4AYCA

Rnf8 ring domain structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
136
structure length
136
Chain Sequence
b'LGSMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 48
structure length 136
sequence length 136
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aycA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycA02
2VPDA 2BAYA 1JM7A 4LKAA 5FB1A 5APQA 1WEUA 1WIMA 2G6QA 2KIZA 5C13A 2I50A 1DVPA 5KH3A 5AVUB 1WILA 2EGPA 2XU6A 3OAKA 2L0BA 5APXA 3HTKC 5LKTA 4F52B 4JYBA 1WFKA 3ZTGA 1IO4A 2LGLA 4YBTA 2M1RA 5AVSB 3O33A 5AVQB 2CKLA 4NN2A 4FO9A 4YATA 4GNFA 3M0DA 3PHDA 2LV9A 5AVVB 2YHOA 5FB0A 3O8ZA 2C2VS 2L43A 3M9HA 2K16A 4X3GA 2YQLA 3NXSA 2KWOA 2Z5HA 2EA6A 3KDPB 1GU4A 3N9QA 1JM7B 3ZYQA 2E6RA 1GK6A 3LIEA 5APTA 3V4QA 1RMDA 1MM3A 1GD2E 2ECIA 2G43A 3LRQA 1SP4A 4UP5A 2YNYA 1WEWA 2FUIA 2KGGA 1HBWA 3IHPA 2Z5IA 2WT7A 5DINA 3SOUA 2VPGA 5H1VA 4B86C 1CSBA 4C46A 3V5BA 2R5BA 4HYTB 2KGIA 2JMJA 3TYYA 3LQHA 2YU4A 2VJEB 5AW9B 1WEEA 5AVZB 5TBNA 2UZGA 3HTKA 3IR9A 3SWFA 1A02F 4WZ3B 1CI6A 2RSDA 3PURA 2W6AA 4YAXA 2CT2A 2N9BA 3P32A 2YSJA 1WEMA 5AW5B 1T1HA 3HCUA 3A5TA 2ECJA 3VTPC 2L75A 2CSYA 1BORA 1X4UA 3O36A 2H7HA 4YABA 4YADA 2VNFA 2MUMA 1H88A 3KV5A 1WESA 5H9MA 5AVTB 3HCSA 3KV6A 3SOXA 5LCWB 4CA1A 2LQ6A 3MGNA 2ECNA 4IC2A 2PUYA 2LXHC 3C6WA 2P67A 1H8AA 2FUUA 2YT5A 5CMZA 1MV8A 1FOSF 4AYCB 2E6SA 3GV4A 4CCGX 4B86A 3DPLR 4R8PK 1HWTC 5AITA 2MT5A 4WZ2A 4GNDA 2QM7A 3RTRB 5TDWA 4PTBA 2LGVA 4N4FA 5AVYB 1Z60A 1NWQA 2Y1NA 4I2LC 2ZETC 4S3OB 3HE4A 4C9ZA 1CHCA 5AW6B 2ECGA 2LN0A 2HDPA 3O7AA 2KREA 3VMZA 3A7OA 5EYAF 4XI1A 3VN0A 2C9NY 2QM8A 5B79A 3MHSA 4L7XA 3M0AA 4BHWA 1HJBA 2VJFB 5G05B 4AUQB 2VPEA 2LGGA 3SOWA 2YO2A 1G2CB 3U5NA 2KR4A 1K2FA 3L11A 2VJEA 4S3OC 1G25A 3NTNA 2F42A 3MD0A 1LDKC 1X4IA 3N9OA 2ECTA 2JRJA 3L1XA 1N87A 3MHHA 5APVA 3M63A 3LQJA 3HE4B 5LKUA 2WTYA 3RPGC 4V3LC 2MD7B 3ZPV1 2QICA 2K4DA 4FK5A 4N3WA 3U5OA 4A4CA 3O35A 2WPRA 1JNMA 4ZQLA 4UP0A 2W27A 3TNUB 2JJLA 4B7YC 4RESB 3SHBA 2KU3A 4YC9A 3TK1A 3M99A 2WPQA 2R32A 3M06A 2MA5A 1J2JB 5AVXB 3N9MA 2LRIC 2JMIA 3V4WA 4WA6A 2KYUA 4AYCA 2R3CA 1LDJB 3KQGA 4MVTA 4EOTA 1A02J 2XZRA 1MFZA 5G0FA 4A0CD 4BBQA 2KWKA 1XWHA 2OXQC 2ECVA 4A49A 2M85A 5APWA 2M3HA 2IPPA 5AW7B 4PPEA 1GU5A 5H1UA 4V3KC 3T97A 1FP0A 3L35A 4R2YA 4MSXA 2ZXEB 4UI9B 4TKPB 5JG6A 