4AYCA

Rnf8 ring domain structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
136
structure length
136
Chain Sequence
LGSMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 48
structure length 136
sequence length 136
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aycA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycA02
4XE5B 1A02J 1CI6A 3P7KA 3RPGB 1K2FA 4PTBA 4I7DA 4O64A 4YBSA 2ECVA 3L11A 4CA1A 5AVXB 5LKTA 3NFQA 3U5MA 3LIDA 2Z5IA 3ZVYA 4QF3A 2Q5UA 3VMYA 4JYBA 1VFYA 4BHWA 1GK6A 2MNYA 1WENA 1SP4A 3KQIA 4MVTA 2ZXEB 2R5DA 3FL2A 1WEWA 3V5BA 1FOSE 4Q6FA 4B86A 4N4FA 5FB0A 3SHBA 2YO2A 1X4IA 5J3XA 5FERA 1FBVA 1WESA 3RPGC 1T2KD 3A7OA 2M85A 2M6MA 3N9PA 2AN6A 2KFTA 4GNGA 2CT2A 2R5BA 3I2DA 3M99A 1HYJA 2E43A 4GB0A 1XWHA 2L75A 5AW5B 2MA5A 1N87A 2WT7A 4L7XA 1KQLA 3SOXA 4F52B 5APVA 2YREA 4YADA 5DINA 4AP4A 2VPBA 4C9ZA 2ZETC 3A3YB 3U5OA 5AIUA 4NN2A 5APWA 5APQA 3PUQA 1RMDA 2L43A 2M3HA 2H0DA 2MD8C 2RI7A 5LKUA 5B78A 3KDPB 4YATA 2YYRA 3O7AA 4A4CA 1S9KE 3P32A 2KREA 2ECGA 2KIZA 3DPLR 3V43A 1CSBA 1IO4A 2PUYA 4R8PK 3LIEA 4ZUXU 1LDKC 3HTKC 4AVXA 2CSZA 4GT1A 3IHPA 5AVWB 3C5KA 4YABA 2WT7B 2K16A 2MT5A 4LADB 5FEYA 1CHCA 2XZRA 2XV5A 2YNYA 3M62A 4B86C 2WWWA 4WA6A 5LKZA 1VD4A 4LLBA 3N9NA 4V3KC 2EA6A 2YT5A 4LJNA 2KP8A 3L35A 5B77A 4I7BA 1WILA 2H0DB 2L5UA 1IYMA 3N9LA 5B76A 3KQGA 3EB6A 3C6WA 3KV5A 1GZLA 2YSMA 5AVYB 2LDRA 3T6RA 1GU4A 2I50A 5D1KB 4GNFA 4M3LA 1ZBDB 1DH3A 2HYED 2KGGA 4C7NB 1Z60A 2KU3A 4WZ3B 3PHDA 5D1MB 2CKLB 5AW4B 4W4UA 2C9NY 5AW6B 2LXPC 2QIZA 2Y1MA 4PPEA 2QM7A 4RESB 2NAAA 5AW1B 2JJLA 4GNEA 5AITA 3V4WA 3LQHA 1LDJB 2LRIC 1JNMA 1G2CB 3HTKA 1CZQA 2VPEA 1WE9A 3HE5A 2R3CA 2YO3A 1WGMA 2BASA 3O8ZA 3M0AA 2XEUA 5I3LA 3TYYA 3IR9A 3M9HA 3KNVA 2C2VS 1JUNA 2K4DA 2G43A 1WEMA 2VJEB 1WEUA 5AW3B 3L1XA 2XU6A 2YHNA 2LV9A 5APTA 1MFZA 1MUUA 2C9LY 2LGLA 3U5NA 3HCTA 1GTWA 2MUMA 4C46A 5AVRB 3M63A 3EB5A 3B8EB 1JM7B 3DQVR 1WIMA 3ZTGA 4P5OB 3L1ZB 3KV6A 5APUA 2FUIA 2LGVA 2VNFA 4A49A 5AVQB 2JMDA 2KWJA 5AW7B 3VMZA 3ZPVE 5CMZA 1X4JA 5DKAA 2IDAA 5AW9B 2EGPA 3VYIA 4FK5A 4CCGX 3HE5B 4A4BA 2YU4A 5AVUB 1E4UA 1Z6UA 5APYA 5FB1A 2VPGA 4WZ0A 4XI1A 2QJ0A 5APXA 4S3OB 3SWFA 5C13A 1HUCA 3LQJA 3V4QA 2M1RA 3MGNA 5KH3A 4YAXA 3O36A 3HE4B 5LCWB 5AW2B 3RTRB 3MHHA 4C7NA 1X4UA 1NWQA 5B79A 1H88A 1WEVA 2CKLA 2KGIA 2P2UA 3NTNA 1X8YA 5AW0B 5LKXA 4EOTA 2KWNA 2ECIA 2VPDA 5G0FA 3M06A 2H7HA 1WEPA 4N3WA 5B75A 3M0DA 3UIAA 1JOCA 3O33A 1S9KD 2E6SA 2LXHC 3ZVZB 2WPQA 1WEOA 3NMDA 2WPRA 2YSJA 3ZPV1 3ASLA 4LC1A 2N9BA 4LK9A 4YBTA 5KH9A 1FOSF 1G25A 3L36A 2D8SA 2KWOA 4I7CA 3PURA 2VJEA 3M9BA 5AVZB 4ZQLA 2MD7B 5EYAF 2KR4A 3I5CA 3TK1A 2JMJA 5JG6A 1A02F 2LGGA 2L0BA 3QZVA 5H1VA 2G6QA 5AVVB 3OAKA 5TBNA 4X3GA 2P67A 3T97A 1JM7A 3P8MC 4UI9B 1GK4A 4R2YA 1H89A 2G45A 3VTPC 3A5TA 3HCSA 3O37A 4YBMA 1F62A 2QM8A 2R32A 1HJBA 1MV8A 2QICA 4BBQA 3MD0A 2Z5HA 2DX8A 5TDRA 3T7LA 2W27A 3GV4A 4V3LC 3HCUA 2FSAA 2FUUA 5H1TA 2ZFCA 4FIPA 1GU5A 1WEEA 2VJFB 3VMXA 1SLQA 2EODA 2VP7A 1H8AA 3A2AA 3HE4A 5H1UA 2XB1A 1HWTC 2Q7CA 3GL6A 5AVTB 1Z2QA 5AW8B 4AYCB 2ECJA 3O35A 3MHSA 5H9MA 4GNDA 3VN0A 2YUCA 1MM2A 2WTYA 3SOUA 4R7EA 4AUQB 4QF2A 1FP0A 2VRSA 2KE1A 4UP0A 2Y43A 4YC9A 1HYIA 5G05B 3O70A 3VK6A 4MSXA 3N9QA 2KYUA 4HYTB 2K1JA 4IC2A 2Y1NA 4I2LC 2UZGA 4GKGA 2Q3IA 4LKAA 2HDPA 2YURA 2JRJA 2L80A 4FJCA 1T1HA 2ECTA 1CI6B 2E6RA 4B7YC 2F6JA 2K17A 2MIQA 4A0CD 3TNUA 1OXZA 2IPPA 2BAYA 2F42A 2WPSA 2PNXA 3NXSA 1DVPA 4AQRD 2CSYA 2F6NA 1U6GB 1V87A 1FAVA 2YQMA 1GD2E 1VYXA 4S3OC 5TABA 3U5PA 4KHXA 2LQ6A 3N9MA 2KWKA 5TRBA 3ZNIA 2C2LA 5TDWA 4WZ2A 2ECNA 4ZDTA 2VJFA 2P7JA 1HBWA 2W6AA 4DZOA 1WFKA 2MNZA 3NG2A 5APSA 5KH7A 1J2JB 2YHOA 1YYCA 2JMIA 2LN0A 3LQIA 4AYCA 1MM3A 5C11A 1NAFA 3TNUB 1BORA 3M91A 3ZYQA 3N9OA 3L37A 3SOWA 4TKPB 2MA6A 2RSDA 3LRQA 1T2KC 4UP5A 5D1LB 2OXQC 4I6MC 4IC3A 1OWAA 2LGKA 5G04B 2ECWA 4L58A 4AUWA 3O34A 5AVSB 2E42A 2YW8A 1WEQA 4JYCA 2YQLA 4FO9A 5B8DA
chains in the Genus database with same CATH superfamily
4U3FD 1DX7A 1SQBD 3DDTA 1RQVA 2BCCE 3L11A 1VPCA 5AVXB 3EQ2A 3N4XA 3CCUP 3CC4P 1YJ9P 4UB6E 2AXTE 3ZVYA 1SFCB 2Q5UA 1VFYA 2KOGA 4BHWA 1GK6A 1SP4A 2WSFH 2ZXEB 1WEWA 3V5BA 4Q6FA 3Q2YA 3BRTB 1Q7YQ 1RE3C 5FERA 1NO4A 1WRGA 1T2KD 2AN6A 3I56P 1JTHA 4GIFA 4YPCA 1LTBC 4KT0J 1JEKA 4HJGH 1SFCC 1KILB 2B87A 1MKMA 5B66E 3SOXA 5APVA 4YADA 5DINA 1QLED 2ZETC 1ZLLA 1W5CE 1NHLA 1FZCC 3VP8A 1R5LA 1OVVA 1BSHA 3HD7B 2FXMA 2CPBA 2XNXA 5B78A 3KDPB 1FZGA 3CXHI 2KREA 3DPLR 3M7KA 3V43A 2PUYA 4R8PK 3H1KJ 1ZRTD 4D6TG 1JMBA 1LDKC 4N6JA 2QIWA 4XFJA 2CSZA 1SQVJ 2RN0A 5AVWB 2NZ2A 3PLNA 2MJZA 4YABA 3A0HH 2W90A 4L75A 3H7HA 3S9OA 1SQQD 2Y0DA 1DIPA 2XZRA 1E5WA 4WA6A 1YJWP 2O3JA 4V3KC 2YT5A 3L70D 3L35A 4NPEA 1BSNA 3II6A 2WSSH 3EB6A 1VQMP 3AEDC 1N7SA 1NKNA 2HODA 2ITAA 3H1KE 5D1KB 3KPEA 4O62A 1GW3A 2W6JH 3CXHD 1SQVE 4C7NB 4WZ3B 3L72G 1VL2A 2HPCB 2CKLB 3CCMP 3QH9A 2L5GB 1GW4A 5AW6B 2Y1MA 4PPEA 2D2CB 3V4WA 1LDJB 1JNMA 2E74D 4ZMDA 2K88A 2KLUA 3JUEA 2BASA 3M0AA 3CCSP 3IR9A 1VQKP 3Q5PA 1Q86Q 3OJAB 3M9HA 1T8ZA 5GTIH 1PPJD 2G43A 4GDOA 2R44A 5DJTB 3WMM0 1L0ND 1YHQP 2HODB 2C9LY 2PRRA 1NKZB 4XA4A 1GTWA 2MUMA 4OGQB 2CRRA 3RBZA 1IFMA 2QJYB 2IYOA 5APUA 2LGVA 3W67A 5AVQB 1FC2C 2CSVA 5CMZA 1X4JA 4PD4D 2FFDB 2I1KA 2EGPA 1N7SC 4A4BA 2B89A 5AVUB 1E4UA 3Q1MA 3CX5H 1WT6A 4XI1A 3Q5RA 4S3OB 3SWFA 5C13A 1HUCA 2E5YA 3V4QA 2M1RA 3MGNA 4YAXA 3Q1DA 3O36A 5M1BA 1BE3D 2OYHB 1KB9I 1IZNB 1NTMD 3TGUD 3GF7A 1DD3A 1EZVD 3CCJP 1Z56A 1X8YA 1RHZB 1ZW0A 5G0FA 1LT1A 5GTHH 3RK3E 1YIJP 1WEPA 5KAFH 4N3WA 1QEXA 1WEOA 3NMDA 1OZHA 3FGAD 2A06G 3FEHA 1FOSF 1G25A 3L36A 3MUDA 1SQXD 3BCCD 2VJEA 3U1CA 2ZAEB 3M9BA 5AVZB 2MD7B 5EYAF 2QRXA 2KR4A 3B4SA 2KNCB 2BEZF 2KKXA 3QWOC 4X3GA 1LTTC 1VQ9P 1X79B 4R2YA 2P57A 1OX3A 4YXDC 4OGCA 3HCSA 3IAOA 1HJBA 1PP9E 2DX8A 5TDRA 3AE9C 2KK7A 3AE8C 5K3QA 3TSIA 4PV1B 3C8VA 2EODA 3A2AA 3HE4A 2XB1A 1JM0A 1HWTC 1L4AD 3GL6A 1OVRA 3P8CE 3RBXA 2OQQA 2ECJA 5H9MA 4GNDA 2WSFJ 1MM2A 4JQ0D 2WTYA 2KS1A 1R8EA 5CCHA 1NU1E 1KN7A 1RQUA 3MUDC 3FAOA 2OARA 3O70A 2E76B 2H8PD 1VQ6P 3AEFC 1LT9B 4UB8E 1JY2P 4GKGA 1HGZA 1YBKA 4LKAA 3L74D 4NPFX 3G71P 2Y9ZA 2KSEA 2ZYGA 1SQVK 4WY4A 2E6RA 2F6JA 3SFDC 2K17A 3FJUB 3TNUA 4H13B 2E76C 1BCCG 4DJGA 1HF9A 1DVPA 2JWDA 4AQRD 2F6NA 3CXHH 2OTKE 1EDKA 1FAVA 1RF1A 2J59M 2YMYA 3MDBC 4R4LA 5TRBA 4TLFA 1KTMA 4H13C 4WZ2A 4ZDTA 1SQPD 2P7JA 1OMIA 5KH7A 1VQOP 1S5LX 2LN0A 4WY4B 5DJUB 1YTZT 3IF4A 3TNUB 1AQTA 1KILE 2FFWA 3D70A 2WZ7A 1FJKA 4UP5A 3IFMA 2K3RA 2OXQC 2RR4A 1N73A 1OWAA 1S2EA 1GL2A 2LGKA 3Q5SA 4GOFA 