQV K;  3L35 A;  3V2Q A;  1LTI C;  5KLI B;  2LGV A;  2QG4 A;  1RE4 A;  2M5A B;  5AW1 B;  2BCC E;  3CX5 E;  1J1E B;  3N4X A;  3TK1 A;  5AVU B;  3C5K A;  4PD4 D;  4H13 B;  2K17 A;  2OAR A;  1IJD B;  3L71 G;  1RF0 C;  3C1L A;  1Q86 Q;  5LKZ A;  1FZC C;  1FC2 C;  2MA6 A;  4I6M C;  4U3F G;  2KKX A;  1LDJ B;  2H0D A;  4EI2 A;  1LTJ B;  2IX7 C;  4H9D A;  5J3X A;  3FAO A;  2E76 C;  1S5L E;  2O01 H;  2N9Y B;  3H1L D;  4UB6 H;  3N9N A;  5SVI A;  2L5G B;  4IL6 E;  1NJI Q;  4UP0 A;  1LT9 C;  5KAF H;  5APU A;  4WZ3 B;  1U57 A;  3SOX A;  1JTH B;  1DH3 A;  2WSF H;  1M1K Q;  5CJ0 A;  1NU1 D;  3L74 G;  3BAT A;  3H1H D;  2AXT H;  4I2L C;  2BAS A;  1R5L A;  2JDI H;  5H1U A;  1ZV8 A;  1X4I A;  3FAN A;  2I1K A;  4YAT A;  2QVA A;  1Y9B A;  3A0B H;  2KNC B;  1LT1 A;  1WEO A;  2E74 C;  4H44 B;  3M0D A;  1SQX D;  2Z4E A;  3H1L J;  1NTM J;  1VQN P;  4Z0O A;  1L0N G;  5TJH A;  1MFZ A;  1AQ5 A;  4AUW A;  1DD3 A;  4AVX A;  4WY4 A;  2F6J A;  1SQX J;  5GTH E;  1FOS E;  4D6T E;  5B78 A;  1ZR4 A;  2KS1 B;  1BCC G;  2QJY B;  3VP8 A;  1E4U A;  1FDO A;  4ZDT A;  4YXD C;  2Q1K A;  3MHS A;  3GHG B;  3L11 A;  1NTZ D;  1HJ0 A;  2A06 G;  1ZW0 A;  2YXR B;  2L0B A;  3IHP A;  4BRY B;  2QA4 P;  4H44 D;  4U7J A;  4GND A;  3CWB E;  2OXQ C;  3FWL A;  1YJN P;  3HCT A;  1T8Z A;  1X8Y A;  2YYR A;  4D6T G;  1LTA C;  1PPJ G;  3TGU J;  3H1K J;  5K3Q A;  3M7K A;  1GK6 A;  3L75 D;  2RKL A;  3H7H A;  4L74 A;  3GV4 A;  1SFC D;  4EOT A;  2XEU A;  1PP9 D;  4QMA A;  4XE5 B;  1X0T A;  5AW8 B;  2YHO A;  5GTH H;  4XA4 A;  2FFD A;  1G2C A;  3H1K E;  1BE3 J;  3CPW O;  3LQI A;  1HF9 A;  1RQU A;  1RQV A;  3M06 A;  3CC2 P;  2XU6 A;  3CXH H;  4EIJ A;  2EGM A;  3I56 P;  2C0W A;  1AVY A;  3L70 G;  1AA0 A;  1W2B O;  2IDB A;  4QQ4 A;  4C7N A;  1L4A B;  2HOD B;  2FKW B;  2ITA A;  3G4S P;  1MM3 A;  1NU1 K;  2MA5 A;  3PUR A;  3HE4 B;  3KZI H;  3DDT A;  3KDE C;  4ZNC A;  5B66 H;  5B75 A;  3HD7 A;  3N9O A;  5KLV E;  2FYU E;  3H1J E;  2C2V S;  1LP1 B;  4PJ0 E;  2CT2 A;  1PFI A;  2JJL A;  4I7C A;  1FS0 E;  3KPE A;  1K73 Q;  1EDI A;  2N1T C;  1NKN A;  3HE5 B;  4WB4 A;  1WEV A;  3D71 A;  2OWA A;  4PD4 E;  1HTL C;  3SOW A;  2OYH B;  4YBS A;  2VPD A;  3L73 J;  2L75 A;  3CCQ P;  4Y99 B;  2AXC A;  