2P2UA 3L36A 2K1JA 1X4JA 4W4UA 2CSZA 4GB0A 2L5UA 1MM2A 1JOCA 1CZQA 1E4UA 1FBVA 2AN6A 4M3LA 2VJFA 5FERA 2LGKA 1WGMA 2KWNA 5I3LA 3L37A 3U5MA 4WZ0A 1OWAA 1WEOA 5APUA 3N9LA 3QZVA 4GNEA 1HUCA 4I6MC 1SLQA 4P5OB 2E43A 5AVWB 2MD8C 2EODA 1T2KD 4Q6FA 2MNZA 2C9LY 5TDRA 4DZOA 1GK4A 2HYED 3M9BA 2YURA 5AW4B 5LKXA 2H0DA 3N9NA 1S9KE 1Z6UA 2QJ0A 3L1ZB 5TABA 2PNXA 4XE5B 3EB5A 4ZUXU 2ZFCA 4LK9A 3UIAA 2MNYA 3HE5B 1JUNA 3RPGB 2VRSA 2XB1A 5AVRB 5B78A 2C2LA 3KQIA 2YREA 3TNUA 5AW8B 4R7EA 4YBSA 2LXPC 3FL2A 4GKGA 1GTWA 1WEPA 1T2KC 4GT1A 2WWWA 2KWJA 5B77A 2JMDA 3NMDA 4I7DA 5B75A 5C11A 1FOSE 3I2DA 1VFYA 3ZVYA 2H0DB 5D1LB 2Q3IA 1X8YA 4I7BA 2Q7CA 2K17A 5AIUA 2F6NA 5D1MB 2WPSA 5G04B 4AQRD 3I5CA 2XEUA 4IC3A 3NFQA 2L80A 3VMXA 2D8SA 2E42A 1Z2QA 1HYJA 3ZPVE 3VK6A 2R5DA 1WE9A 4QF3A 2QIZA 3T7LA 1WEVA 5H1TA 2YSMA 2VPBA 4YBMA 3P7KA 4I7CA 2YUCA 3A2AA 2YW8A 4FJCA 1U6GB 1MUUA 1FAVA 5LKZA 2G45A 2LDRA 1VD4A 3M62A 1KQLA 2FSAA 2Q5UA 1S9KD 2CKLB 3VMYA 1IYMA 3O34A 5AW2B 2IDAA 3DQVR 3N9PA 1WENA 3KNVA 3ZNIA 4FIPA 2ECWA 5AW1B 1F62A 2BASA 4L58A 4LLBA 1NAFA 5B76A 4QF2A 2VP7A 3O37A 4LADB 2YQMA 4C7NA 2RI7A 5TRBA 5KH9A 2F6JA 1GZLA 3P8MC 3EB6A 1H89A 3O70A 4AP4A 4AVXA 4GNGA 1ZBDB 5KH7A 3HE5A 3LQIA 3ASLA 2XV5A 4KHXA 3ZVZB 2YHNA 1HYIA 5APYA 4LJNA 3VYIA 2KP8A 2YO3A 3B8EB 2DX8A 4ZDTA 3PUQA 3LIDA 2WT7B 1DH3A 2Y1MA 4O64A 5D1KB 2YYRA 4A4BA 3T6RA 2Y43A 3C5KA 3V43A 3U5PA 4LC1A 1V87A 4JYCA 2MIQA 2NAAA 2P7JA 1YYCA 2M6MA 4C7NB 4AUWA 1VYXA 3M91A 1WEQA 1OXZA 1CI6B 3A3YB 5FEYA 5J3XA 5APSA 2KE1A 3HCTA 5DKAA 3NG2A 5AW0B 2MA6A 5AW3B 5B8DA 3GL6A 2KFTA
chains in the Genus database with same CATH superfamily
2IZ0A 1NKZB 2VPDA 2E5YA 5FB1A 1JEKA 1WEUA 4H44D 4R4LA 3CCRP 1N86A 1DVPA 1SFCA 1WILA 3CX5H 3OAKA 1PP9J 2L0BA 3HTKC 1IZNB 4JYBA 3ZTGA 5AVSB 4NN2A 4FO9A 4GNFA 5SVIB 1NH4A 1QLED 2YHOA 1L2PA 4IL6E 1RE4A 2BCCJ 2Z5HA 3KYQA 4QQ4A 1IFMA 1U7JA 1PP9G 3U59A 3BATA 3H1ID 2IQJA 2PRRA 1GK6A 2YKQA 2JUNA 2POHA 2KYVA 3H1LD 1PPJG 3V4QA 1PP9E 2ECIA 1GD2E 4KJMA 2BCCG 4UP5A 2WQYC 1WEWA 2FUIA 1DEBA 2WT7A 2D2CC 5H1VA 2FBWC 3V6IA 1FZFA 5B5EE 1PPJE 2BCCE 3TYYA 5AVZB 4WY4C 3PTZA 1KYOD 2KKXA 1YJ9P 2K1AA 2UZGA 1OW7A 1R5SA 3SWFA 4WZ3B 2E61A 5E79E 3PURA 1IFJA 2W6AA 2RH0A 3OA7A 1KB9D 2QJKC 1GW3A 2B89A 3VTPC 1HTLC 3GHGC 1BORA 3O6QB 2QIWA 2OYHA 1FZCB 4YADA 1H88A 