2HLOA 3O34A 2O01J 3PH0A 5AVSB 4RKUJ 4WY4C 1PP9G 1L0LJ 4H44B 2YW8A 1BGYJ 4PD4H 4OH8B 4XE5B 1NTKE 1A02J 1CI6A 2P58A 3P7KA 1FDMA 3AE2C 1W2BO 2IDBA 1K2FA 1U57A 4YBSA 4CA1A 4ZKUA 1NTZG 4WWIA 5LKTA 3NFQA 1JCCA 1RF1C 2Z5IA 4QF3A 5KLVG 1U7MA 5KAIH 3D71A 2MNYA 4Z0RA 1WENA 4MVTA 1LGHB 3CCRP 4I7ZC 1GDTA 5KJ7A 1JMMA 1NU1G 4N4FA 1P84E 2YO2A 1WESA 3L71E 1K04A 1BGYE 2K9JA 3A7OA 2M85A 3RK3C 4N78D 2YKPA 2M8RA 1E79H 2KFTA 4GNGA 2CT2A 2R5BA 3I2DA 1HYJA 1GMJA 4ASWA 3FXEA 4GB0A 2N1TB 4IL6H 2WT7A 4L7XA 1KQLA 4BRYB 2YREA 1PV3A 1MZ9A 2FYUJ 2Q6QA 3U5OA 3HTKB 1N73C 5APWA 1LTIC 3H1JE 2O1KA 1EDLA 1DD4A 2Y0EA 1M1JB 1KYOD 5LKUA 2YKQA 3CMEP 1VF5C 2N1TC 4H0LD 2ECGA 2FXOA 3V2RA 3FWNA 1JB0J 3LIEA 3VOPA 5TISH 1QVGO 1M7LA 3HTKC 2POHA 3WU2E 2NPSD 3SUBA 3W68A 2FYUE 3CI9A 3L73E 3C5KA 2E75B 3H1HG 2WT7B 5KLVK 2MT5A 1MBMA 4LADB 1SQBJ 3SWYA 5KJ7C 1OFCX 3G6EP 1NOHA 4D6TD 5LKZA 2SPZA 3H1ID 1NU1K 1VQNP 2KP8A 1WILA 2L5UA 1HTLC 5B76A 3KQGA 3C6WA 1GZLA 5AVYB 1AJYA 1YJNP 4M3LA 1PGOA 2E75C 1FZAA 4PJ0H 1D7MA 1N86A 5GTHE 1URQB 3IN6A 1J1EB 1KILA 2C9NY 2QIZA 1AQ5A 1G1JA 2NRGA 2QM7A 3BVHA 2OYIB 2NAAA 1SQBE 1NTKG 1IC2A 1Y9BA 1G2CB 1CZQA 1S1CX 2VPEA 1WE9A 2MKVA 2YO3A 3L72D 5BU8B 2G3AA 3HD7A 3G3ZA 2ZJSE 1JUNA 1FZEA 2W6BA 1J1EC 3AEGC 2C0XA 2LV9A 2OYIC 3L71G 1MUUA 3TF5A 2LGLA 3HCTA 4C46A 5AVRB 1YQ3C 3T97B 3M63A 1JM7B 3B8EB 3DQVR 3ZTGA 3B5NB 2WPVB 2XDJA 2KWJA 2YIUB 4FK5A 2WSCJ 2DJAA 1RF0A 3LW5H 1SQQJ 3A0BH 1Z6UA 3H1JG 3O47A 2FKWB 5FB1A 4W80A 4WZ0A 2GM4A 3H6PA 3L70J 2HR3A 1JO5A 1KV4A 3LQJA 4HKZH 1KILC 2QE7H 1IK9A 3D6ZA 2K1AA 1VQPP 3AEBC 4C7NA 5B79A 2HPCA 2CKLA 1NTKK 2YIUC 2P2UA 4HB1A 3NTNA 4LGDE 5LKXA 2KWNA 2VPDA 3M06A 2H7HA 2O01N 3CWBJ 3L73G 1LTJB 3HD7C 1ZP0C 4LC1A 2N9BA 3RK2B 3MIWA 2IBZE 5KH9A 1ZR4A 3L70E 1PGPA 3BASA 2YXQB 1NVOA 3PURA 2V7QH 5KKZB 3H1LG 5JG6A 1L0NJ 2G6QA 2QA4P 1G1IA 5AVVB 1IFNA 2A06D 3CWBE 3RK2C 3P8MC 3CMAP 1RF0C 1FS0E 1H89A 2OTJP 4KJMA 2PGDA 2BCCG 4YBMA 1F62A 2FFDA 3CCLP 2R32A 2QICA 4BBQA 3L4FA 2Z5HA 3GV4A 4V3LC 3HCUA 1DEBA 2CPSA 1AFOA 1M8OB 2VJFB 2NPSB 1SLQA 2KLVA 2VP7A 2OYHA 2Q7CA 5SVXA 2D2CC 1KYOH 1Z2QA 4JPZB 1J1DB 1EC5A 3O35A 1JY2N 1BE3J 4F1PA 3VN0A 3L75D 1NTMJ 3KHUA 3TGUJ 3SOUA 5CCHD 1OW7A 2E61A 1FP0A 4UP0A 2Y43A 1LWUB 4OVNF 3LVQE 1KZUB 1DEEG 4MSXA 4PD4E 2WMMA 1EDJA 3GMAA 3O6QB 4ZKPA 1N2DC 2QG4A 4OGEA 4OGQC 3R4YA 1SQXJ 2JRJA 4FJCA 3CPWO 2QJYC 3BCCJ 2KNCA 5SVIB 1BE3E 4A0CD 2M0BA 1NTME 1OXZA 2IPPA 3TGUE 2BAYA 3AEEC 4IOIH 1EZVE 2WPSA 2FFDC 1SQBK 2KB7P 1KORA 2OYOA 1FJPA 3AE5C 3V2QA 4S3OC 1Q90D 3U5PA 2LQ6A 3N9MA 2XP0A 4WBAA 1CW5A 4R4MA 1BCCD 2OYHC 1PGJA 2IBZG 2ECNA 1SQXE 3BCCE 1XTGB 4K3AA 1HBWA 2W6AA 4DZOA 1WFKA 3NG2A 3RK3D 1HH0A 3H1KG 2YHOA 1YYCA 2JMIA 5H2FE 2XOZA 1MM3A 3RL0D 3M91A 1KMIZ 1SQVG 1NH4A 3L37A 4EYYQ 3CWBG 3V2NA 1KB9D 1T2KC 1KQFB 2K37A 4UB6H 4I6MC 1GL2D 5TISE 4BWNA 3FX0A 3C1LA 3GLMA 5G04B 2ECWA 2IYPA 1LT9A 3I55P 2LXCB 2ZT9D 2YQLA 2K9YA 1QX8A 4HH2A 4YXWH 1HJ0A 3L74J 1YTZI 3U5MA 3F89A 5B66H 1PP9D 3VMYA 1S5LE 4PJ0E 3S1KA 4IL6X 4L76A 3SFEC 5FB0A 1KQGB 4Y28J 1X4IA 4PV1C 1NTZD 1S4XA 3N9PA 1Q2NA 3CD6P 5KLVD 1LJ2A 3FWLA 5CJ4A 2V4HA 3EFFK 1EDIA 2HYNA 1XWHA 2L75A 1X9VA 5AW5B 2MA5A 1EXJA 3AE4C 1SQPJ 1NU1D 4I1LA 4W7ZA 1JY3N 3LW5J 3ZDMA 1VQ5P 2XOCA 1QL1A 4NN2A 3WUTA 5APQA 2E74B 4MN4C 1ZMEC 3PUQA 2M3HA 2H0DA 3PP5A 1LT9C 5B5EH 3GF3A 2MD8C 2RI7A 1IFPA 3KXDA 2YYRA 4CPGA 1K05A 1S9KE 5L8RJ 3P32A 3RGUA 2I8DA 3FM8C 5E79H 2L7PA 3N7NA 1SQPE 2E74C 2WSEH 3IHPA 2XNDH 4WVZA 3ITKA 4W7YA 3A0BE 2OWAA 1CHCA 1ZV8A 3V2PA 1SFCD 2DSMA 2D8UA 2YNYA 2WWWA 1USEA 4LLBA 1JY2O 3N9NA 2EA6A 2V7QJ 2H0DB 3E1RA 1UIXA 3N9LA 1SVFA 2KZJA 2FYNB 1IFIA 3H1HD 2LDRA 1GU4A 2QJKB 3PTZA 1DCQA 3CCEP 2Y0CA 1DH3A 2KU3A 3PHDA 2B9BA 3A0HE 1K73Q 1KILD 4RJTA 5AW4B 1P84I 4W4UA 2N1TA 3LJUX 2QJPB 1VQ7P 4IFFA 4RESB 4BRYA 5AW1B 3LQHA 1JCDA 2FD4A 2LRIC 3HTKA 3PRJA 2FYNC 3HE5A 4Z1MH 1WGMA 3O8ZA 2DW3A 3HD7D 2CRWA 2C2VS 4U7JA 2G8YA 1M1JA 2IZ0A 4H44C 1FU1A 1WEMA 1WEUA 1NTKD 4EI2A 5AW3B 3L1XA 2A45I 1AV1A 2FBWC 3MP7B 1L0LE 1SQXK 1MFZA 4N78E 1T3UA 2GA1A 2JWAA 3OA7A 1W2EA 2CK3H 1QVFO 3EB5A 1FE6A 2VNFA 3M9QA 4A49A 1P84D 2JMDA 5GTIE 3VMZA 3ZPVE 2Z4EA 5DKAA 3L71D 5AW9B 2J58A 2MKEA 3HE5B 2YU4A 5APYA 1ZR2A 4ZNCA 4D6TJ 2VPGA 3H1IJ 1KYOE 2ZT9B 5APXA 2YXRB 5K5GB 1KB9H 5LCWB 2KI7B 5AW2B 5CBOA 1VQ4P 2M3BA 3MHHA 1URQA 1X4UA 1LTAC 1L4AB 2N9YB 2AXCA 1H88A 1WEVA 2KGIA 3H1JD 3LVRE 1N8RQ 2BEQD 4EOTA 4Z0OA 1H0TB 2OYIA 2D2CD 2JUNA 1K8AQ 5B75A 3M0DA 3JC22 1G2CA 3SSUA 1M1JC 1JOCA 3CX5E 1Y47A 4U3FJ 2E6SA 2LXHC 3ZVZB 2WPQA 2WPRA 1KQSO 4D6TE 1XTCC 3ASLA 3H1IE 2B88A 4YBTA 4GODA 1L4AC 3KZIH 3L72J 2AEMA 3EFGA 2EXUA 3R2PA 1N7SD 1LP1B 3L73D 4ZQLA 3I5CA 2UWJE 3TK1A 3HUSB 1A02F 1ZXGA 2L0BA 5H1VA 2KSJA 4OGQD 1UIIA 1LNQA 3OAKA 5KAFE 1FBMA 2M3EA 2P67A 3T97A 1JM7A 1IJDB 1GK4A 4U3FE 3B5NA 3MTUE 3OW2O 3VTPC 3A5TA 3HRNA 3O37A 3H1LD 3C9IA 2M5AB 2QM8A 1JY3O 1BDCA 3L72E 3T7LA 2LAUA 2W27A 4JBZA 4A7PA 2FSAA 2ZYDA 1URQC 5H1TA 4FIPA 1WMKA 4UB8H 1H8AA 5H1UA 2BCCD 2P10A 1SQPK 1L0LG 5AVTB 3M0DC 4AYCB 1BGYG 4TT3H 3MHSA 3H25A 2Q1KA 4R7EA 4AUQB 4DOJA 3SWKA 4QF2A 1LTJA 2VRSA 1VQLP 3JSVC 1RY3A 5G05B 2W83C 1FZCB 1VQ8P 2M13A 2A45G 4HYTB 2K1JA 1M57D 2Y1NA 3B71A 3F5HA 4ASVA 1ZN5A 3JCUH 2HDPA 1IFDA 1S72P 5KTBA 4B7YC 2IBZI 3B5NC 2QEXP 2MIQA 1ZRTE 2F42A 1NAYA 1RE4A 1OW8A 2FYUG 4O9BA 1U6GB 1GD2E 1VYXA 1SQQE 3FXDA 3GHGA 2GUSA 2KWKA 2KIKA 1QGKB 3ZNIA 3H1IG 2WSEJ 2ZVNB 5TDWA 2FYZA 2H43A 1JTHB 4PV1D 2VJFA 2NPSA 5CJ0A 1EXIA 1L0LK 2B87B 1X0TA 3U1AA 3CCVP 3GW6A 1LTJC 5B5EE 1PZQA 3CXHE 2A06E 1YQ4C 1M1KQ 4C7RA 5SVYA 3ZYQA 3N9OA 2HFED 2IBZD 2MA6A 3KYQA 1LTSC 2JKVA 3L75J 1LWUA 4U3FG 5D1LB 2E76D 1SQBG 4YTPC 3H1KD 5E79E 5KKZC 1OW6A 4GOEA 5CCGA 4L58A 3GHGB 4H0LB 3O6QA 3Q3DA 1OIPA 1P84H 1SQVD 2O01H 3CWBD 1WEQA 2GUVA 1PGQA 1PPJE 5EFWB 5B8DA 5BU5A 4PD4I 1RE4C 1L0NE 3RPGB 5SVIA 4PTBA 4I7DA 4O64A 2ECVA 4H13D 1FZBA 3LIDA 2FYUK 3PHLA 1SS1A 3L75E 1YI2P 3GHGC 4JYBA 4H0LC 3KQIA 2A45H 2QVAA 2R5DA 3FL2A 1S3JA 2Q9IA 2H89C 1FOSE 2OTLP 4B86A 2HG5D 3SHBA 2JDIH 2XOYA 1N7SB 2NPSC 1EZVI 5J3XA 3G9RA 1FBVA 3RPGC 2YMKA 1BDDA 1PL5A 2M6MA 1AA0A 2Q3EA 1J1DC 1BCCJ 3M99A 2E43A 1RH5B 1N87A 4LLHA 4WY4D 4F52B 3WU2H 4AP4A 2VPBA 5KAIE 4C9ZA 1LWUC 3A3YB 5AIUA 1K9MQ 3MHVA 1RMDA 2L43A 5CCGC 4WB4A 4NPDA 2IX7C 1PFIA 3VP9A 2JR8A 4YATA 3O7AA 4A4CA 2KIZA 1SQQG 1CSBA 1IO4A 4H44D 1BCCE 4ZUXU 4IL6E 1MFTA 2L91A 1QL2A 3L70G 1AVOA 4AVXA 4GT1A 3AE3C 1X22A 1IK7A 1T6AA 2K16A 3U59A 2AEFA 5FEYA 2EGMA 2XV5A 4B86C 3M62A 5CHXA 1VD4A 2YKOA 3AEAC 4RO0A 1KB9E 4LJNA 