3FL2 A;  1P84 D;  3BVH A;  1LTS C;  3CLQ A;  4WWI A;  3VP9 A;  4GT1 A;  1T1H A;  3MDB C;  4LC1 A;  3ZYQ A;  4FO9 A;  1X9V A;  3E1R A;  4DZO A;  1M56 D;  1OMI A;  4LK9 A;  1L0L J;  2OYH C;  3FWN A;  3HD7 B;  1RY3 A;  1USD A;  1SQP E;  2E75 B;  2KKY A;  4AQR D;  1M57 D;  3IN6 A;  2OGU A;  5APY A;  3HTK B;  1EXI A;  3HE4 A;  2R5D A;  2WPV B;  1YIT P;  3CXH D;  5DJT B;  1HJB A;  1ZP0 C;  2ZVN B;  3P8C D;  1KTM A;  3RL0 B;  2FXO A;  5B66 E;  4LAD B;  3AE1 C;  1IFD A;  3Q5R A;  1DCQ A;  1URQ B;  2I50 A;  2E61 A;  2M6M A;  5KKZ C;  2KS1 A;  1SQQ K;  5KLI C;  3RK2 B;  1EDK A;  3H1H J;  1KIL E;  3LID A;  1J1E C;  1OW7 A;  1WFK A;  1VL2 A;  1OVV A;  3MHV A;  3AEF C;  4CPG A;  3JSV C;  4HB1 A;  1FZF A;  1LJ2 A;  1S3J A;  1T6A A;  4WY4 C;  3WUT A;  1URQ C;  2R32 A;  4L76 A;  5AIT A;  3H1I J;  1G25 A;  1LDK C;  2FYU D;  2B87 A;  1P84 I;  1JB0 J;  3A2A A;  3RK3 E;  1FDI A;  3LQJ A;  1LTJ C;  4C7R A;  2JEE A;  3B5N B;  3H1I E;  3L70 D;  2KSE A;  2LKM A;  1RE4 C;  3L73 E;  2YMK A;  4V3L C;  1GW4 A;  2YW8 A;  1NTK G;  4WY4 B;  1NU1 J;  4WZ0 A;  2QJK B;  3DPL R;  3H1J G;  4N4F A;  1KZU B;  2QEX P;  5TIS H;  3FJU B;  1SFC A;  2FXP A;  2YNY A;  3E7K A;  3II6 A;  1V87 A;  2YT5 A;  4OH8 B;  1NKZ B;  3KNV A;  3M63 A;  1K8A Q;  2FYU J;  1VQ8 P;  1GL2 C;  2KU3 A;  2Y0D A;  2RH0 A;  2H7H A;  1SQQ G;  5CCH C;  2XOY A;  2LRI C;  5CCG A;  1URQ A;  2KYU A;  1EZV G;  1VF5 D;  1S9K E;  1N73 A;  5CCG D;  3M0A A;  1YJW P;  1IC2 A;  1JOC A;  1RMD A;  1QX8 A;  1BE3 D;  2Y0E A;  1N7S D;  5LKU A;  4R4M A;  4GOF A;  1LP1 A;  3Q3D A;  2XP0 A;  4YC9 A;  3P8M C;  1NTK J;  3H32 A;  1K04 A;  1NAY A;  1P84 H;  2KZJ A;  3AE8 C;  2FYN B;  1WEP A;  2KOG A;  3H1K D;  3LJU X;  1HUC A;  3L75 J;  3VOP A;  1YQ4 C;  1JO5 A;  1ZRT E;  3T7L A;  1NTM G;  2CON A;  2YVR A;  3HCS A;  2W83 C;  4JQ0 D;  3D70 A;  2E5Y A;  4P5O B;  3EB5 A;  1MKM A;  2F42 A;  3KZI E;  2O1J A;  2LGK A;  3O6Q A;  1VD4 A;  2EA6 A;  3GF3 A;  1GU5 A;  2E76 B;  1NTZ E;  3RK3 D;  3TNU B;  1SS1 A;  1BGY J;  3UIA A;  1GD2 E;  3CWB D;  1SQP G;  5CHX A;  2M3E A;  2MKV A;  5CCH A;  1WE9 A;  2WPR A;  3RTR B;  3CWB J;  1VQ9 P;  3EQ2 A;  3T9K A;  1CI6 A;  4TT3 H;  1NWQ A;  1YQ3 C;  4RES B;  5AW0 B;  1FE6 