1VQOP 5H9MA 3MUDA 1P84E 3HCSA 3KV6A 3A0BE 3I55P 3L75D 1FZAA 3EQ2A 2CPSA 1SQQJ 2ECNA 1L0LJ 2LXHC 1ZMEC 1AQTA 1KILB 3VP9A 1MV8A 4AYCB 2CSVA 4R8PK 5KLVK 2A45I 2OQQA 4WZ2A 1LTSC 3CX5D 4IFDK 2QJPB 1NWQA 1URQA 1AQ5A 1SQQG 1NTKK 1NU1J 2J5UA 1L0LG 1CHCA 4C7RA 2ECGA 3AE8C 3D6YA 4OGQC 5B79A 1MFTA 3SFEC 4L75A 1SQQE 1L0LE 1NU1G 2YO2A 1RH5B 2GUVA 2KR4A 1LTBC 2RMZA 1SQBK 1K2FA 2F42A 3MD0A 1S4XA 5KKZC 2M0BA 1LDKC 1X4IA 3L1XA 1N87A 1NU1E 1BDCA 2FYUK 3HE4B 3GW6A 2QA4P 2WTYA 1BCCJ 3TF5A 1LTJB 1Q7YQ 2OYIB 4BRYB 3O35A 2WPRA 2K88A 1DD4A 3M99A 1BCCG 2R32A 4D6TD 3BRTB 2MA5A 2FXMA 5KAFH 1PGPA 3HD7B 2JMIA 2RN0A 4WA6A 1KILA 3JCUH 2KYUA 2L7PA 4AYCA 1BCCE 1LDJB 5KAIH 1GL2A 4GIFA 3Q5SA 5G0FA 4A0CD 1XWHA 2HLOA 2IPPA 5AW7B 1GU5A 3T97A 3L35A 1LT9C 1NOHA 2G3AA 1VF5C 3CXHE 5JG6A 2R44A 1WMKA 2W8ZA 1EZVD 3BVHA 3PHLA 2ZT9D 1KMIZ 1L4AC 3E7KA 1WEOA 5APUA 1KD1Q 1RE4C 1K04A 1HUCA 4I6MC 1M57D 1M1JC 2EODA 4Q6FA 2C9LY 3H32B 4KT0J 5LKXA 3KPEA 1S9KE 2WSEJ 2JP3A 1LTJA 3S4RA 4NPDA 4LK9A 4BRYA 4Z0OA 4UB8H 5AVRB 4PD4H 3AECC 1S72P 1N7SC 2WSCH 3FL2A 3H1KD 3RL0D 2M8RA 1E5WA 4L76A 1T2KC 2FYZA 2KWJA 3NMDA 1KTMA 4HJGH 4PD4I 3U1AA 5DJTB 2H0DB 1X8YA 1S2EA 2K17A 4YPCA 2YKOA 1NJIQ 2ZYAA 4IC3A 3NFQA 1SVFA 2L80A 1HGZA 2QE7H 2OTKE 2KZIA 2IZ1A 5CCGD 1ZP0C 1JCCA 1WEVA 3H7HA 2YSMA 2E76D 2VPBA 1OX3A 4H13D 1RF1A 4I7CA 2YW8A 4K3AA 3K5BA 1U6GB 3T9KA 1MUUA 3M62A 1JO5A 2Q5UA 2CKLB 1IFNA 2KK7A 1SQXD 4ASVA 3O34A 3N9PA 3CI9A 1OIPA 1VL2A 1F62A 2E74D 1BE3E 1YTZI 1RY3A 2M13A 1KZUB 4C7NA 2RI7A 2F6JA 3DWDA 1GZLA 3MIWA 1H89A 3O70A 3R4YA 3LQIA 3ZVZB 2YHNA 5APYA 5EFWB 2SPZA 3PUQA 1YBKA 1SQVD 2Y1MA 4O64A 5CBNA 5KLVJ 2FFDB 1VDFA 4A4BA 1YITP 2WVRA 2OARA 2Y43A 3CMEP 4PD4D 2LKMA 1NVOA 3LW5J 3PP5A 3AE2C 2MIQA 2NAAA 4I1LA 1NYHA 4WVZA 1WEQA 3KXDA 2ZYDA 1CI6B 5J3XA 4Y99B 4IL6H 5APSA 4IL6X 5DKAA 5AW0B 5AW3B 1NTME 1VQ5P 3QH9A 1OVRA 3V2RA 1FZCC 1WT6A 3L73J 2BAYA 3C8VA 1FZBA 1AVOA 1WIMA 3L70E 1HGVA 2G6QA 1SQBJ 5C13A 2I50A 5AVUB 2XU6A 5LKTA 2LGLA 4YBTA 3O33A 2CKLA 2FYUJ 3L73G 3BCCD 5AVVB 3EWKA 2D2CD 2C2VS 2L43A 3RBXA 1HH0A 5B5EH 4X3GA 1SQBG 1S1CX 2QJPC 2KWOA 3KDPB 1BGYJ 1VQ7P 3L73E 4ZKPA 4WY4D 1OVUA 2M3EA 2FYUG 2E6RA 1SQBE 1IK9A 5E79H 3GG2A 1J1EB 5APTA 1LNQA 4N78E 1SFCB 1MM3A 2G43A 2KB7P 2NPSC 2KGGA 1BGYG 2ZJSE 5CCHA 1SQPK 2FYUE 1ZR4A 5DINA 3PH0A 4B86C 