2WQYC 5B77A 3K5BA 4I7BA 1PP9J 1IYMA 3AE6C 2LXBA 3KV5A 2AXTH 2YSMA 3PLWA 3T6RA 1FDIA 2I50A 4GNFA 3V6IA 2FXPA 1ZOYC 1ZBDB 3TDKA 1NTZJ 2HYED 2KGGA 3MZWB 5C39A 1Z60A 4DT0A 5D1MB 1HGVA 1VF5D 2N1TD 3E1IA 1YITP 5KLVJ 2C0WA 1PPJG 1KFNA 3CC2P 2LXPC 2CONA 2YVRA 1L0NG 2JJLA 4GNEA 5AITA 1VDFA 2KUBA 3KZIE 1NU1J 2R3CA 2XKMA 2XEUA 5I3LA 3TYYA 1PIXA 1R5SA 3L75G 2KXPB 3KNVA 1HVVA 1TU3F 2K4DA 1SQQK 5KJ7D 1FDOA 2VJEB 2FY8A 1FZFA 2XU6A 2YHNA 1LTGC 1NTZE 2KYVA 5APTA 3D6YA 3P8CD 3U5NA 5KLVE 2OGUA 2P1JA 3DWDA 5KLIB 3L74E 2E75D 1WIMA 4P5OB 3L1ZB 3KV6A 2FUIA 3KDEC 2IZ1A 5AW7B 3T9KA 1OVUA 1BE3G 2PFXA 2QSIA 2IDAA 3VYIA 4CCGX 1NTMG 1M90Q 3TGUG 3AE1C 1KD1Q 3PJSK 1EZVG 2WSCH 3CLQA 4BXLA 4QQ4A 2WVRA 2QJ0A 3RL0g 1NGMB 2IFNA 2I1JA 5KLIC 3USSA 2WITA 3S4RA 5KH3A 3HE4B 1T3JA 2R3SA 1URQD 3RTRB 3H1HJ 1IFJA 1NWQA 2JP3A 3AE7C 1L0NK 4L73A 5AW0B 1SQXG 3BCCG 2ECIA 2KS1B 2JO1A 4IFDK 3GG2A 2E5TA 3UIAA 3O33A 1S9KD 2YSJA 2W8ZA 3ZPV1 1Q81Q 3JCUE 4LK9A 1Y8AA 1EQ7A 2D8SA 2Y9YA 2KWOA 4I7CA 1U7JA 2O1JA 4N3YB 3H1HE 4EDFA 2JMJA 1NTKJ 2LGGA 3E2DA 5CCHC 3QZVA 5TBNA 1AVYA 4UI9B 3B5ND 3H32A 1NTMK 4IFMA 2G45A 3CL3D 1USDA 1RF1B 1MV8A 2QJKC 3MD0A 3L71J 2PP6A 4I7ZB 1M56D 2H88C 2LKMA 2FUUA 2ZFCA 1GU5A 1WEEA 2IFMA 3VMXA 4Y99B 3WUUA 2QJPC 2JEEA 1KFMA 3LDYA 3RK3B 5BVZA 2B0OE 1L4AA 3G4SP 5AW8B 1KYOI 3RL0B 2YUCA 1H0TA 3WUVA 3BRVB 3H1JJ 3L74G 3H32B 2KE1A 2AEJA 4YC9A 1HYIA 1N73B 1NYHA 4Y99C 3RK2D 3VK6A 1GL2B 1L0LD 3BATA 3N9QA 2KYUA 1BGYD 4IC2A 4OWFA 4I2LC 4EIJA 2UZGA 2Q3IA 3CX5I 3RL0C 1LP1A 1VF5B 2YURA 2L80A 1T1HA 2ECTA 3HUSA 1CI6B 3L73J 1KC8Q 2ZXXA 3CC7P 1GL2C 2PNXA 2IQJA 2LR2A 4JF7A 3NXSA 4DCKA 5H2FH 1SQPG 2CSYA 4L74A 4K35A 1V87A 2YQMA 2ZT9C 3VMAA 2M5AA 5TJHA 3EWKA 5TABA 2RKLA 4KHXA 1JY3P 3H1LJ 2K9JB 2C2LA 4QMAA 2JM3A 1NTZK 3AECC 1RE3A 2KZIA 2FYUD 2MNZA 2RMZA 5APSA 1J2JB 2ZVOB 3CX5D 2KKYA 3LQIA 4AYCA 2BCCJ 1SFCA 5C11A 1NAFA 1BORA 3CCQP 2RH0A 3SOWA 3ABVC 5CBNA 1N7LA 4TKPB 2RSDA 4H9DA 2J5UA 3LRQA 4IC3A 1Q82Q 3H1LE 1FZCA 2ZYAA 5CCGD 3E7KA 1S5LH 4AUWA 1L2PA 3HUSC 3FANA 2E42A 2PAJA 4JYCA 4FO9A 1NJIQ
chains in the Genus database with same CATH topology
4XE5B 5BU5A 1A02J 4HH2A 1CI6A 1RE4C 3P7KA 1FDMA 1DX7A 3RPGB 1K2FA 4PTBA 4I7DA 4O64A 4YBSA 2ECVA 3L11A 1VPCA 4CA1A 5AVXB 3EQ2A 4ZKUA 1YTZI 3N4XA 5LKTA 3NFQA 3U5MA 1JCCA 1FZBA 3LIDA 2FYUK 1RF1C 2Z5IA 3ZVYA 4QF3A 1SFCB 2Q5UA 3GHGC 4JYBA 3VMYA 2KOGA 1VFYA 4BHWA 1GK6A 2MNYA 1WENA 1SP4A 2WSFH 1LGHB 3KQIA 4MVTA 2ZXEB 2A45H 1GDTA 5KJ7A 2R5DA 3FL2A 1WEWA 2Q9IA 3V5BA 1FOSE 4Q6FA 1JMMA 2HG5D 3BRTB 4B86A 4N4FA 5FB0A 2YO2A 3SHBA 1N7SB 2NPSC 1X4IA 1RE3C 5J3XA 5FERA 1FBVA 1WESA 3RPGC 1NO4A 1WRGA 1T2KD 3A7OA 2M85A 2M6MA 3RK3C 3N9PA 4N78D 2YKPA 2M8RA 2AN6A 2KFTA 4GNGA 1JTHA 2CT2A 2R5BA 1J1DC 4GIFA 3I2DA 3M99A 1LTBC 5CJ4A 1HYJA 1SFCC 2E43A 1KILB 4GB0A 2HYNA 1XWHA 2N1TB 2L75A 1X9VA 5AW5B 1N87A 2MA5A 2WT7A 4LLHA 4L7XA 1KQLA 4WY4D 3SOXA 4F52B 5APVA 2YREA 1MZ9A 4I1LA 4YADA 5DINA 4AP4A 2VPBA 4C9ZA 1LWUC 1JY3N 4W7ZA 2ZETC 3A3YB 3U5OA 3HTKB 1ZLLA 1N73C 1QL1A 5AIUA 4NN2A 5APWA 5APQA 1NHLA 1FZCC 3PUQA 1LTIC 1RMDA 3VP8A 2O1KA 2L43A 5CCGC 2M3HA 2H0DA 3PP5A 4WB4A 1LT9C 3HD7B 2MD8C 2IX7C 2FXMA 1M1JB 2CPBA 2RI7A 1PFIA 2XNXA 3VP9A 5LKUA 5B78A 3KDPB 4YATA 2YYRA 2YKQA 1FZGA 3O7AA 4A4CA 1S9KE 2N1TC 3P32A 2KREA 2ECGA 2KIZA 3DPLR 3V43A 1CSBA 3V2RA 1IO4A 2PUYA 4R8PK 3LIEA 3VOPA 4ZUXU 1M7LA 1LDKC 3HTKC 4N6JA 1QL2A 2POHA 3N7NA 2NPSD 4AVXA 2WSEH 2CSZA 4GT1A 3IHPA 3CI9A 5AVWB 3C5KA 2Y1MA 2MJZA 4YABA 4W7YA 2WT7B 5KLVK 3U59A 2K16A 2MT5A 4LADB 5FEYA 1CHCA 3SWYA 5KJ7C 1ZV8A 3V2PA 2XZRA 1SFCD 1E5WA 2XV5A 2YNYA 3M62A 5CHXA 1NOHA 2WWWA 4B86C 4WA6A 5LKZA 1VD4A 2YKOA 4LLBA 1JY2O 3N9NA 1NU1K 4V3KC 2EA6A 2YT5A 4LJNA 2KP8A 3L35A 5B77A 4I7BA 1WILA 2H0DB 2L5UA 3II6A 1IYMA 1HTLC 3N9LA 5B76A 1SVFA 3KQGA 3EB6A 3C6WA 3KV5A 1GZLA 2YSMA 1N7SA 1NKNA 1IFIA 5AVYB 2HODA 2LDRA 3T6RA 1GU4A 2I50A 5D1KB 4GNFA 4M3LA 1FZAA 3KPEA 1ZBDB 1DH3A 1GW3A 1N86A 2HYED 2KGGA 1URQB 4C7NB 1Z60A 2KU3A 4WZ3B 3PHDA 1KILD 2HPCB 2CKLB 5D1MB 1HGVA 2N1TD 5AW4B 1J1EB 1KILA 3E1IA 2L5GB 2N1TA 4W4UA 2C0WA 2C9NY 1KFNA 1GW4A 4IFFA 5AW6B 2LXPC 2QIZA 1AQ5A 1G1JA 2QM7A 4RESB 3BVHA 2OYIB 2NAAA 5AW1B 2JJLA 4GNEA 5AITA 1IC2A 3V4WA 1VDFA 3LQHA 1JCDA 1LDJB 2LRIC 1JNMA 1G2CB 3HTKA 1CZQA 2VPEA 1WE9A 3HE5A 2R3CA 2YO3A 1WGMA 2BASA 2XKMA 3M0AA 3O8ZA 2XEUA 5I3LA 3TYYA 3IR9A 3HD7D 3OJAB 3M9HA 1T8ZA 5BU8B 3KNVA 2C2VS 3HD7A 1HVVA 3G3ZA 1JUNA 1M1JA 2K4DA 1FZEA 1SQQK 5KJ7D 2G43A 2W6BA 1FU1A 1WEMA 2VJEB 1J1EC 1WEUA 1FZFA 5AW3B 3WMM0 3L1XA 2A45I 2XU6A 2YHNA 2C0XA 1LTGC 2OYIC 2LV9A 2HODB 2KYVA 5APTA 1SQXK 1MFZA 1MUUA 2C9LY 4N78E 1NKZB 4XA4A 2LGLA 3P8CD 3U5NA 1T3UA 2P1JA 3HCTA 1GTWA 2MUMA 4C46A 5AVRB 3OA7A 3M63A 1IFMA 1W2EA 3EB5A 3B8EB 1JM7B 3DQVR 1WIMA 3ZTGA 4P5OB 3L1ZB 3KV6A 5APUA 2FUIA 2LGVA 3B5NB 2VNFA 3M9QA 4A49A 2XDJA 5AVQB 2JMDA 2KWJA 5AW7B 3VMZA 3ZPVE 2Z4EA 5CMZA 1X4JA 5DKAA 2FFDB 2IDAA 2I1KA 5AW9B 1N7SC 2J58A 3VYIA 2EGPA 4FK5A 3HE5B 1RF0A 4CCGX 3LW5H 4A4BA 2YU4A 5AVUB 1E4UA 2WSCH 3CLQA 1Z6UA 5APYA 1ZR2A 2FKWB 1WT6A 2VPGA 4W80A 5FB1A 4WZ0A 4XI1A 2GM4A 2QJ0A 3H6PA 5APXA 2IFNA 2I1JA 4S3OB 3SWFA 1JO5A 1HUCA 3LQJA 3V4QA 5C13A 2M1RA 1KILC 2WITA 3MGNA 5KH3A 4YAXA 3O36A 3HE4B 5LCWB 1T3JA 5AW2B 1IK9A 2OYHB 1URQD 3RTRB 2M3BA 1IFJA 3MHHA 1URQA 4C7NA 1LTAC 1X4UA 1NWQA 5B79A 1L4AB 1H88A 2HPCA 1WEVA 2CKLA 1NTKK 2KGIA 2P2UA 1L0NK 1Z56A 3NTNA 4LGDE 1X8YA 5AW0B 5LKXA 4EOTA 2KWNA 2OYIA 2ECIA 2VPDA 3M06A 2H7HA 5G0FA 1WEPA 4IFDK 4N3WA 5B75A 1LTJB 3HD7C 1G2CA 3M0DA 3UIAA 1M1JC 1JOCA 3O33A 1S9KD 2E6SA 2LXHC 3ZVZB 2WPQA 1WEOA 3NMDA 2WPRA 2YSJA 3ZPV1 3ASLA 1XTCC 2N9BA 4LC1A 3RK2B 3MIWA 4LK9A 4YBTA 5KH9A 1ZR4A 1FOSF 1G25A 1EQ7A 3L36A 1L4AC 2D8SA 3BASA 2KWOA 3MUDA 4I7CA 3PURA 2VJEA 3U1CA 3EFGA 3M9BA 5AVZB 2O1JA 3R2PA 1N7SD 4N3YB 2MD7B 4ZQLA 5EYAF 2KR4A 3I5CA 3TK1A 3HUSB 2JMJA 5JG6A 1A02F 2LGGA 5CCHC 2L0BA 3QZVA 5H1VA 2KSJA 2G6QA 1G1IA 5AVVB 1IFNA 3OAKA 5TBNA 1FBMA 4X3GA 2P67A 1LTTC 3T97A 1X79B 3RK2C 1JM7A 3P8MC 1IJDB 4UI9B 1GK4A 1RF0C 3B5ND 3H32A 4R2YA 1H89A 3B5NA 1NTMK 3MTUE 4IFMA 2G45A 3VTPC 3A5TA 3CL3D 3HRNA 3HCSA 3O37A 4YBMA 3C9IA 1F62A 2FFDA 2QM8A 2R32A 1RF1B 1HJBA 1MV8A 2QICA 4BBQA 1JY3O 3L4FA 3MD0A 2Z5HA 2DX8A 5TDRA 3T7LA 2W27A 2PP6A 3GV4A 4V3LC 3HCUA 2FSAA 2LKMA 2FUUA 1DEBA 1URQC 2CPSA 5H1TA 2ZFCA 1AFOA 4FIPA 1GU5A 1WEEA 2IFMA 2VJFB 3VMXA 2NPSB 3TSIA 4Y99B 1SLQA 2KLVA 2EODA 2VP7A 1H8AA 3A2AA 3HE4A 5H1UA 2JEEA 1KFMA 2OYHA 2XB1A 1HWTC 3RK3B 2Q7CA 5BVZA 1L4AD 3GL6A 1SQPK 5AVTB 