A;  1Q81 Q;  5AVS B;  3NXS A;  1JUN A;  1J1D C;  3O6Q B;  1VPC A;  1S2E A;  3OW2 O;  4MN4 C;  4GB0 A;  1M7L A;  5GTI E;  2D8S A;  2YHN A;  1OVR A;  2KYV A;  3WUV A;  4IC2 A;  4B86 A;  2E5T A;  5E79 H;  3S9O A;  2CK3 H;  3AEC C;  4DT0 A;  1J2J B;  1L4A C;  3AEE C;  1SQV D;  4JYC A;  3SSU A;  3CCM P;  2QM8 A;  1VQ4 P;  2MNY A;  2W90 A;  2IBZ E;  5FEY A;  3TNU A;  5CCH D;  2FYU G;  4N78 E;  4WZ2 A;  3H1L E;  4YBM A;  4OGE A;  4LLB A;  2ZJS E;  1ZLL A;  1LTJ A;  2YIU C;  1N7S B;  3A5T A;  5H9M A;  3OA7 A;  2P57 A;  3L71 D;  5APQ A;  2IYP A;  2Y1N A;  3R4Y A;  2K9J B;  3V5B A;  2YSJ A;  3GHG C;  3A0H H;  5APW A;  4FJC A;  4LKA A;  4I7Z B;  3ITK A;  2MD7 B;  2M0B A;  5G05 B;  4R4L A;  5CBO A;  5H1V A;  3L36 A;  2YO2 A;  4Z1M H;  2XOC A;  3A3Y B;  1LTG C;  2IZ0 A;  2JMD A;  1NHL A;  2XOZ A;  1PGQ A;  1RF1 B;  1EDJ A;  1OIP A;  3MIW A;  2FYZ A;  4NPF X;  4Y28 J;  3ZTG A;  2NPS D;  3L37 A;  1YI2 P;  2PNX A;  4UB8 E;  2QM7 A;  3RK2 D;  4GKG A;  3GMA A;  2B88 A;  3U1A A;  2FY8 A;  3HTK A;  4GNG A;  1MFT A;  1XTG B;  5DIN A;  1PIX A;  5M1B A;  2QIC A;  3FXD A;  3KQI A;  1KN7 A;  1L0N D;  4XI1 A;  3MD0 A;  3MHH A;  1FBV A;  1Q90 D;  1U7M A;  1G2C B;  1UIX A;  1USE A;  3N9P A;  1L0L G;  2FSA A;  3C9I A;  2Y43 A;  2MIQ A;  5KKZ B;  1JM0 A;  3RK2 C;  1EQ7 A;  4HH2 A;  5C39 A;  1N7S A;  2VNF A;  1HGV A;  3ZVY A;  2YKO A;  2N1T B;  2H89 C;  4YTP C;  1S5L X;  1S1C X;  2E75 D;  1AFO A;  3HD7 D;  3N9L A;  2L80 A;  2B9B A;  3B8E B;  1L0N E;  2HDP A;  5GTI H;  2DSM A;  2ZYD A;  1SQQ J;  1W2E A;  5AW4 B;  1NTM E;  3U5N A;  2KUB A;  4LGD E;  1EZV E;  5KLV G;  3LVQ E;  3H1I D;  2ZXE B;  2KK7 A;  2WSC H;  2KFT A;  2W6J H;  3CL3 D;  3NTN A;  1IFJ A;  3U1C A;  5DJU B;  1DEE G;  2YKQ A;  1SP4 A;  2ECW A;  1OXZ A;  2KB7 P;  2KLV A;  4H13 C;  4C9Z A;  2BEQ D;  5AW2 B;  2ZAE B;  1QL2 A;  1BE3 E;  3FEH A;  4YAD A;  3U5O A;  3TYY A;  1IK7 A;  1L4A D;  3CC7 P;  1KC8 Q;  3TGU D;  1JNM A;  4ZQL A;  1Q82 Q;  2K4D A;  1U7J A;  3AE3 C;  1WGM A;  4IC3 A;  2CRW A;  3M99 A;  4O64 A;  2WVR A;  1IO4 A;  4PPE A;  3BAS A;  3H1L G;  1EZV D;  2K88 A;  5AVT B;  3EB6 A;  1BGY G;  1VQ7 P;  1OW8 A;  3RBZ A;  2ZYA A;  1NTK E;  2WZ7 A;  4BHW A;  2A45 H;  4OGQ B;  2B87 B;  2IBZ D;  2BCC G;  2VJE B;  2LGG A;  5FB1 A;  1LT9 B;  2R44 A;  4EDF A;  2XV5 A;  2CPS A;  4A4C A;  2OQQ A;  2YMY A;  5AVY B;  2FFD B;  1VQ6 P;  1F62 A;  1OWA A;  1Z56 A;  1WEU A; 