1CSBA 4N3YB 2R5BA 5CJ4A 2UWJE 1EDJA 4TT3H 3LQHA 5BU5A 1BGYE 3CL3D 3G3ZA 3HUSA 2VJEB 1M7LA 1P84H 2HPCB 3A0BH 2IBZI 2FFWA 2JEEA 2WPVB 1CI6A 2PGDA 1JY2P 2RSDA 2OYIC 4EIJA 4YAXA 2PAJA 3HCUA 3A5TA 1P84I 4BXLA 1X4UA 2H7HA 2XP0A 3KV5A 1WESA 3FGAD 3P8CE 3HD7C 4OGQD 1PGOA 3AEEC 4CA1A 2W90A 3MGNA 1L0NK 2EGMA 2I8DA 1G2CA 3C6WA 2FUUA 3O47A 5CMZA 3VOPA 3DPLR 3EFFK 3RK2B 1PP9D 2QM7A 2A06G 5TDWA 4N4FA 5AVYB 1Z60A 1G1IA 2ZETC 4S3OB 2XOYA 5AW6B 1KN7A 4H0LB 1OMIA 2KREA 2KSEA 2OYHB 1HF9A 2M5AA 4XI1A 3DDTA 1PPJD 2A06E 3Q1MA 2BCCD 3IAOA 1ZXGA 2VJFB 2YKPA 5G05B 2VPEA 3M7KA 1M8OB 2M3BA 4DJGA 2G8YA 5M1BA 1YIJP 5TISE 1FBMA 2VJEA 1G25A 2HPCA 3TGUJ 2YVRA 2W6BA 3ITKA 2H88C 3L74J 4BWNA 3M63A 1URQB 2IYOA 3LQJA 1Y47A 4OVNF 1HVVA 1QX8A 1JTHA 2MD7B 1IFDA 3ZPV1 2K37A 1PV3A 2LXCB 1P84D 3TGUG 3BRVB 4FK5A 2CPBA 3U5OA 2XOZA 3CC7P 2P1JA 1PIXA 3L74G 2LAUA 1Q86Q 3TNUB 1T6AA 4YC9A 3CXHH 1VF5D 2WPQA 3PLWA 3M06A 5GTIE 1OZHA 3L74E 2V7QJ 5AVXB 3SWKA 2IBZG 3H1IJ 1QVGO 3D6ZA 3B4SA 1L4AD 3CXHI 4MVTA 1LTIC 3G6EP 2JKVA 3H1LJ 4EOTA 1XTCC 1MKMA 2IBZE 2KWKA 2ECVA 3MDBC 1SQQD 5APWA 2KSJA 2M3HA 1L0LD 4V3KC 1Y9BA 1RF0A 3H1IG 3II6A 4TKPB 3L36A 1UIXA 2WSFJ 1X4JA 2CSZA 4GB0A 3M9QA 2A45H 1RQVA 2KIKA 1CW5A 1RE3A 3VMAA 3AEDC 1FBVA 3H1LG 4M3LA 2VJFA 5FERA 1NTZK 1R8EA 1WGMA 2ZT9B 3L37A 1NU1D 3U5MA 1N7SD 3S9OA 3E2DA 4R4MA 2Q1KA 4GNEA 4RJTA 1VQKP 4P5OB 1GL2B 2IX7C 5AVWB 3Q2YA 4RKUJ 2MD8C 1T2KD 5TDRA 1GK4A 1X79B 1LWUC 5B66E 2QJ0A 5TABA 3T97B 4ZUXU 1VQ4P 2DJAA 3U1CA 5CCHC 3UIAA 2MNYA 3HE5B 3RPGB 2VRSA 3N4XA 5B78A 2WZ7A 2FFDC 1YJNP 2JWAA 3CCEP 2C2LA 5KJ7C 3KQIA 4EDFA 3TNUA 2I1KA 4R7EA 4F1PA 3KHUA 1GTWA 1BCCD 1WEPA 1EXJA 2WWWA 3SSUA 2JMDA 1LP1A 3RL0B 1Q2NA 1N7LA 2R3SA 4Y99C 2AXTE 4I7BA 2FKWB 1FU1A 1QL1A 2AEMA 5H2FE 5D1MB 4XFJA 3CXHD 2WPSA 2YMKA 2XEUA 2OGUA 3JSVC 2D8SA 1Z2QA 1SQPJ 1FC2C 4OWFA 2QJYB 3RL0g 2Q6QA 3S1KA 4QF3A 3G9RA 2QIZA 3T7LA 1H0TB 1ZOYC 1GMJA 3H1HJ 2HFED 3G71P 1LJ2A 2NZ2A 1FAVA 2O1JA 1SQPG 1KQLA 3FXDA 1S9KD 1R5LA 3DQVR 3CLQA 1ZRTD 3H1HG 2ECWA 5AW1B 1FE6A 2KLVA 2BASA 1QVFO 1SQPE 3FM8C 1NAFA 2W83C 2XNXA 3CCLP 2DSMA 2VP7A 1K05A 1U57A 4PJ0E 1J1EC 5TRBA 1W5CE 1EDIA 1LT1A 2J58A 1SFCC 3P8MC 3EB6A 2O1KA 3H1HE 2OYOA 3GF3A 3F89A 4AP4A 3QWOC 5KH7A 2QVAA 3HE5A 1RF1B 3H1JJ 4XA4A 2CONA 4KHXA 1L0NJ 3VYIA 2KP8A 1T3UA 2L5GB 3AE9C 