1Z2QA 1L4AA 3M0DC 3P8CE 4PPEA 1J1DB 5AW8B 4AYCB 2ECJA 1JY2N 3O35A 3MHSA 5H9MA 3RL0B 3VN0A 2YUCA 4GNDA 1MM2A 2WTYA 3SOUA 4R7EA 4AUQB 3BRVB 4DOJA 5CCHD 4QF2A 5CCHA 1LTJA 3H32B 1FP0A 2VRSA 2KE1A 4UP0A 2Y43A 1LWUB 2OARA 1RY3A 4YC9A 1HYIA 5G05B 1N73B 3O70A 1KZUB 4Y99C 2H8PD 3RK2D 3VK6A 1GL2B 1FZCB 4MSXA 3BATA 3N9QA 2KYUA 2A45G 4HYTB 2K1JA 1LT9B 4IC2A 1JY2P 2Y1NA 4ZKPA 4I2LC 1N2DC 4EIJA 2UZGA 4GKGA 1HGZA 2Q3IA 3RL0C 4LKAA 1ZN5A 2HDPA 2YURA 2JRJA 2L80A 4FJCA 1IFDA 1T1HA 2ECTA 3HUSA 1CI6B 1SQVK 4WY4A 5KTBA 2E6RA 4B7YC 2F6JA 3B5NC 2K17A 2MIQA 4A0CD 3TNUA 1OXZA 2IPPA 2BAYA 2F42A 1GL2C 2WPSA 2PNXA 2FFDC 1SQBK 2KB7P 1RE4A 4JF7A 3NXSA 1DVPA 4AQRD 2CSYA 2F6NA 4O9BA 1U6GB 1FJPA 1V87A 1FAVA 2YQMA 1GD2E 1RF1A 1VYXA 3V2QA 4S3OC 2J59M 3GHGA 5TABA 2GUSA 2YMYA 3U5PA 4KHXA 2LQ6A 3N9MA 1JY3P 2KWKA 4WBAA 1CW5A 5TRBA 3ZNIA 2OYHC 2C2LA 5TDWA 4WZ2A 2ECNA 2FYZA 2H43A 4ZDTA 1JTHB 2VJFA 2P7JA 1NTZK 1XTGB 2NPSA 5CJ0A 1RE3A 1HBWA 2W6AA 1L0LK 4DZOA 1WFKA 2MNZA 3NG2A 3RK3D 5APSA 1HH0A 5KH7A 3U1AA 1J2JB 2YHOA 1YYCA 2JMIA 2LN0A 4WY4B 3LQIA 1LTJC 4AYCA 1MM3A 3RL0D 1SFCA 1YTZT 5C11A 1NAFA 3TNUB 1BORA 3M91A 4C7RA 3ZYQA 3N9OA 1NH4A 2HFED 3L37A 3SOWA 4TKPB 1N7LA 3V2NA 2MA6A 2RSDA 3KYQA 1LTSC 2WZ7A 1FJKA 1T2KC 3LRQA 4UP5A 3IFMA 1LWUA 5D1LB 2OXQC 4I6MC 4IC3A 1N73A 1GL2D 1OWAA 1GL2A 1FZCA 5CCGD 2LGKA 5CCGA 5G04B 2ECWA 4L58A 2HLOA 4AUWA 3GHGB 3O34A 1LT9A 3HUSC 5AVSB 4WY4C 2O01H 2E42A 2YW8A 1WEQA 2GUVA 2PAJA 4JYCA 2YQLA 4FO9A 4OH8B 5B8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XE5 B;  1A02 J;  1CI6 A;  3P7K A;  3RPG B;  1K2F A;  4PTB A;  4I7D A;  4O64 A;  4YBS A;  2ECV A;  3L11 A;  4CA1 A;  5AVX B;  5LKT A;  3NFQ A;  3U5M A;  3LID A;  2Z5I A;  3ZVY A;  4QF3 A;  2Q5U A;  3VMY A;  4JYB A;  1VFY A;  4BHW A;  1GK6 A;  2MNY A;  1WEN A;  1SP4 A;  3KQI A;  4MVT A;  2ZXE B;  2R5D A;  3FL2 A;  1WEW A;  3V5B A;  1FOS E;  4Q6F A;  4B86 A;  4N4F A;  5FB0 A;  3SHB A;  2YO2 A;  1X4I A;  5J3X A;  5FER A;  1FBV A;  1WES A;  3RPG C;  1T2K D;  3A7O A;  2M85 A;  2M6M A;  3N9P A;  2AN6 A;  2KFT A;  4GNG A;  2CT2 A;  2R5B A;  3I2D A;  3M99 A;  1HYJ A;  2E43 A;  4GB0 A;  1XWH A;  2L75 A;  5AW5 B;  2MA5 A;  1N87 A;  2WT7 A;  4L7X A;  1KQL A;  3SOX A;  4F52 B;  5APV A;  2YRE A;  4YAD A;  5DIN A;  4AP4 A;  2VPB A;  4C9Z A;  2ZET C;  3A3Y B;  3U5O A;  5AIU A;  4NN2 A;  5APW A;  5APQ A;  3PUQ A;  1RMD A;  2L43 A;  2M3H A;  2H0D A;  2MD8 C;  2RI7 A;  5LKU A;  5B78 A;  3KDP B;  4YAT A;  2YYR A;  3O7A A;  4A4C A;  1S9K E;  3P32 A;  2KRE A;  2ECG A;  2KIZ A;  3DPL R;  3V43 A;  1CSB A;  1IO4 A;  2PUY A;  4R8P K;  3LIE A;  4ZUX U;  1LDK C;  3HTK C;  4AVX A;  2CSZ A;  4GT1 A;  3IHP A;  5AVW B;  3C5K A;  4YAB A;  2WT7 B;  2K16 A;  2MT5 A;  4LAD B;  5FEY A;  1CHC A;  2XZR A;  2XV5 A;  2YNY A;  3M62 A;  4B86 C;  2WWW A;  4WA6 A;  5LKZ A;  1VD4 A;  4LLB A;  3N9N A;  4V3K C;  2EA6 A;  2YT5 A;  4LJN A;  2KP8 A;  3L35 A;  5B77 A;  4I7B A;  1WIL A;  2H0D B;  2L5U A;  1IYM A;  3N9L A;  5B76 A;  3KQG A;  3EB6 A;  3C6W A;  3KV5 A;  1GZL A;  2YSM A;  5AVY B;  2LDR A;  3T6R A;  1GU4 A;  2I50 A;  5D1K B;  4GNF A;  4M3L A;  1ZBD B;  1DH3 A;  2HYE D;  2KGG A;  4C7N B;  1Z60 A;  2KU3 A;  4WZ3 B;  3PHD A;  5D1M B;  2CKL B;  5AW4 B;  4W4U A;  2C9N Y;  5AW6 B;  2LXP C;  2QIZ A;  2Y1M A;  4PPE A;  2QM7 A;  4RES B;  2NAA A;  5AW1 B;  2JJL A;  4GNE A;  5AIT A;  3V4W A;  3LQH A;  1LDJ B;  2LRI C;  1JNM A;  1G2C B;  3HTK A;  1CZQ A;  2VPE A;  1WE9 A;  3HE5 A;  2R3C A;  2YO3 A;  1WGM A;  2BAS A;  3O8Z A;  3M0A A;  2XEU A;  5I3L A;  3TYY A;  3IR9 A;  3M9H A;  3KNV A;  2C2V S;  1JUN A;  2K4D A;  2G43 A;  1WEM A;  2VJE B;  1WEU A;  5AW3 B;  3L1X A;  2XU6 A;  2YHN A;  2LV9 A;  5APT A;  1MFZ A;  1MUU A;  2C9L Y;  2LGL A;  3U5N A;  3HCT A;  1GTW A;  2MUM A;  4C46 A;  5AVR B;  3M63 A;  3EB5 A;  3B8E B;  1JM7 B;  3DQV R;  1WIM A;  3ZTG A;  4P5O B;  3L1Z B;  3KV6 A;  5APU A;  2FUI A;  2LGV A;  2VNF A;  4A49 A;  5AVQ B;  2JMD A;  2KWJ A;  5AW7 B;  3VMZ A;  3ZPV E;  5CMZ A;  1X4J A;  5DKA A;  2IDA A;  5AW9 B;  2EGP A;  3VYI A;  4FK5 A;  4CCG X;  3HE5 B;  4A4B A;  2YU4 A;  5AVU B;  1E4U A;  1Z6U A;  5APY A;  5FB1 A;  2VPG A;  4WZ0 A;  4XI1 A;  2QJ0 A;  5APX A;  4S3O B;  3SWF A;  5C13 A;  1HUC A;  3LQJ A;  3V4Q A;  2M1R A;  3MGN A;  5KH3 A;  4YAX A;  3O36 A;  3HE4 B;  5LCW B;  5AW2 B;  3RTR B;  3MHH A;  4C7N A;  1X4U A;  1NWQ A;  5B79 A;  1H88 A;  1WEV A;  2CKL A;  2KGI A;  2P2U A;  3NTN A;  1X8Y A;  5AW0 B;  5LKX A;  4EOT A;  2KWN A;  2ECI A;  2VPD A;  5G0F A;  3M06 A;  2H7H A;  1WEP A;  4N3W A;  5B75 A;  3M0D A;  3UIA A;  1JOC A;  3O33 A;  1S9K D;  2E6S A;  2LXH C;  3ZVZ B;  2WPQ A;  1WEO A;  3NMD A;  2WPR A;  2YSJ A;  3ZPV 1;  3ASL A;  4LC1 A;  2N9B A;  4LK9 A;  4YBT A;  5KH9 A;  1FOS F;  1G25 A;  3L36 A;  2D8S A;  2KWO A;  4I7C A;  3PUR A;  2VJE A;  3M9B A;  5AVZ B;  4ZQL A;  2MD7 B;  5EYA F;  2KR4 A;  3I5C A;  3TK1 A;  2JMJ A;  5JG6 A;  1A02 F;  2LGG A;  2L0B A;  3QZV A;  5H1V A;  2G6Q A;  5AVV B;  3OAK A;  5TBN A;  4X3G A;  2P67 A;  3T97 A;  1JM7 A;  3P8M C;  4UI9 B;  1GK4 A;  4R2Y A;  1H89 A;  2G45 A;  3VTP C;  3A5T A;  3HCS A;  3O37 A;  4YBM A;  1F62 A;  2QM8 A;  2R32 A;  1HJB A;  1MV8 A;  2QIC A;  4BBQ A;  3MD0 A;  2Z5H A;  2DX8 A;  5TDR A;  3T7L A;  2W27 A;  3GV4 A;  4V3L C;  3HCU A;  2FSA A;  2FUU A;  5H1T A;  2ZFC A;  4FIP A;  1GU5 A;  1WEE A;  2VJF B;  3VMX A;  1SLQ A;  2EOD A;  2VP7 A;  1H8A A;  3A2A A;  3HE4 A;  5H1U A;  2XB1 A;  1HWT C;  2Q7C A;  3GL6 A;  5AVT B;  1Z2Q A;  5AW8 B;  4AYC B;  2ECJ A;  3O35 A;  3MHS A;  5H9M A;  4GND A;  3VN0 A;  2YUC A;  1MM2 A;  2WTY A;  3SOU A;  4R7E A;  4AUQ B;  4QF2 A;  1FP0 A;  2VRS A;  2KE1 A;  4UP0 A;  2Y43 A;  4YC9 A;  1HYI A;  5G05 B;  3O70 A;  3VK6 A;  4MSX A;  3N9Q A;  2KYU A;  4HYT B;  2K1J A;  4IC2 A;  2Y1N A;  4I2L C;  2UZG A;  4GKG A;  2Q3I A;  4LKA A;  2HDP A;  2YUR A;  2JRJ A;  2L80 A;  4FJC A;  1T1H A;  2ECT A;  1CI6 B;  2E6R A;  4B7Y C;  2F6J A;  2K17 A;  2MIQ A;  4A0C D;  3TNU A;  1OXZ A;  2IPP A;  2BAY A;  2F42 A;  2WPS A;  2PNX A;  3NXS A;  1DVP A;  4AQR D;  2CSY A;  2F6N A;  1U6G B;  1V87 A;  1FAV A;  2YQM A;  1GD2 E;  1VYX A;  4S3O C;  5TAB A;  3U5P A;  4KHX A;  2LQ6 A;  3N9M A;  2KWK A;  5TRB A;  3ZNI A;  2C2L A;  5TDW A;  4WZ2 A;  2ECN A;  4ZDT A;  2VJF A;  2P7J A;  1HBW A;  2W6A A;  4DZO A;  1WFK A;  2MNZ A;  3NG2 A;  5APS A;  5KH7 A;  1J2J B;  2YHO A;  1YYC A;  2JMI A;  2LN0 A;  3LQI A;  4AYC A;  1MM3 A;  5C11 A;  1NAF A;  3TNU B;  1BOR A;  3M91 A;  3ZYQ A;  3N9O A;  3L37 A;  3SOW A;  4TKP B;  2MA6 A;  2RSD A;  3LRQ A;  1T2K C;  4UP5 A;  5D1L B;  2OXQ C;  4I6M C;  4IC3 A;  1OWA A;  2LGK A;  5G04 B;  2ECW A;  4L58 A;  4AUW A;  3O34 A;  5AVS B;  2E42 A;  2YW8 A;  1WEQ A;  4JYC A;  2YQL A;  4FO9 A;  5B8D A; 