#chains in the Genus database with same CATH homology
 2PAJ A;  1URQ B;  4X3G A;  4LLH A;  2I50 A;  2EOD A;  1ZR2 A;  2M6M A;  1H8A A;  5DKA A;  4KHX A;  1SQQ K;  4LJN A;  3RK2 B;  5B76 A;  3HTK C;  2MNZ A;  2I1J A;  2KWJ A;  2YSM A;  3V2R A;  1SQX K;  3LID A;  2L5U A;  1J1E C;  3SWF A;  1WFK A;  2VJF B;  2LN0 A;  5D1L B;  5TDW A;  3B5N D;  1GL2 A;  2A45 G;  1GDT A;  1Z2Q A;  1LWU A;  1FZF A;  5AW3 B;  1HGZ A;  5LKX A;  1JY2 P;  2A45 I;  1WEN A;  5B79 A;  4HYT B;  1G1J A;  4R2Y A;  3N7N A;  1N73 C;  4WY4 C;  1URQ C;  3HRN A;  5CMZ A;  1FDM A;  4WY4 D;  2R32 A;  5AIT A;  3E1I A;  4L7X A;  2ECJ A;  1JY3 P;  1M1J B;  1CSB A;  4UI9 B;  4JYB A;  3SOU A;  1G25 A;  1LDK C;  2HPC B;  5G04 B;  2ECG A;  2Z5I A;  2HFE D;  3A2A A;  5APV A;  1T2K C;  3LQJ A;  1GU4 A;  1LTJ C;  4C7R A;  5B77 A;  2JEE A;  3P8C E;  5LKT A;  2N1T A;  3B5N B;  1RF1 C;  2YU4 A;  3EFG A;  2E43 A;  1JMM A;  5C11 A;  2LKM A;  1FBM A;  3C6W A;  1FZG A;  2Z5H A;  2OYI A;  1RE4 C;  3HUS A;  2MD8 C;  3M9B A;  3KV6 A;  4V3L C;  1GW4 A;  5TBN A;  2YW8 A;  1N73 A;  3N9Q A;  4WY4 B;  1JCD A;  4GNF A;  2IPP A;  4WZ0 A;  2CSY A;  1NTK K;  3DPL R;  5D1M B;  1BOR A;  2G45 A;  3L1X A;  4N4F A;  1KZU B;  2YO3 A;  1M1J C;  2KWN A;  1N87 A;  1URQ D;  2KGI A;  4AUQ B;  2EGP A;  5AVZ B;  1MM2 A;  2NPS A;  5CJ4 A;  1SFC A;  5LCW B;  5AVQ B;  4QF3 A;  1NH4 A;  2YNY A;  3O7A A;  4I7B A;  1E5W A;  4GNE A;  3II6 A;  2ECV A;  3O70 A;  4W80 A;  1V87 A;  2YT5 A;  4OH8 B;  1NKZ B;  3KNV A;  2DX8 A;  2KWK A;  3M63 A;  4BBQ A;  3VYI A;  3VMX A;  5KLV K;  1GL2 C;  5BVZ A;  2KR4 A;  2KU3 A;  1KFN A;  2CSZ A;  2QIZ A;  3GL6 A;  3M62 A;  3O34 A;  2FYU K;  1IYM A;  2H7H A;  5AW6 B;  4A4B A;  5CCH C;  2JMJ A;  2LRI C;  5CCG A;  2L43 A;  4YAB A;  1L0L K;  1URQ A;  3I5C A;  1FZB A;  1G1I A;  2POH A;  2JMI A;  2KYU A;  3RL0 D;  1S9K E;  1JM7 B;  2KSJ A;  3IFM A;  4JF7 A;  1N2D C;  5CCG D;  3M0A A;  4Y99 C;  1IC2 A;  3L4F A;  3RK3 C;  1CHC A;  1JOC A;  1RMD A;  2PUY A;  3NMD A;  3HCU A;  5AVW B;  1N7S D;  