3RK3B 1DH3A 2IDBA 1J1DB 3CC2P 3H1JG 3C5KA 4LC1A 1L0NG 2N1TD 4JYCA 1YYCA 4C7NB 3A3YB 3WU2E 1N2DC 2B88A 2MA6A 3H1JE 4PV1B 1L0NE 5B8DA 4A49A 3PJSK 1JY3P 2XDJA 1JM7A 1H0TA 1DCQA 2KNCB 5CCGA 1WRGA 1OW6A 4K35A 1N73A 5CHXA 5KH3A 1EQ7A 1VQMP 2EGPA 5APXA 4F52B 3GF7A 3TDKA 1BE3D 3I56P 2NPSD 3RK2C 3M0DA 3PHDA 3O8ZA 2O01J 3A0HE 3IN6A 2K16A 1BSNA 3FANA 3FX0A 2Q9IA 2EA6A 2V4HA 1GU4A 4H0LC 1JY2N 1KILE 2OYHC 3MUDC 4WY4B 2XKMA 5KTBA 1QL2A 1LTGC 1S3JA 3SFDC 2LR2A 2Y0DA 3CC4P 1SP4A 1PL5A 4GODA 3RGUA 1PZQA 3E1IA 3IHPA 3D70A 3BASA 3L4FA 2O01N 4C46A 4DCKA 4L73A 2E75B 3AEGC 1NTMD 1URQC 3HD7D 5AW9B 3HTKA 1Y8AA 3IR9A 1A02F 2QEXP 2Y9YA 3V2QA 1DIPA 2Y0CA 3L70D 2CT2A 2N9BA 3P32A 3F5HA 1WEMA 5AW5B 2QRXA 1NTZJ 4YXDC 2CSYA 2KNCA 1S5LE 1OVVA 4MN4C 2AEJA 4YABA 3L71J 1FJPA 2WITA 4ASWA 4O9BA 2FYNB 1XTGB 2H43A 5AVTB 2RR4A 2YIUB 3HUSB 4OGQB 1NTKJ 1NTZG 2LQ6A 3L73D 4OGEA 2HYNA 3B5NB 4OH8B 1H8AA 4ZKUA 2YT5A 1SQBD 1FOSF 2E6SA 2Z4EA 3GV4A 5KLVG 3L71G 2P57A 1VQ6P 5TISH 1NTZE 4N78D 2LGVA 1JMBA 2Y1NA 1NTKG 1RHZB 2FYUD 4C9ZA 2ITAA 4WY4A 5KLVE 3L71E 2HDPA 3VMZA 4L74A 3A7OA 4H44B 4NPFX 3MHSA 1NKNA 4L7XA 1HJBA 1BGYD 2I1JA 1KILC 1NTKE 1T8ZA 2JWDA 4LLHA 1GL2C 2KZJA 2LGGA 1Q82Q 3SOWA 3OW2O 3GHGA 1G2CB 1X22A 2JO1A 1G1JA 2N9YB 2P58A 3RK3E 5GTIH 4JPZB 3N9OA 2C0WA 3KZIE 2JRJA 2GA1A 3MHHA 5APVA 1M56D 3GMAA 5LKUA 3USSA 3AE4C 3RPGC 4V3LC 2M5AB 1VPCA 1AJYA 3P8CD 3CWBJ 1NHLA 2K4DA 4A4CA 2GUSA 2EXUA 4UP0A 3BCCJ 4RESB 3SHBA 2KU3A 3MHVA 3SWYA 3L72D 4O62A 2K9JB 5SVYA 3CWBG 1VF5B 2V7QH 1LTJC 4U7JA 3V4WA 3B5NA 3PLNA 2OTJP 3BCCG 3G4SP 2OWAA 5SVXA 3KQGA 2QJYC 3FEHA 3CWBE 2A06D 1JTHB 4BBQA 2XZRA 2W6JH 2OXQC 4UB6E 1E79H 5DJUB 4HB1A 2M85A 5CCGC 1DD3A 1DEEG 3V2PA 1PFIA 2B9BA 1M1JB 5B66H 1VQNP 1FP0A 4R2YA 1IC2A 1USDA 4MSXA 2ZXEB 1KV4A 2L91A 2WSFH 1FDMA 2YMYA 1MM2A 2L5UA 1JOCA 2AN6A 1X0TA 2YXRB 3VP8A 3B71A 3Q1DA 5I3LA 1IFIA 5KJ7D 3N9LA 4U3FJ 1K73Q 3CCMP 4IFMA 1AA0A 1SLQA 2E43A 2Y0EA 5GTHE 1BSHA 4DZOA 3EFGA 2HR3A 3M9BA 1KYOI 1Z6UA 3L1ZB 4I7ZB 1RF1C 2AXTH 3E1RA 2PNXA 1IK7A 2B87B 4XE5B 3EB5A 4U3FG 5H2FH 4ZNCA 1M90Q 1Q90D 3RK3C 1OW8A 1JUNA 2XB1A 3CPWO 1JCDA 3L74D 2MKEA 2YREA 1J1DC 1N8RQ 1PGQA 3MTUE 1U7MA 4U3FE 1W2BO 3LVQE 4GKGA 1LT9A 4GT1A 5B77A 2K9JA 5B75A 2IFMA 3KDEC 2IBZD 3I2DA 1EXIA 3ZVYA 1OFCX 2Q3IA 4PV1C 5AIUA 1L4AA 3JUEA 5G04B 