#chains in the Genus database with same CATH topology
 4U3F D;  1DX7 A;  1SQB D;  3DDT A;  1RQV A;  2BCC E;  3L11 A;  1VPC A;  5AVX B;  3EQ2 A;  3N4X A;  3CCU P;  3CC4 P;  1YJ9 P;  4UB6 E;  2AXT E;  3ZVY A;  1SFC B;  2Q5U A;  1VFY A;  2KOG A;  4BHW A;  1GK6 A;  1SP4 A;  2WSF H;  2ZXE B;  1WEW A;  3V5B A;  4Q6F A;  3Q2Y A;  3BRT B;  1Q7Y Q;  1RE3 C;  5FER A;  1NO4 A;  1WRG A;  1T2K D;  2AN6 A;  3I56 P;  1JTH A;  4GIF A;  4YPC A;  1LTB C;  4KT0 J;  1JEK A;  4HJG H;  1SFC C;  1KIL B;  2B87 A;  1MKM A;  5B66 E;  3SOX A;  5APV A;  4YAD A;  5DIN A;  1QLE D;  2ZET C;  1ZLL A;  1W5C E;  1NHL A;  1FZC C;  3VP8 A;  1R5L A;  1OVV A;  1BSH A;  3HD7 B;  2FXM A;  2CPB A;  2XNX A;  5B78 A;  3KDP B;  1FZG A;  3CXH I;  2KRE A;  3DPL R;  3M7K A;  3V43 A;  2PUY A;  4R8P K;  3H1K J;  1ZRT D;  4D6T G;  1JMB A;  1LDK C;  4N6J A;  2QIW A;  4XFJ A;  2CSZ A;  1SQV J;  2RN0 A;  5AVW B;  2NZ2 A;  3PLN A;  2MJZ A;  4YAB A;  3A0H H;  2W90 A;  4L75 A;  3H7H A;  3S9O A;  1SQQ D;  2Y0D A;  1DIP A;  2XZR A;  1E5W A;  4WA6 A;  1YJW P;  2O3J A;  4V3K C;  2YT5 A;  3L70 D;  3L35 A;  4NPE A;  1BSN A;  3II6 A;  2WSS H;  3EB6 A;  1VQM P;  3AED C;  1N7S A;  1NKN A;  2HOD A;  2ITA A;  3H1K E;  5D1K B;  3KPE A;  4O62 A;  1GW3 A;  2W6J H;  3CXH D;  1SQV E;  4C7N B;  4WZ3 B;  3L72 G;  1VL2 A;  2HPC B;  2CKL B;  3CCM P;  3QH9 A;  2L5G B;  1GW4 A;  5AW6 B;  2Y1M A;  4PPE A;  2D2C B;  3V4W A;  1LDJ B;  1JNM A;  2E74 D;  4ZMD A;  2K88 A;  2KLU A;  3JUE A;  2BAS A;  3M0A A;  3CCS P;  3IR9 A;  1VQK P;  3Q5P A;  1Q86 Q;  3OJA B;  3M9H A;  1T8Z A;  5GTI H;  1PPJ D;  2G43 A;  4GDO A;  2R44 A;  5DJT B;  3WMM 0;  1L0N D;  1YHQ P;  2HOD B;  2C9L Y;  2PRR A;  1NKZ B;  4XA4 A;  1GTW A;  2MUM A;  4OGQ B;  2CRR A;  3RBZ A;  1IFM A;  2QJY B;  2IYO A;  5APU A;  2LGV A;  3W67 A;  5AVQ B;  1FC2 C;  2CSV A;  5CMZ A;  1X4J A;  4PD4 D;  2FFD B;  2I1K A;  2EGP A;  1N7S C;  4A4B A;  2B89 A;  5AVU B;  1E4U A;  3Q1M A;  3CX5 H;  1WT6 A;  4XI1 A;  3Q5R A;  4S3O B;  3SWF A;  5C13 A;  1HUC A;  2E5Y A;  3V4Q A;  2M1R A;  3MGN A;  4YAX A;  3Q1D A;  3O36 A;  5M1B A;  1BE3 D;  2OYH B;  1KB9 I;  1IZN B;  1NTM D;  3TGU D;  3GF7 A;  1DD3 A;  1EZV D;  3CCJ P;  1Z56 A;  1X8Y A;  1RHZ B;  1ZW0 A;  5G0F A;  1LT1 A;  5GTH H;  3RK3 E;  1YIJ P;  1WEP A;  5KAF H;  4N3W A;  1QEX A;  1WEO A;  3NMD A;  1OZH A;  3FGA D;  2A06 G;  3FEH A;  1FOS F;  1G25 A;  3L36 A;  3MUD A;  1SQX D;  3BCC D;  2VJE A;  3U1C A;  2ZAE B;  3M9B A;  5AVZ B;  2MD7 B;  5EYA F;  2QRX A;  2KR4 A;  3B4S A;  2KNC B;  2BEZ F;  2KKX A;  3QWO C;  4X3G A;  1LTT C;  1VQ9 P;  1X79 B;  4R2Y A;  2P57 A;  1OX3 A;  4YXD C;  4OGC A;  3HCS A;  3IAO A;  1HJB A;  1PP9 E;  2DX8 A;  5TDR A;  3AE9 C;  2KK7 A;  3AE8 C;  5K3Q A;  3TSI A;  4PV1 B;  3C8V A;  2EOD A;  3A2A A;  3HE4 A;  2XB1 A;  1JM0 A;  1HWT C;  1L4A D;  3GL6 A;  1OVR A;  3P8C E;  3RBX A;  2OQQ A;  2ECJ A;  5H9M A;  4GND A;  2WSF J;  1MM2 A;  4JQ0 D;  2WTY A;  2KS1 A;  1R8E A;  5CCH A;  1NU1 E;  1KN7 A;  1RQU A;  3MUD C;  3FAO A;  2OAR A;  3O70 A;  2E76 B;  2H8P D;  1VQ6 P;  3AEF C;  1LT9 B;  4UB8 E;  1JY2 P;  4GKG A;  1HGZ A;  1YBK A;  4LKA A;  3L74 D;  4NPF X;  3G71 P;  2Y9Z A;  2KSE A;  2ZYG A;  1SQV K;  4WY4 A;  2E6R A;  2F6J A;  3SFD C;  2K17 A;  3FJU B;  3TNU A;  4H13 B;  2E76 C;  1BCC G;  4DJG A;  1HF9 A;  1DVP A;  2JWD A;  4AQR D;  2F6N A;  3CXH H;  2OTK E;  1EDK A;  1FAV A;  1RF1 A;  2J59 M;  2YMY A;  3MDB C;  4R4L A;  5TRB A;  4TLF A;  1KTM A;  4H13 C;  4WZ2 A;  4ZDT A;  1SQP D;  2P7J A;  1OMI A;  5KH7 A;  1VQO P;  1S5L X;  2LN0 A;  4WY4 B;  5DJU B;  1YTZ T;  3IF4 A;  3TNU B;  1AQT A;  1KIL E;  2FFW A;  3D70 A;  2WZ7 A;  1FJK A;  4UP5 A;  3IFM A;  2K3R A;  2OXQ C;  2RR4 A;  1N73 A;  1OWA A;  1S2E A;  1GL2 A;  2LGK A;  3Q5S A;  4GOF A;  2HLO A;  3O34 A;  2O01 J;  3PH0 A;  5AVS B;  4RKU J;  4WY4 C;  1PP9 G;  1L0L J;  4H44 B;  2YW8 A;  1BGY J;  4PD4 H;  4OH8 B;  4XE5 B;  1NTK E;  1A02 J;  1CI6 A;  2P58 A;  3P7K A;  1FDM A;  3AE2 C;  1W2B O;  2IDB A;  1K2F A;  1U57 A;  4YBS A;  4CA1 A;  4ZKU A;  1NTZ G;  4WWI A;  5LKT A;  3NFQ A;  1JCC A;  1RF1 C;  2Z5I A;  4QF3 A;  5KLV G;  1U7M A;  5KAI H;  3D71 A;  2MNY A;  4Z0R A;  1WEN A;  4MVT A;  1LGH B;  3CCR P;  4I7Z C;  1GDT A;  5KJ7 A;  1JMM A;  1NU1 G;  4N4F A;  1P84 E;  2YO2 A;  1WES A;  3L71 E;  1K04 A;  1BGY E;  2K9J A;  3A7O A;  2M85 A;  3RK3 C;  4N78 D;  2YKP A;  2M8R A;  1E79 H;  2KFT A;  4GNG A;  2CT2 A;  2R5B A;  3I2D A;  1HYJ A;  1GMJ A;  4ASW A;  3FXE A;  4GB0 A;  2N1T B;  4IL6 H;  2WT7 A;  4L7X A;  1KQL A;  4BRY B;  2YRE A;  1PV3 A;  1MZ9 A;  2FYU J;  2Q6Q A;  3U5O A;  3HTK B;  1N73 C;  5APW A;  1LTI C;  3H1J E;  2O1K A;  1EDL A;  1DD4 A;  2Y0E A;  1M1J B;  1KYO D;  5LKU A;  2YKQ A;  3CME P;  1VF5 C;  2N1T C;  4H0L D;  2ECG A;  2FXO A;  3V2R A;  3FWN A;  1JB0 J;  3LIE A;  3VOP A;  5TIS H;  1QVG O;  1M7L A;  3HTK C;  2POH A;  3WU2 E;  2NPS D;  3SUB A;  3W68 A;  2FYU E;  3CI9 A;  3L73 E;  3C5K A;  2E75 B;  3H1H G;  2WT7 B;  5KLV K;  2MT5 A;  1MBM A;  4LAD B;  1SQB J;  3SWY A;  5KJ7 C;  1OFC X;  3G6E P;  1NOH A;  4D6T D;  5LKZ A;  2SPZ A;  3H1I D;  1NU1 K;  1VQN P;  2KP8 A;  1WIL A;  2L5U A;  1HTL C;  5B76 A;  3KQG A;  3C6W A;  1GZL A;  5AVY B;  1AJY A;  1YJN P;  4M3L A;  1PGO A;  2E75 C;  1FZA A;  4PJ0 H;  1D7M A;  1N86 A;  5GTH E;  1URQ B;  3IN6 A;  1J1E B;  1KIL A;  2C9N Y;  2QIZ A;  1AQ5 A;  1G1J A;  2NRG A;  2QM7 A;  3BVH A;  2OYI B;  2NAA A;  1SQB E;  1NTK G;  1IC2 A;  1Y9B A;  1G2C B;  1CZQ A;  1S1C X;  2VPE A;  1WE9 A;  2MKV A;  2YO3 A;  3L72 D;  5BU8 B;  2G3A A;  3HD7 A;  3G3Z A;  2ZJS E;  1JUN A;  1FZE A;  2W6B A;  1J1E C;  3AEG C;  2C0X A;  2LV9 A;  2OYI C;  3L71 G;  1MUU A;  3TF5 A;  2LGL A;  3HCT A;  4C46 A;  5AVR B;  1YQ3 C;  3T97 B;  3M63 A;  1JM7 B;  3B8E B;  3DQV R;  3ZTG A;  3B5N B;  2WPV B;  2XDJ A;  2KWJ A;  2YIU B;  4FK5 A;  2WSC J;  2DJA A;  1RF0 A;  3LW5 H;  1SQQ J;  3A0B H;  1Z6U A;  3H1J G;  3O47 A;  2FKW B;  5FB1 A;  4W80 A;  4WZ0 A;  2GM4 A;  3H6P A;  3L70 J;  2HR3 A;  