5LKU A;  2KP8 A;  3KDP B;  1KIL D;  1WIL A;  3PUQ A;  4YC9 A;  1FZA A;  3P8M C;  3H32 A;  1WES A;  1GK4 A;  3RPG B;  4B7Y C;  1WEM A;  1YTZ I;  1LWU B;  3NG2 A;  1WEP A;  3O36 A;  2KOG A;  1HH0 A;  4I1L A;  3MUD A;  3SWY A;  1HUC A;  2H43 A;  3VOP A;  4AYC B;  3KYQ A;  3LRQ A;  1IFI A;  1JO5 A;  2IFM A;  1H88 A;  3ZPV 1;  3R2P A;  1HVV A;  1FZC A;  4Q6F A;  3T7L A;  1KFM A;  3L1Z B;  3O35 A;  3HCS A;  3HE5 A;  3O8Z A;  3P32 A;  1A02 F;  5AVV B;  2VPG A;  2QJ0 A;  4ZUX U;  1JCC A;  5APX A;  4P5O B;  3EB5 A;  4AP4 A;  2BAY A;  1L4A A;  2F42 A;  2O1J A;  1WEQ A;  5TRB A;  2LGK A;  2CKL A;  1HYI A;  1KIL C;  1NOH A;  1VD4 A;  1RE3 C;  2EA6 A;  3BRT B;  1GU5 A;  3N9M A;  3RK3 D;  2YUC A;  2VRS A;  3TNU B;  3TSI A;  1WIM A;  4ZKU A;  3UIA A;  2ECI A;  5FB0 A;  1KQL A;  1RE3 A;  1GD2 E;  2YKP A;  1SVF A;  2C9L Y;  2W6A A;  2M85 A;  4NN2 A;  1WRG A;  5CHX A;  5KJ7 D;  4YBT A;  5CCH A;  1WE9 A;  2WPR A;  1GW3 A;  3LIE A;  5AW9 B;  3V4Q A;  2FUU A;  3RTR B;  1IFM A;  1WEE A;  1SQV K;  2K16 A;  3L35 A;  1HWT C;  3V2Q A;  1LTI C;  2G43 A;  3VMZ A;  2LGV A;  4PTB A;  3EQ2 A;  5AW5 B;  3V43 A;  1RE4 A;  5AW1 B;  1CI6 A;  1J1E B;  3N4X A;  1NWQ A;  1HYJ A;  4RES B;  5AW0 B;  3TK1 A;  5AVU B;  3C5K A;  3MGN A;  1K2F A;  4GIF A;  4WBA A;  5AVS B;  3NXS A;  4S3O B;  1JUN A;  1J1D C;  2K17 A;  2OAR A;  5KJ7 A;  1IJD B;  1VPC A;  1RF0 C;  1IFN A;  1LTB C;  4GB0 A;  5LKZ A;  1M7L A;  2D8S A;  2YHN A;  2KYV A;  1FZC C;  1JM7 A;  4IC2 A;  4B86 A;  4W7Y A;  2MA6 A;  3ASL A;  5FER A;  3VK6 A;  2VPE A;  4I6M C;  4CCG X;  2RSD A;  2VJF A;  4FK5 A;  5TAB A;  3M91 A;  5AVX B;  1LDJ B;  1MUU A;  2H0D A;  1L0N K;  2MT5 A;  2NAA A;  1J2J B;  1T2K D;  1LTJ B;  1L4A C;  1MZ9 A;  5CCG C;  2IX7 C;  4JYC A;  5J3X A;  1VFY A;  3V2N A;  2QM8 A;  2MNY A;  1NTM K;  3H6P A;  5FEY A;  3TNU A;  2O01 H;  2W27 A;  5CCH D;  2CKL B;  4MSX A;  4N78 E;  3O33 A;  3N9N A;  1IK9 A;  4WZ2 A;  3HD7 C;  4YBM A;  2L5G B;  4WA6 A;  4UP0 A;  1DX7 A;  2N1T D;  1LGH B;  1FAV A;  4LLB A;  3P7K A;  1LT9 C;  1H89 A;  1ZLL A;  1LTJ A;  3ZVZ B;  4CA1 A;  2WWW A;  3HUS B;  5APU A;  4WZ3 B;  2H0D B;  1N7S B;  3SOX A;  2IDA A;  3OJA B;  2FUI A;  4IFD K;  1FP0 A;  1JTH B;  1DH3 A;  