3AE1C 4WWIA 3CX5I 1FZGA 1HYJA 1M1JA 2NRGA 3AEFC 4Z1MH 5K5GB 2R5DA 4PJ0H 4GOEA 2MKVA 5H1TA 1TU3F 3CCUP 1SFCD 3P7KA 3TGUE 1PGJA 1QEXA 1LP1B 4FJCA 3CD6P 5LKZA 2G45A 3WMM0 3VMYA 4OGCA 1N7SA 2IDAA 3WUVA 3KNVA 3FWLA 1FDOA 1T3JA 4L58A 4LLBA 3CCJP 4QF2A 3O37A 2O3JA 3H25A 1LGHB 2YQMA 2B87A 4YTPC 2IFNA 1KQSO 1VQ9P 4AVXA 3WU2H 4GNGA 1ZN5A 2CRRA 1JY3N 2HODA 3ASLA 1HYIA 4H9DA 4LJNA 3AE7C 3H1IE 5C39A 2E75C 2DX8A 4ZDTA 3LIDA 2H8PD 5BVZA 5D1KB 1SQXK 3ZDMA 3H1LE 2WSSH 2BEZF 4NPEA 2YXQB 3OJAB 3CCQP 2QSIA 3JC22 1NTMK 3V43A 3U5PA 5SVIA 2WSEH 2P7JA 2M6MA 4AUWA 1VYXA 2N1TB 1OXZA 1BDDA 3RK2D 5FEYA 2KE1A 3HCTA 1JY2O 3A0HH 5KLIB 1NAYA 3RBZA 3MZWB 2IYPA 3W68A 1YTZT 3L75J 1KYOE 3GL6A 1SS1A 2KFTA 2FYNC 4H0LD 3R2PA 4LKAA 5APQA 3LDYA 4JQ0D 2KIZA 1KB9E 4GDOA 2YIUC 3HUSC 1SQVK 3IF4A 2ZVOB 1EZVI 1LTAC 3B5NC 1SQPD 1WFKA 1IO4A 3L75G 2M1RA 5AVQB 4YATA 2LV9A 5FB0A 2NPSB 3M9HA 2O01H 3H1HD 2YQLA 2FY8A 4A7PA 4WB4A 3NXSA 3L75E 3Q5PA 3N9QA 1URQD 2CRWA 4H44C 3IFMA 1JM7B 3ZYQA 1NO4A 1MBMA 1Q81Q 3LIEA 4EYYQ 3CX5E 2E76B 2PFXA 1N73B 4H13B 1RMDA 3LRQA 2YNYA 1FZEA 1HBWA 3O6QA 2Z5IA 1KC8Q 3SOUA 2VPGA 1FZCA 2DW3A 1S5LH 3V5BA 1S5LX 4HYTB 2KGIA 3Q5RA 1AFOA 2JMJA 2CK3H 2KOGA 2MJZA 2ZYGA 3H1JD 2YU4A 5TJHA 2P10A 1WEEA 1L0ND 5TBNA 2E74B 2N1TA 2E5TA 2JR8A 3FJUB 2YSJA 1T1HA 4RO0A 4D6TJ 2ECJA 2L75A 3WUTA 4QMAA 3O36A 1VQ8P 4IOIH 1HJ0A 2Y9ZA 2VNFA 2C0XA 2Q3EA 2MUMA 4HKZH 1X9VA 2XNDH 3SOXA 4D6TG 5LCWB 3LW5H 1W2EA 1KILD 3PRJA 4IC2A 2PUYA 4N6JA 4JF7A 2NPSA 3HTKB 2P67A 1GL2D 4CCGX 4B86A 1RQUA 1HWTC 5AITA 2MT5A 4D6TE 3H6PA 1EDKA 2A45G 5CBOA 4GNDA 3RTRB 1AVYA 4PTBA 4I2LC 3HE4A 3KZIH 4Z0RA 1USEA 2LN0A 3O7AA 4CPGA 5EYAF 3VN0A 1ZRTE 2C9NY 2QM8A 1KQFB 2OYIA 1EC5A 1EZVG 3M0AA 4BHWA 2LXBA 4WBAA 1KORA 4Y28J 4AUQB 1Z56A 3U5NA 1MZ9A 1EZVE 3L11A 4DOJA 2D2CB 4S3OC 3NTNA 4I7ZC 1KFMA 3HD7A 3Q3DA 1RF0C 1D7MA 2ECTA 3H1KJ 1RE3C 1JB0J 2D8UA 4LGDE 3CCSP 2QICA 4N3WA 2KKYA 1BE3J 4W80A 4UB6H 1NGMB 1JNMA 4ZQLA 2QJKB 2ZVNB 2W27A 2B0OE 3FXEA 2PP6A 2JJLA 4B7YC 3GHGB 3H1KG 3TK1A 1VQLP 4YXWH 2OTLP 1FDIA 1J2JB 1NTZD 5K3QA 4W7YA 3N9MA 1YQ3C 2KS1B 2LRIC 1BE3G 3H1KE 3D71A 2R3CA 5KLVD 3L71D 4EI2A 3AE3C 5GTHH 2FXPA 1A02J 1MFZA 3H32A 1JM0A 3HRNA 1NTKD 4PPEA 5H1UA 1ZV8A 1KQGB 1ZLLA 1YI2P 1SQXJ 2K9YA 1LWUB 3FWNA 4UI9B 2P2UA 2K1JA 4W4UA 2GM4A 1CZQA 2HG5D 