1JO5 A;  1KV4 A;  3LQJ A;  4HKZ H;  1KIL C;  2QE7 H;  1IK9 A;  3D6Z A;  2K1A A;  1VQP P;  3AEB C;  4C7N A;  5B79 A;  2HPC A;  2CKL A;  1NTK K;  2YIU C;  2P2U A;  4HB1 A;  3NTN A;  4LGD E;  5LKX A;  2KWN A;  2VPD A;  3M06 A;  2H7H A;  2O01 N;  3CWB J;  3L73 G;  1LTJ B;  3HD7 C;  1ZP0 C;  4LC1 A;  2N9B A;  3RK2 B;  3MIW A;  2IBZ E;  5KH9 A;  1ZR4 A;  3L70 E;  1PGP A;  3BAS A;  2YXQ B;  1NVO A;  3PUR A;  2V7Q H;  5KKZ B;  3H1L G;  5JG6 A;  1L0N J;  2G6Q A;  2QA4 P;  1G1I A;  5AVV B;  1IFN A;  2A06 D;  3CWB E;  3RK2 C;  3P8M C;  3CMA P;  1RF0 C;  1FS0 E;  1H89 A;  2OTJ P;  4KJM A;  2PGD A;  2BCC G;  4YBM A;  1F62 A;  2FFD A;  3CCL P;  2R32 A;  2QIC A;  4BBQ A;  3L4F A;  2Z5H A;  3GV4 A;  4V3L C;  3HCU A;  1DEB A;  2CPS A;  1AFO A;  1M8O B;  2VJF B;  2NPS B;  1SLQ A;  2KLV A;  2VP7 A;  2OYH A;  2Q7C A;  5SVX A;  2D2C C;  1KYO H;  1Z2Q A;  4JPZ B;  1J1D B;  1EC5 A;  3O35 A;  1JY2 N;  1BE3 J;  4F1P A;  3VN0 A;  3L75 D;  1NTM J;  3KHU A;  3TGU J;  3SOU A;  5CCH D;  1OW7 A;  2E61 A;  1FP0 A;  4UP0 A;  2Y43 A;  1LWU B;  4OVN F;  3LVQ E;  1KZU B;  1DEE G;  4MSX A;  4PD4 E;  2WMM A;  1EDJ A;  3GMA A;  3O6Q B;  4ZKP A;  1N2D C;  2QG4 A;  4OGE A;  4OGQ C;  3R4Y A;  1SQX J;  2JRJ A;  4FJC A;  3CPW O;  2QJY C;  3BCC J;  2KNC A;  5SVI B;  1BE3 E;  4A0C D;  2M0B A;  1NTM E;  1OXZ A;  2IPP A;  3TGU E;  2BAY A;  3AEE C;  4IOI H;  1EZV E;  2WPS A;  2FFD C;  1SQB K;  2KB7 P;  1KOR A;  2OYO A;  1FJP A;  3AE5 C;  3V2Q A;  4S3O C;  1Q90 D;  3U5P A;  2LQ6 A;  3N9M A;  2XP0 A;  4WBA A;  1CW5 A;  4R4M A;  1BCC D;  2OYH C;  1PGJ A;  2IBZ G;  2ECN A;  1SQX E;  3BCC E;  1XTG B;  4K3A A;  1HBW A;  2W6A A;  4DZO A;  1WFK A;  3NG2 A;  3RK3 D;  1HH0 A;  3H1K G;  2YHO A;  1YYC A;  2JMI A;  5H2F E;  2XOZ A;  1MM3 A;  3RL0 D;  3M91 A;  1KMI Z;  1SQV G;  1NH4 A;  3L37 A;  4EYY Q;  3CWB G;  3V2N A;  1KB9 D;  1T2K C;  1KQF B;  2K37 A;  4UB6 H;  4I6M C;  1GL2 D;  5TIS E;  4BWN A;  3FX0 A;  3C1L A;  3GLM A;  5G04 B;  2ECW A;  2IYP A;  1LT9 A;  3I55 P;  2LXC B;  2ZT9 D;  2YQL A;  2K9Y A;  1QX8 A;  4HH2 A;  4YXW H;  1HJ0 A;  3L74 J;  1YTZ I;  3U5M A;  3F89 A;  5B66 H;  1PP9 D;  3VMY A;  1S5L E;  4PJ0 E;  3S1K A;  4IL6 X;  4L76 A;  3SFE C;  5FB0 A;  1KQG B;  4Y28 J;  1X4I A;  4PV1 C;  1NTZ D;  1S4X A;  3N9P A;  1Q2N A;  3CD6 P;  5KLV D;  1LJ2 A;  3FWL A;  5CJ4 A;  2V4H A;  3EFF K;  1EDI A;  2HYN A;  1XWH A;  2L75 A;  1X9V A;  5AW5 B;  2MA5 A;  1EXJ A;  3AE4 C;  1SQP J;  1NU1 D;  4I1L A;  4W7Z A;  1JY3 N;  3LW5 J;  3ZDM A;  1VQ5 P;  2XOC A;  1QL1 A;  4NN2 A;  3WUT A;  5APQ A;  2E74 B;  4MN4 C;  1ZME C;  3PUQ A;  2M3H A;  2H0D A;  3PP5 A;  1LT9 C;  5B5E H;  3GF3 A;  2MD8 C;  2RI7 A;  1IFP A;  3KXD A;  2YYR A;  4CPG A;  1K05 A;  1S9K E;  5L8R J;  3P32 A;  3RGU A;  2I8D A;  3FM8 C;  5E79 H;  2L7P A;  3N7N A;  1SQP E;  2E74 C;  2WSE H;  3IHP A;  2XND H;  4WVZ A;  3ITK A;  4W7Y A;  3A0B E;  2OWA A;  1CHC A;  1ZV8 A;  3V2P A;  1SFC D;  2DSM A;  2D8U A;  2YNY A;  2WWW A;  1USE A;  4LLB A;  1JY2 O;  3N9N A;  2EA6 A;  2V7Q J;  2H0D B;  3E1R A;  1UIX A;  3N9L A;  1SVF A;  2KZJ A;  2FYN B;  1IFI A;  3H1H D;  2LDR A;  1GU4 A;  2QJK B;  3PTZ A;  1DCQ A;  3CCE P;  2Y0C A;  1DH3 A;  2KU3 A;  3PHD A;  2B9B A;  3A0H E;  1K73 Q;  1KIL D;  4RJT A;  5AW4 B;  1P84 I;  4W4U A;  2N1T A;  3LJU X;  2QJP B;  1VQ7 P;  4IFF A;  4RES B;  4BRY A;  5AW1 B;  3LQH A;  1JCD A;  2FD4 A;  2LRI C;  3HTK A;  3PRJ A;  2FYN C;  3HE5 A;  4Z1M H;  1WGM A;  3O8Z A;  2DW3 A;  3HD7 D;  2CRW A;  2C2V S;  4U7J A;  2G8Y A;  1M1J A;  2IZ0 A;  4H44 C;  1FU1 A;  1WEM A;  1WEU A;  1NTK D;  4EI2 A;  5AW3 B;  3L1X A;  2A45 I;  1AV1 A;  2FBW C;  3MP7 B;  1L0L E;  1SQX K;  1MFZ A;  4N78 E;  1T3U A;  2GA1 A;  2JWA A;  3OA7 A;  1W2E A;  2CK3 H;  1QVF O;  3EB5 A;  1FE6 A;  2VNF A;  3M9Q A;  4A49 A;  1P84 D;  2JMD A;  5GTI E;  3VMZ A;  3ZPV E;  2Z4E A;  5DKA A;  3L71 D;  5AW9 B;  2J58 A;  2MKE A;  3HE5 B;  2YU4 A;  5APY A;  1ZR2 A;  4ZNC A;  4D6T J;  2VPG A;  3H1I J;  1KYO E;  2ZT9 B;  5APX A;  2YXR B;  5K5G B;  1KB9 H;  5LCW B;  2KI7 B;  5AW2 B;  5CBO A;  1VQ4 P;  2M3B A;  3MHH A;  1URQ A;  1X4U A;  1LTA C;  1L4A B;  2N9Y B;  2AXC A;  1H88 A;  1WEV A;  2KGI A;  3H1J D;  3LVR E;  1N8R Q;  2BEQ D;  4EOT A;  4Z0O A;  1H0T B;  2OYI A;  2D2C D;  2JUN A;  1K8A Q;  5B75 A;  3M0D A;  3JC2 2;  1G2C A;  3SSU A;  1M1J C;  1JOC A;  3CX5 E;  1Y47 A;  4U3F J;  2E6S A;  2LXH C;  3ZVZ B;  2WPQ A;  2WPR A;  1KQS O;  4D6T E;  1XTC C;  3ASL A;  3H1I E;  2B88 A;  4YBT A;  4GOD A;  1L4A C;  3KZI H;  3L72 J;  2AEM A;  3EFG A;  2EXU A;  3R2P A;  1N7S D;  1LP1 B;  3L73 D;  4ZQL A;  3I5C A;  2UWJ E;  3TK1 A;  3HUS B;  1A02 F;  1ZXG A;  2L0B A;  5H1V A;  2KSJ A;  4OGQ D;  1UII A;  1LNQ A;  3OAK A;  5KAF E;  1FBM A;  2M3E A;  2P67 A;  3T97 A;  1JM7 A;  1IJD B;  1GK4 A;  4U3F E;  3B5N A;  3MTU E;  3OW2 O;  3VTP C;  3A5T A;  3HRN A;  3O37 A;  3H1L D;  3C9I A;  2M5A B;  2QM8 A;  1JY3 O;  1BDC A;  3L72 E;  3T7L A;  2LAU A;  2W27 A;  4JBZ A;  4A7P A;  2FSA A;  2ZYD A;  1URQ C;  5H1T A;  4FIP A;  1WMK A;  4UB8 H;  1H8A A;  5H1U A;  2BCC D;  2P10 A;  1SQP K;  1L0L G;  5AVT B;  3M0D C;  4AYC B;  1BGY G;  4TT3 H;  3MHS A;  3H25 A;  2Q1K A;  4R7E A;  4AUQ B;  4DOJ A;  3SWK A;  4QF2 A;  1LTJ A;  2VRS A;  1VQL P;  3JSV C;  1RY3 A;  5G05 B;  2W83 C;  1FZC B;  1VQ8 P;  2M13 A;  2A45 G;  4HYT B;  2K1J A;  1M57 D;  2Y1N A;  3B71 A;  3F5H A;  4ASV A;  1ZN5 A;  3JCU H;  2HDP A;  1IFD A;  1S72 P;  5KTB A;  4B7Y C;  2IBZ I;  3B5N C;  2QEX P;  2MIQ A;  1ZRT E;  2F42 A;  1NAY A;  1RE4 A;  1OW8 A;  2FYU G;  4O9B A;  1U6G B;  1GD2 E;  1VYX A;  1SQQ E;  3FXD A;  3GHG A;  2GUS A;  2KWK A;  2KIK A;  1QGK B;  3ZNI A;  3H1I G;  2WSE J;  2ZVN B;  5TDW A;  2FYZ A;  2H43 A;  1JTH B;  4PV1 D;  2VJF A;  2NPS A;  5CJ0 A;  1EXI A;  1L0L K;  2B87 B;  1X0T A;  3U1A A;  3CCV P;  3GW6 A;  1LTJ C;  5B5E E;  1PZQ A;  3CXH E;  2A06 E;  1YQ4 C;  1M1K Q;  4C7R A;  5SVY A;  3ZYQ A;  3N9O A;  2HFE D;  2IBZ D;  2MA6 A;  3KYQ A;  1LTS C;  2JKV A;  3L75 J;  1LWU A;  4U3F G;  5D1L B;  2E76 D;  1SQB G;  4YTP C;  3H1K D;  5E79 E;  5KKZ C;  1OW6 A;  4GOE A;  5CCG A;  4L58 A;  3GHG B;  4H0L B;  3O6Q A;  3Q3D A;  1OIP A;  1P84 H;  1SQV D;  2O01 H;  3CWB D;  1WEQ A;  2GUV A;  1PGQ A;  1PPJ E;  5EFW B;  5B8D A;  5BU5 A;  4PD4 I;  1RE4 C;  1L0N E;  3RPG B;  5SVI A;  4PTB A;  4I7D A;  4O64 A;  2ECV A;  4H13 D;  