2WSF H;  2E42 A;  2M3H A;  2ZET C;  3A5T A;  5H9M A;  3OA7 A;  5CJ0 A;  3NFQ A;  5AVR B;  2WT7 B;  2Q5U A;  4AYC A;  5KH3 A;  5APQ A;  1JY3 O;  2C2L A;  3BAT A;  3U5P A;  3RL0 C;  2WPS A;  4I2L C;  2BAS A;  2M1R A;  5I3L A;  2Y1M A;  1CZQ A;  1ZV8 A;  5AIU A;  2Y1N A;  1X4I A;  4YAX A;  5H1U A;  1M1J A;  2XNX A;  2I1K A;  1ZBD B;  4YAT A;  1GZL A;  3V5B A;  4B86 C;  1SFC B;  1SLQ A;  2NPS C;  2M3B A;  3GHG C;  2LXP C;  2YSJ A;  2ZFC A;  1WEO A;  5APW A;  3M0D A;  4FJC A;  4LKA A;  2Z4E A;  2YQM A;  1S9K D;  3GHG A;  2XKM A;  1MFZ A;  1AQ5 A;  3OAK A;  4AUW A;  2MD7 B;  5KH7 A;  4MVT A;  4AVX A;  4WY4 A;  2F6J A;  5G05 B;  5H1V A;  1FOS E;  4A0C D;  5B78 A;  3L36 A;  2YO2 A;  1ZR4 A;  3A3Y B;  2ECN A;  1LWU C;  2OYH A;  1LTG C;  2KWO A;  3PHD A;  2CPB A;  2JMD A;  3M9Q A;  2IFN A;  3VP8 A;  1NHL A;  4QF2 A;  1E4U A;  2C0X A;  5G0F A;  1X79 B;  4ZDT A;  3B5N C;  4O9B A;  1RF1 B;  3MHS A;  2NPS B;  3MIW A;  3GHG B;  3L11 A;  1NO4 A;  2FYZ A;  3HUS C;  2KE1 A;  2YUR A;  2LV9 A;  3ZTG A;  1SQB K;  2L0B A;  3H32 B;  2NPS D;  3IHP A;  3L37 A;  2HLO A;  1LT9 A;  1XWH A;  5KH9 A;  2PNX A;  4GND A;  3SHB A;  2O1K A;  2OXQ C;  2Q9I A;  2QM7 A;  3RK2 D;  3HCT A;  4GKG A;  5BU5 A;  3G3Z A;  1T8Z A;  3A7O A;  2WTY A;  3U1A A;  1X8Y A;  3HTK A;  4GNG A;  2JRJ A;  5EYA F;  2YYR A;  1XTG B;  5DIN A;  1LTA C;  2WT7 A;  3T97 A;  4DOJ A;  2QIC A;  2HYE D;  4TKP B;  2W6B A;  3KQI A;  3WMM 0;  1GK6 A;  4N3W A;  3ZNI A;  4XI1 A;  1SFC C;  2WSE H;  3MD0 A;  3MHH A;  1FBV A;  1JY3 N;  1Z6U A;  1SFC D;  2VP7 A;  5APT A;  4IFF A;  4EOT A;  1NAF A;  1G2C B;  2XEU A;  3QZV A;  2FFD C;  1N86 A;  4XE5 B;  4I7D A;  4IFM A;  2LQ6 A;  2HYN A;  5AW8 B;  3N9P A;  2YHO A;  2FSA A;  3C9I A;  4XA4 A;  2FFD A;  1G2C A;  3CI9 A;  2UZG A;  4L58 A;  2H8P D;  4FIP A;  2Y43 A;  1GL2 B;  2MIQ A;  2HOD A;  2VJE A;  1WT6 A;  3RK2 C;  3LQI A;  5KTB A;  1EQ7 A;  2P67 A;  1ZN5 A;  3U59 A;  4W4U A;  3M06 A;  1FOS F;  2PP6 A;  1JTH A;  5TDR A;  2XU6 A;  4HH2 A;  2OYI B;  1DVP A;  4EIJ A;  1FZC B;  1N7S A;  1WEW A;  2VNF A;  1FJK A;  1HGV A;  2WPQ A;  2YKO A;  3ZVY A;  2N1T B;  3B5N A;  1YTZ T;  2C9N Y;  2J59 M;  2C0W A;  4ZKP A;  1N7L A;  1AFO A;  4UP5 A;  2HPC