1NTMJ 1E4UA 5KAFE 2AXCA 3RK3D 2XOCA 2LGKA 3JCUE 3C9IA 2KWNA 2RKLA 4WZ0A 1OWAA 1VQPP 2QG4A 5KAIE 2ZAEB 3QZVA 1LTTC 3AE5C 3L70J 1SQXG 3AE6C 1YQ4C 2MNZA 3LJUX 1ZR2A 1ZW0A 1NTMG 2HYED 2YURA 5AW4B 2H0DA 3N9NA 3ABVC 1SQQK 1IFPA 1L0LK 1SQXE 5KKZB 1SQVJ 4PV1D 1DX7A 2ZFCA 3L70G 3W67A 3AEAC 2ZT9C 2FXOA 4ZMDA 5AW8B 2WSCJ 2LXPC 4YBSA 1NU1K 1SQVG 2KI7B 4I7DA 3CWBD 5C11A 2ZXXA 2KS1A 2N1TC 1FOSE 1VFYA 1YJWP 2FD4A 5KLIC 5D1LB 4TLFA 1SQVE 2Q7CA 2K3RA 2BEQD 2F6NA 1AV1A 4JBZA 1QGKB 4AQRD 3I5CA 1KFNA 4UB8E 1EDLA 3WUUA 3VMXA 4GOFA 2E42A 4PD4E 5BU8B 3ZPVE 3VK6A 1IJDB 1WE9A 5CJ0A 1JY3O 3RL0C 3LVRE 1UIIA 1LWUA 1YHQP 4HH2A 1GDTA 4YBMA 3FAOA 2YUCA 3A2AA 1LT9B 2AEFA 2KUBA 2KLUA 5L8RJ 3V2NA 1JMMA 2LDRA 1VD4A 2FSAA 4IFFA 1IYMA 3CMAP 2WMMA 2FFDA 2E75D 5KJ7A 3CCVP 1FJKA 3GLMA 5AW2B 1WENA 3ZNIA 1L4AB 4FIPA 3C1LA 5B76A 3TSIA 4LADB 1FS0E 3BCCE 1GW4A 5KH9A 2E76C 1N73C 4H13C 4U3FD 3MP7B 1ZBDB 2JM3A 3L72J 2XV5A 5CCHD 2H89C 3M0DC 2J59M 1KYOH 1M1KQ 2KXPB 1K8AQ 2YO3A 3B8EB 4W7ZA 2WT7B 2YYRA 1N7SB 1KB9H 3AEBC 3T6RA 2E74C 3L72G 1K9MQ 1V87A 3B5ND 3SUBA 3M91A 1KB9I 2JDIH 4DT0A 3L72E 3NG2A 3TGUD 3N7NA 2HODB
chains in the Genus database with same CATH topology
2XDJA 2VPDA 1NKZB 1WT6A 2BAYA 1JM7A 3R2PA 4LKAA 5FB1A 1FZBA 5APQA 1WEUA 5CCGA 1WIMA 1HGVA 2G6QA 2KIZA 1WRGA 5C13A 3HUSC 1SQVK 2I50A 5J3XA 1N73A 1N86A 5CHXA 1SFCA 1DVPA 5KH3A 5AVUB 1EQ7A 1LTAC 1WILA 2XU6A 3OAKA 2EGPA 2L0BA 5APXA 3HTKC 5LKTA 3B5NC 4F52B 4JYBA 1WFKA 3ZTGA 1IO4A 2LGLA 4YBTA 2M1RA 5AVSB 3O33A 5AVQB 2CKLA 4NN2A 4FO9A 4YATA 2NPSD 4GNFA 3RK2C 3M0DA 1NH4A 3PHDA 2LV9A 5AVVB 2YHOA 5FB0A 3O8ZA 2C2VS 2L43A 2NPSB 3M9HA 2O01H 1HH0A 2K16A 4X3GA 2YQLA 4WB4A 1RE4A 3NXSA 2KWOA 2Z5HA 2Q9IA 2EA6A 3KDPB 3KYQA 1IFMA 1GU4A 1JY2N 2OYHC 3N9QA 1URQD 4ZKPA 3U59A 3BATA 4WY4D 3IFMA 1JM7B 3ZYQA 1NO4A 2E6RA 1GK6A 1IK9A 4WY4B 2YKQA 2XKMA 5KTBA 1QL2A 3LIEA 1LTGC 1J1EB 5APTA 2POHA 2KYVA 3V4QA 4N78E 1N73B 1RMDA 1SFCB 1GD2E 1MM3A 2ECIA 2G43A 1SP4A 3LRQA 4UP5A 2KB7P 2YNYA 1WEWA 1FZEA 2FUIA 2NPSC 1DEBA 5CCHA 3E1IA 2KGGA 1HBWA 1SQPK 3IHPA 1ZR4A 2Z5IA 2WT7A 5DINA 3BASA 3SOUA 2VPGA 5H1VA 4B86C 1FZCA 3L4FA 1FZFA 1CSBA 4N3YB 4C46A 3V5BA 2R5BA 4HYTB 2KGIA 1AFOA 5CJ4A 2JMJA 2KOGA 3TYYA 3LQHA 2MJZA 3CL3D 5BU5A 3G3ZA 3HUSA 1URQC 3HD7D 2VJEB 1M7LA 2HPCB 2YU4A 5AW9B 1WEEA 5AVZB 