1FZB A;  3LID A;  2FYU K;  3PHL A;  1SS1 A;  3L75 E;  1YI2 P;  3GHG C;  4JYB A;  4H0L C;  3KQI A;  2A45 H;  2QVA A;  2R5D A;  3FL2 A;  1S3J A;  2Q9I A;  2H89 C;  1FOS E;  2OTL P;  4B86 A;  2HG5 D;  3SHB A;  2JDI H;  2XOY A;  1N7S B;  2NPS C;  1EZV I;  5J3X A;  3G9R A;  1FBV A;  3RPG C;  2YMK A;  1BDD A;  1PL5 A;  2M6M A;  1AA0 A;  2Q3E A;  1J1D C;  1BCC J;  3M99 A;  2E43 A;  1RH5 B;  1N87 A;  4LLH A;  4WY4 D;  4F52 B;  3WU2 H;  4AP4 A;  2VPB A;  5KAI E;  4C9Z A;  1LWU C;  3A3Y B;  5AIU A;  1K9M Q;  3MHV A;  1RMD A;  2L43 A;  5CCG C;  4WB4 A;  4NPD A;  2IX7 C;  1PFI A;  3VP9 A;  2JR8 A;  4YAT A;  3O7A A;  4A4C A;  2KIZ A;  1SQQ G;  1CSB A;  1IO4 A;  4H44 D;  1BCC E;  4ZUX U;  4IL6 E;  1MFT A;  2L91 A;  1QL2 A;  3L70 G;  1AVO A;  4AVX A;  4GT1 A;  3AE3 C;  1X22 A;  1IK7 A;  1T6A A;  2K16 A;  3U59 A;  2AEF A;  5FEY A;  2EGM A;  2XV5 A;  4B86 C;  3M62 A;  5CHX A;  1VD4 A;  2YKO A;  3AEA C;  4RO0 A;  1KB9 E;  4LJN A;  2WQY C;  5B77 A;  3K5B A;  4I7B A;  1PP9 J;  1IYM A;  3AE6 C;  2LXB A;  3KV5 A;  2AXT H;  2YSM A;  3PLW A;  3T6R A;  1FDI A;  2I50 A;  4GNF A;  3V6I A;  2FXP A;  1ZOY C;  1ZBD B;  3TDK A;  1NTZ J;  2HYE D;  2KGG A;  3MZW B;  5C39 A;  1Z60 A;  4DT0 A;  5D1M B;  1HGV A;  1VF5 D;  2N1T D;  3E1I A;  1YIT P;  5KLV J;  2C0W A;  1PPJ G;  1KFN A;  3CC2 P;  2LXP C;  2CON A;  2YVR A;  1L0N G;  2JJL A;  4GNE A;  5AIT A;  1VDF A;  2KUB A;  3KZI E;  1NU1 J;  2R3C A;  2XKM A;  2XEU A;  5I3L A;  3TYY A;  1PIX A;  1R5S A;  3L75 G;  2KXP B;  3KNV A;  1HVV A;  1TU3 F;  2K4D A;  1SQQ K;  5KJ7 D;  1FDO A;  2VJE B;  2FY8 A;  1FZF A;  2XU6 A;  2YHN A;  1LTG C;  1NTZ E;  2KYV A;  5APT A;  3D6Y A;  3P8C D;  3U5N A;  5KLV E;  2OGU A;  2P1J A;  3DWD A;  5KLI B;  3L74 E;  2E75 D;  1WIM A;  4P5O B;  3L1Z B;  3KV6 A;  2FUI A;  3KDE C;  2IZ1 A;  5AW7 B;  3T9K A;  1OVU A;  1BE3 G;  2PFX A;  2QSI A;  2IDA A;  3VYI A;  4CCG X;  1NTM G;  1M90 Q;  3TGU G;  3AE1 C;  1KD1 Q;  3PJS K;  1EZV G;  2WSC H;  3CLQ A;  4BXL A;  4QQ4 A;  2WVR A;  2QJ0 A;  3RL0 g;  1NGM B;  2IFN A;  2I1J A;  5KLI C;  3USS A;  2WIT A;  3S4R A;  5KH3 A;  3HE4 B;  1T3J A;  2R3S A;  1URQ D;  3RTR B;  3H1H J;  1IFJ A;  1NWQ A;  2JP3 A;  3AE7 C;  1L0N K;  4L73 A;  5AW0 B;  1SQX G;  3BCC G;  2ECI A;  2KS1 B;  2JO1 A;  4IFD K;  3GG2 A;  2E5T A;  3UIA A;  3O33 A;  1S9K D;  2YSJ A;  2W8Z A;  3ZPV 1;  1Q81 Q;  3JCU E;  4LK9 A;  1Y8A A;  1EQ7 A;  2D8S A;  2Y9Y A;  2KWO A;  4I7C A;  1U7J A;  2O1J A;  4N3Y B;  3H1H E;  4EDF A;  2JMJ A;  1NTK J;  2LGG A;  3E2D A;  5CCH C;  3QZV A;  5TBN A;  1AVY A;  4UI9 B;  3B5N D;  3H32 A;  1NTM K;  4IFM A;  2G45 A;  3CL3 D;  1USD A;  1RF1 B;  1MV8 A;  2QJK C;  3MD0 A;  3L71 J;  2PP6 A;  4I7Z B;  1M56 D;  2H88 C;  2LKM A;  2FUU A;  2ZFC A;  1GU5 A;  1WEE A;  2IFM A;  3VMX A;  4Y99 B;  3WUU A;  2QJP C;  2JEE A;  1KFM A;  3LDY A;  3RK3 B;  5BVZ A;  2B0O E;  1L4A A;  3G4S P;  5AW8 B;  1KYO I;  3RL0 B;  2YUC A;  1H0T A;  3WUV A;  3BRV B;  3H1J J;  3L74 G;  3H32 B;  2KE1 A;  2AEJ A;  4YC9 A;  1HYI A;  1N73 B;  1NYH A;  4Y99 C;  3RK2 D;  3VK6 A;  1GL2 B;  1L0L D;  3BAT A;  3N9Q A;  2KYU A;  1BGY D;  4IC2 A;  4OWF A;  4I2L C;  4EIJ A;  2UZG A;  2Q3I A;  3CX5 I;  3RL0 C;  1LP1 A;  1VF5 B;  2YUR A;  2L80 A;  1T1H A;  2ECT A;  3HUS A;  1CI6 B;  3L73 J;  1KC8 Q;  2ZXX A;  3CC7 P;  1GL2 C;  2PNX A;  2IQJ A;  2LR2 A;  4JF7 A;  3NXS A;  4DCK A;  5H2F H;  1SQP G;  2CSY A;  4L74 A;  4K35 A;  1V87 A;  2YQM A;  2ZT9 C;  3VMA A;  2M5A A;  5TJH A;  3EWK A;  5TAB A;  2RKL A;  4KHX A;  1JY3 P;  3H1L J;  2K9J B;  2C2L A;  4QMA A;  2JM3 A;  1NTZ K;  3AEC C;  1RE3 A;  2KZI A;  2FYU D;  2MNZ A;  2RMZ A;  5APS A;  1J2J B;  2ZVO B;  3CX5 D;  2KKY A;  3LQI A;  4AYC A;  2BCC J;  1SFC A;  5C11 A;  1NAF A;  1BOR A;  3CCQ P;  2RH0 A;  3SOW A;  3ABV C;  5CBN A;  1N7L A;  4TKP B;  2RSD A;  4H9D A;  2J5U A;  3LRQ A;  4IC3 A;  1Q82 Q;  3H1L E;  1FZC A;  2ZYA A;  5CCG D;  3E7K A;  1S5L H;  4AUW A;  1L2P A;  3HUS C;  3FAN A;  2E42 A;  2PAJ A;  4JYC A;  4FO9 A;  1NJI Q; 
#chains in the Genus database with same CATH homology
 4XE5 B;  5BU5 A;  1A02 J;  4HH2 A;  1CI6 A;  1RE4 C;  3P7K A;  1FDM A;  1DX7 A;  3RPG B;  1K2F A;  4PTB A;  4I7D A;  4O64 A;  4YBS A;  2ECV A;  3L11 A;  1VPC A;  4CA1 A;  5AVX B;  3EQ2 A;  4ZKU A;  1YTZ I;  3N4X A;  5LKT A;  3NFQ A;  3U5M A;  1JCC A;  1FZB A;  3LID A;  2FYU K;  1RF1 C;  2Z5I A;  3ZVY A;  4QF3 A;  1SFC B;  2Q5U A;  3GHG C;  4JYB A;  3VMY A;  2KOG A;  1VFY A;  4BHW A;  1GK6 A;  2MNY A;  1WEN A;  1SP4 A;  2WSF H;  1LGH B;  3KQI A;  4MVT A;  2ZXE B;  2A45 H;  1GDT A;  5KJ7 A;  2R5D A;  3FL2 A;  1WEW A;  2Q9I A;  3V5B A;  1FOS E;  4Q6F A;  1JMM A;  2HG5 D;  3BRT B;  4B86 A;  4N4F A;  5FB0 A;  2YO2 A;  3SHB A;  1N7S B;  2NPS C;  1X4I A;  1RE3 C;  5J3X A;  5FER A;  1FBV A;  1WES A;  3RPG C;  1NO4 A;  1WRG A;  1T2K D;  3A7O A;  2M85 A;  2M6M A;  3RK3 C;  3N9P A;  4N78 D;  2YKP A;  2M8R A;  2AN6 A;  2KFT A;  4GNG A;  1JTH A;  2CT2 A;  2R5B A;  1J1D C;  4GIF A;  3I2D A;  3M99 A;  1LTB C;  5CJ4 A;  1HYJ A;  1SFC C;  2E43 A;  1KIL B;  4GB0 A;  2HYN A;  1XWH A;  2N1T B;  2L75 A;  1X9V A;  5AW5 B;  1N87 A;  2MA5 A;  2WT7 A;  4LLH A;  4L7X A;  1KQL A;  4WY4 D;  3SOX A;  4F52 B;  5APV A;  2YRE A;  1MZ9 A;  4I1L A;  4YAD A;  5DIN A;  4AP4 A;  2VPB A;  4C9Z A;  1LWU C;  1JY3 N;  4W7Z A;  2ZET C;  3A3Y B;  3U5O A;  3HTK B;  1ZLL A;  1N73 C;  1QL1 A;  5AIU A;  4NN2 A;  5APW A;  5APQ A;  1NHL A;  1FZC C;  3PUQ A;  1LTI C;  1RMD A;  3VP8 A;  2O1K A;  2L43 A;  5CCG C;  2M3H A;  2H0D A;  3PP5 A;  4WB4 A;  1LT9 C;  3HD7 B;  2MD8 C;  2IX7 C;  2FXM A;  1M1J B;  2CPB A;  2RI7 A;  1PFI A;  2XNX A;  3VP9 A;  5LKU A;  5B78 A;  3KDP B;  4YAT A;  2YYR A;  2YKQ A;  1FZG A;  3O7A A;  4A4C A;  1S9K E;  2N1T C;  3P32 A;  2KRE A;  2ECG A;  2KIZ A;  3DPL R;  3V43 A;  1CSB A;  3V2R A;  1IO4 A;  2PUY A;  4R8P K;  3LIE A;  3VOP A;  4ZUX U;  1M7L A;  1LDK C;  3HTK C;  4N6J A;  1QL2 A;  2POH A;  3N7N A;  2NPS D;  4AVX A;  2WSE H;  2CSZ A;  4GT1 A;  3IHP A;  3CI9 A;  5AVW B;  3C5K A;  2Y1M A;  2MJZ A;  4YAB A;  4W7Y A;  2WT7 B;  5KLV K;  3U59 A;  2K16 A;  2MT5 A;  4LAD B;  5FEY A;  1CHC A;  3SWY A;  5KJ7 C;  1ZV8 A;  3V2P A;  2XZR A;  1SFC D;  1E5W A;  2XV5 A;  2YNY A;  3M62 A;  5CHX A;  1NOH A;  2WWW A;  4B86 C;  4WA6 A;  5LKZ A;  1VD4 A;  2YKO A;  4LLB A;  1JY2 O;  3N9N A;  1NU1 K;  4V3K C;  2EA6 A;  