A;  4C7N A;  1DEB A;  1L4A B;  2HOD B;  3HD7 D;  3PP5 A;  4C7N B;  2AN6 A;  3N9L A;  2L80 A;  2FKW B;  1X4U A;  2M8R A;  1SQP K;  2P2U A;  1LTT C;  3GV4 A;  2P1J A;  3MTU E;  1MM3 A;  3B8E B;  1NU1 K;  3KQG A;  2MA5 A;  1KIL A;  3M0D C;  5H1T A;  3ZPV E;  1FZE A;  3PUR A;  3HE4 B;  2HDP A;  3LW5 H;  5BU8 B;  4A49 A;  5AW7 B;  5AW4 B;  1JY2 O;  1W2E A;  2J58 A;  1XTC C;  2MJZ A;  5B75 A;  4N78 D;  2MUM A;  2KGG A;  4V3K C;  5B8D A;  3U5N A;  1QL1 A;  4LGD E;  2YRE A;  3HD7 A;  3N9O A;  2C2V S;  3DQV R;  1T3U A;  4W7Z A;  1YYC A;  5APS A;  2CT2 A;  2F6N A;  2G6Q A;  1GTW A;  2ZXE B;  1HBW A;  2WSC H;  4N6J A;  2KFT A;  3CL3 D;  1PFI A;  2JJL A;  4I7C A;  1VDF A;  1IFJ A;  3NTN A;  3U1C A;  3KPE A;  3VMY A;  1VYX A;  2OYI C;  3I2D A;  1X4J A;  2YKQ A;  1CW5 A;  2GUV A;  4N3Y B;  1SP4 A;  2N1T C;  1NKN A;  1RF1 A;  1OXZ A;  2KB7 P;  3HE5 B;  2ECW A;  2K1J A;  4F52 B;  2KLV A;  4S3O C;  2HG5 D;  1J1D B;  4WB4 A;  4C9Z A;  1WEV A;  5AW2 B;  2E6S A;  3O37 A;  3V4W A;  1QL2 A;  3SOW A;  1HTL C;  5KJ7 C;  2OYH B;  3VN0 A;  2VPD A;  2YQL A;  2L75 A;  4YAD A;  1RF0 A;  3U5O A;  4Y99 B;  4YBS A;  3RK3 B;  1FJP A;  3FL2 A;  4R7E A;  3BVH A;  1LTS C;  3TYY A;  3IR9 A;  1L4A D;  3CLQ A;  3VP9 A;  4R8P K;  4GT1 A;  1T1H A;  1FU1 A;  2XZR A;  1JNM A;  4LC1 A;  5JG6 A;  4ZQL A;  2K4D A;  1MV8 A;  3ZYQ A;  3RPG C;  3U5M A;  1WGM A;  3LQH A;  4IC3 A;  4FO9 A;  1T3J A;  1X9V A;  3M99 A;  4O64 A;  2RI7 A;  2FXM A;  2LXH C;  1IO4 A;  4PPE A;  3T6R A;  4DZO A;  3BAS A;  2XB1 A;  1N73 B;  4LK9 A;  2OYH C;  3HD7 B;  1RY3 A;  2WIT A;  5AVT B;  3EB6 A;  5D1K B;  2ECT A;  2GM4 A;  2R3C A;  2LGL A;  4AQR D;  2GUS A;  2P7J A;  3BRV B;  2KRE A;  3KV5 A;  1GL2 D;  2LDR A;  2WZ7 A;  4BHW A;  3VTP C;  2A45 H;  1A02 J;  5APY A;  2VJE B;  2E6R A;  3HTK B;  2LGG A;  3V2P A;  1Z60 A;  3HE4 A;  2R5D A;  5FB1 A;  1KIL B;  2XDJ A;  2KIZ A;  2N9B A;  2Q7C A;  1LT9 B;  1NTZ K;  1HJB A;  2R5B A;  2XV5 A;  4C46 A;  1U6G B;  2CPS A;  4A4C A;  3M9H A;  3P8C D;  2YMY A;  1N7S C;  1CI6 B;  5AVY B;  1JY2 N;  3RL0 B;  2VPB A;  5C13 A;  2Q3I A;  2FFD B;  1F62 A;  1OWA A;  1Z56 A;  4M3L A;  4LAD B;  1IFD A;  1WEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...