2YT5 A;  4LJN A;  2KP8 A;  3L35 A;  5B77 A;  4I7B A;  1WIL A;  2H0D B;  2L5U A;  3II6 A;  1IYM A;  1HTL C;  3N9L A;  5B76 A;  1SVF A;  3KQG A;  3EB6 A;  3C6W A;  3KV5 A;  1GZL A;  2YSM A;  1N7S A;  1NKN A;  1IFI A;  5AVY B;  2HOD A;  2LDR A;  3T6R A;  1GU4 A;  2I50 A;  5D1K B;  4GNF A;  4M3L A;  1FZA A;  3KPE A;  1ZBD B;  1DH3 A;  1GW3 A;  1N86 A;  2HYE D;  2KGG A;  1URQ B;  4C7N B;  1Z60 A;  2KU3 A;  4WZ3 B;  3PHD A;  1KIL D;  2HPC B;  2CKL B;  5D1M B;  1HGV A;  2N1T D;  5AW4 B;  1J1E B;  1KIL A;  3E1I A;  2L5G B;  2N1T A;  4W4U A;  2C0W A;  2C9N Y;  1KFN A;  1GW4 A;  4IFF A;  5AW6 B;  2LXP C;  2QIZ A;  1AQ5 A;  1G1J A;  2QM7 A;  4RES B;  3BVH A;  2OYI B;  2NAA A;  5AW1 B;  2JJL A;  4GNE A;  5AIT A;  1IC2 A;  3V4W A;  1VDF A;  3LQH A;  1JCD A;  1LDJ B;  2LRI C;  1JNM A;  1G2C B;  3HTK A;  1CZQ A;  2VPE A;  1WE9 A;  3HE5 A;  2R3C A;  2YO3 A;  1WGM A;  2BAS A;  2XKM A;  3M0A A;  3O8Z A;  2XEU A;  5I3L A;  3TYY A;  3IR9 A;  3HD7 D;  3OJA B;  3M9H A;  1T8Z A;  5BU8 B;  3KNV A;  2C2V S;  3HD7 A;  1HVV A;  3G3Z A;  1JUN A;  1M1J A;  2K4D A;  1FZE A;  1SQQ K;  5KJ7 D;  2G43 A;  2W6B A;  1FU1 A;  1WEM A;  2VJE B;  1J1E C;  1WEU A;  1FZF A;  5AW3 B;  3WMM 0;  3L1X A;  2A45 I;  2XU6 A;  2YHN A;  2C0X A;  1LTG C;  2OYI C;  2LV9 A;  2HOD B;  2KYV A;  5APT A;  1SQX K;  1MFZ A;  1MUU A;  2C9L Y;  4N78 E;  1NKZ B;  4XA4 A;  2LGL A;  3P8C D;  3U5N A;  1T3U A;  2P1J A;  3HCT A;  1GTW A;  2MUM A;  4C46 A;  5AVR B;  3OA7 A;  3M63 A;  1IFM A;  1W2E A;  3EB5 A;  3B8E B;  1JM7 B;  3DQV R;  1WIM A;  3ZTG A;  4P5O B;  3L1Z B;  3KV6 A;  5APU A;  2FUI A;  2LGV A;  3B5N B;  2VNF A;  3M9Q A;  4A49 A;  2XDJ A;  5AVQ B;  2JMD A;  2KWJ A;  5AW7 B;  3VMZ A;  3ZPV E;  2Z4E A;  5CMZ A;  1X4J A;  5DKA A;  2FFD B;  2IDA A;  2I1K A;  5AW9 B;  1N7S C;  2J58 A;  3VYI A;  2EGP A;  4FK5 A;  3HE5 B;  1RF0 A;  4CCG X;  3LW5 H;  4A4B A;  2YU4 A;  5AVU B;  1E4U A;  2WSC H;  3CLQ A;  1Z6U A;  5APY A;  1ZR2 A;  2FKW B;  1WT6 A;  2VPG A;  4W80 A;  5FB1 A;  4WZ0 A;  4XI1 A;  2GM4 A;  2QJ0 A;  3H6P A;  5APX A;  2IFN A;  2I1J A;  4S3O B;  3SWF A;  1JO5 A;  1HUC A;  3LQJ A;  3V4Q A;  5C13 A;  2M1R A;  1KIL C;  2WIT A;  3MGN A;  5KH3 A;  4YAX A;  3O36 A;  3HE4 B;  5LCW B;  1T3J A;  5AW2 B;  1IK9 A;  2OYH B;  1URQ D;  3RTR B;  2M3B A;  1IFJ A;  3MHH A;  1URQ A;  4C7N A;  1LTA C;  1X4U A;  1NWQ A;  5B79 A;  1L4A B;  1H88 A;  2HPC A;  1WEV A;  2CKL A;  1NTK K;  2KGI A;  2P2U A;  1L0N K;  1Z56 A;  3NTN A;  4LGD E;  1X8Y A;  5AW0 B;  5LKX A;  4EOT A;  2KWN A;  2OYI A;  2ECI A;  2VPD A;  3M06 A;  2H7H A;  5G0F A;  1WEP A;  4IFD K;  4N3W A;  5B75 A;  1LTJ B;  3HD7 C;  1G2C A;  3M0D A;  3UIA A;  1M1J C;  1JOC A;  3O33 A;  1S9K D;  2E6S A;  2LXH C;  3ZVZ B;  2WPQ A;  1WEO A;  3NMD A;  2WPR A;  2YSJ A;  3ZPV 1;  3ASL A;  1XTC C;  2N9B A;  4LC1 A;  3RK2 B;  3MIW A;  4LK9 A;  4YBT A;  5KH9 A;  1ZR4 A;  1FOS F;  1G25 A;  1EQ7 A;  3L36 A;  1L4A C;  2D8S A;  3BAS A;  2KWO A;  3MUD A;  4I7C A;  3PUR A;  2VJE A;  3U1C A;  3EFG A;  3M9B A;  5AVZ B;  2O1J A;  3R2P A;  1N7S D;  4N3Y B;  2MD7 B;  4ZQL A;  5EYA F;  2KR4 A;  3I5C A;  3TK1 A;  3HUS B;  2JMJ A;  5JG6 A;  1A02 F;  2LGG A;  5CCH C;  2L0B A;  3QZV A;  5H1V A;  2KSJ A;  2G6Q A;  1G1I A;  5AVV B;  1IFN A;  3OAK A;  5TBN A;  1FBM A;  4X3G A;  2P67 A;  1LTT C;  3T97 A;  1X79 B;  3RK2 C;  1JM7 A;  3P8M C;  1IJD B;  4UI9 B;  1GK4 A;  1RF0 C;  3B5N D;  3H32 A;  4R2Y A;  1H89 A;  3B5N A;  1NTM K;  3MTU E;  4IFM A;  2G45 A;  3VTP C;  3A5T A;  3CL3 D;  3HRN A;  3HCS A;  3O37 A;  4YBM A;  3C9I A;  1F62 A;  2FFD A;  2QM8 A;  2R32 A;  1RF1 B;  1HJB A;  1MV8 A;  2QIC A;  4BBQ A;  1JY3 O;  3L4F A;  3MD0 A;  2Z5H A;  2DX8 A;  5TDR A;  3T7L A;  2W27 A;  2PP6 A;  3GV4 A;  4V3L C;  3HCU A;  2FSA A;  2LKM A;  2FUU A;  1DEB A;  1URQ C;  2CPS A;  5H1T A;  2ZFC A;  1AFO A;  4FIP A;  1GU5 A;  1WEE A;  2IFM A;  2VJF B;  3VMX A;  2NPS B;  3TSI A;  4Y99 B;  1SLQ A;  2KLV A;  2EOD A;  2VP7 A;  1H8A A;  3A2A A;  3HE4 A;  5H1U A;  2JEE A;  1KFM A;  2OYH A;  2XB1 A;  1HWT C;  3RK3 B;  2Q7C A;  5BVZ A;  1L4A D;  3GL6 A;  1SQP K;  5AVT B;  1Z2Q A;  1L4A A;  3M0D C;  3P8C E;  4PPE A;  1J1D B;  5AW8 B;  4AYC B;  2ECJ A;  1JY2 N;  3O35 A;  3MHS A;  5H9M A;  3RL0 B;  3VN0 A;  2YUC A;  4GND A;  1MM2 A;  2WTY A;  3SOU A;  4R7E A;  4AUQ B;  3BRV B;  4DOJ A;  5CCH D;  4QF2 A;  5CCH A;  1LTJ A;  3H32 B;  1FP0 A;  2VRS A;  2KE1 A;  4UP0 A;  2Y43 A;  1LWU B;  2OAR A;  1RY3 A;  4YC9 A;  1HYI A;  5G05 B;  1N73 B;  3O70 A;  1KZU B;  4Y99 C;  2H8P D;  3RK2 D;  3VK6 A;  1GL2 B;  1FZC B;  4MSX A;  3BAT A;  3N9Q A;  2KYU A;  2A45 G;  4HYT B;  2K1J A;  1LT9 B;  4IC2 A;  1JY2 P;  2Y1N A;  4ZKP A;  4I2L C;  1N2D C;  4EIJ A;  2UZG A;  4GKG A;  1HGZ A;  2Q3I A;  3RL0 C;  4LKA A;  1ZN5 A;  2HDP A;  2YUR A;  2JRJ A;  2L80 A;  4FJC A;  1IFD A;  1T1H A;  2ECT A;  3HUS A;  1CI6 B;  1SQV K;  4WY4 A;  5KTB A;  2E6R A;  4B7Y C;  2F6J A;  3B5N C;  2K17 A;  2MIQ A;  4A0C D;  3TNU A;  1OXZ A;  2IPP A;  2BAY A;  2F42 A;  1GL2 C;  2WPS A;  2PNX A;  2FFD C;  1SQB K;  2KB7 P;  1RE4 A;  4JF7 A;  3NXS A;  1DVP A;  4AQR D;  2CSY A;  2F6N A;  4O9B A;  1U6G B;  1FJP A;  1V87 A;  1FAV A;  2YQM A;  1GD2 E;  1RF1 A;  1VYX A;  3V2Q A;  4S3O C;  2J59 M;  3GHG A;  5TAB A;  2GUS A;  2YMY A;  3U5P A;  4KHX A;  2LQ6 A;  3N9M A;  1JY3 P;  2KWK A;  4WBA A;  1CW5 A;  5TRB A;  3ZNI A;  2OYH C;  2C2L A;  5TDW A;  4WZ2 A;  2ECN A;  2FYZ A;  2H43 A;  4ZDT A;  1JTH B;  2VJF A;  2P7J A;  1NTZ K;  1XTG B;  2NPS A;  5CJ0 A;  1RE3 A;  1HBW A;  2W6A A;  1L0L K;  4DZO A;  1WFK A;  2MNZ A;  3NG2 A;  3RK3 D;  5APS A;  1HH0 A;  5KH7 A;  3U1A A;  1J2J B;  2YHO A;  1YYC A;  2JMI A;  2LN0 A;  4WY4 B;  3LQI A;  1LTJ C;  4AYC A;  1MM3 A;  3RL0 D;  1SFC A;  1YTZ T;  5C11 A;  1NAF A;  3TNU B;  1BOR A;  3M91 A;  4C7R A;  3ZYQ A;  3N9O A;  1NH4 A;  2HFE D;  3L37 A;  3SOW A;  4TKP B;  1N7L A;  3V2N A;  2MA6 A;  2RSD A;  3KYQ A;  1LTS C;  2WZ7 A;  1FJK A;  1T2K C;  3LRQ A;  4UP5 A;  3IFM A;  1LWU A;  5D1L B;  2OXQ C;  4I6M C;  4IC3 A;  1N73 A;  1GL2 D;  1OWA A;  1GL2 A;  1FZC A;  5CCG D;  2LGK A;  5CCG A;  5G04 B;  2ECW A;  4L58 A;  2HLO A;  4AUW A;  3GHG B;  3O34 A;  1LT9 A;  3HUS C;  5AVS B;  4WY4 C;  2O01 H;  2E42 A;  2YW8 A;  1WEQ A;  2GUV A;  2PAJ A;  4JYC A;  2YQL A;  4FO9 A;  4OH8 B;  5B8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...