4WY4C 5TBNA 2UZGA 3HTKA 2JEEA 2N1TA 3IR9A 3SWFA 1A02F 1CI6A 4WZ3B 1JY2P 2RSDA 2OYIC 3V2QA 1IFJA 3PURA 2W6AA 4EIJA 4YAXA 2CT2A 3OA7A 2N9BA 3P32A 2PAJA 2YSJA 1WEMA 2KFTA 5AW5B 1GW3A 1T1HA 3HCUA 3A5TA 2ECJA 3VTPC 2L75A 1HTLC 2CSYA 3GHGC 1BORA 1X4UA 3O36A 2OYHA 2H7HA 1FZCB 4YADA 4YABA 2VNFA 2C0XA 1FJPA 2MUMA 2WITA 4O9BA 1H88A 3KV5A 1WESA 3P8CE 1XTGB 3HD7C 2H43A 5H9MA 1X9VA 3MUDA 5AVTB 3HCSA 3KV6A 3SOXA 1FZAA 3HUSB 5LCWB 3EQ2A 4CA1A 2CPSA 3LW5H 1W2EA 3MGNA 2LQ6A 1L0NK 1KILD 2ECNA 4IC2A 2PUYA 4N6JA 2LXHC 4JF7A 1G2CA 2HYNA 2NPSA 3C6WA 3HTKB 2P67A 3B5NB 4OH8B 1H8AA 2FUUA 1KILB 4ZKUA 2YT5A 1GL2D 5CMZA 3VP9A 1MV8A 1FOSF 4AYCB 2E6SA 2Z4EA 3GV4A 4B86A 3VOPA 3DPLR 4CCGX 4R8PK 5KLVK 2A45I 1HWTC 3RK2B 5AITA 2MT5A 3H6PA 4WZ2A 1LTSC 2A45G 4GNDA 4N78D 2QM7A 3RTRB 5TDWA 4PTBA 2LGVA 4N4FA 5AVYB 4IFDK 1Z60A 1NWQA 2Y1NA 1G1IA 1URQA 4I2LC 3HE4A 1NTKK 1AQ5A 2ZETC 4S3OB 4C9ZA 4WY4A 1CHCA 5AW6B 4C7RA 2ECGA 2LN0A 2HDPA 3O7AA 2KREA 3VMZA 2OYHB 3A7OA 5EYAF 4XI1A 3VN0A 2C9NY 2QM8A 5B79A 2OYIA 3MHSA 1NKNA 4L7XA 3M0AA 4BHWA 1HJBA 2I1JA 1KILC 4WBAA 1T8ZA 4LLHA 2VJFB 2YKPA 5G05B 4AUQB 1GL2C 2VPEA 2LGGA 3SOWA 2M3BA 1Z56A 3GHGA 2YO2A 1G2CB 2GUVA 3U5NA 2KR4A 1LTBC 1MZ9A 1SQBK 1K2FA 1FBMA 3L11A 4DOJA 2VJEA 4S3OC 1G25A 2HPCA 3NTNA 2W6BA 1G1JA 2F42A 3MD0A 1KFMA 3HD7A 1LDKC 1RF0C 1X4IA 3N9OA 2C0WA 2ECTA 2JRJA 3L1XA 1N87A 3MHHA 5APVA 3M63A 1URQB 3LQJA 2FYUK 3HE4B 5LKUA 2WTYA 1RE3C 1HVVA 3RPGC 1LTJB 4LGDE 4V3LC 1JTHA 1VPCA 1IFDA 2MD7B 3ZPV1 3P8CD 2QICA 2OYIB 1NHLA 3BRVB 2K4DA 2CPBA 4FK5A 4N3WA 3U5OA 3O35A 2GUSA 4A4CA 2WPRA 4W80A 2P1JA 1JNMA 4ZQLA 4UP0A 2W27A 2PP6A 3TNUB 2JJLA 4B7YC 4RESB 3GHGB 3SHBA 2KU3A 4YC9A 3SWYA 3TK1A 3M99A 2WPQA 2R32A 3M06A 3BRTB 2MA5A 1J2JB 4W7YA 5AVXB 3N9MA 2FXMA 1LTJC 2LRIC 3HD7B 2JMIA 3V4WA 4WA6A 3B5NA 1KILA 2KYUA 4AYCA 2R3CA 1L4AD 1LDJB 1GL2A 3KQGA 4MVTA 1LTIC 4GIFA 4EOTA 1XTCC 1JTHB 1A02J 2XZRA 1MFZA 3H32A 5G0FA 4A0CD 2KWKA 4BBQA 3HRNA 1XWHA 2OXQC 2ECVA 4A49A 2HLOA 2M85A 5CCGC 5APWA 2KSJA 3V2PA 1PFIA 2IPPA 5AW7B 2M3HA 1GU5A 4PPEA 5H1UA 1ZV8A 1M1JB 4V3KC 3T97A 1FP0A 3L35A 4R2YA 1IC2A 1LT9C 1NOHA 1RF0A 1ZLLA 4MSXA 2ZXEB 3II6A 1LWUB 4UI9B 4TKPB 5JG6A 2P2UA 3L36A 2K1JA 1X4JA 4W4UA 2CSZA 2WSFH 3M9QA 4GB0A 2A45H 2GM4A 2YMYA 1FDMA 1MM2A 2L5UA 1CW5A 1JOCA 1CZQA 1RE3A 2HG5D 1E4UA 1FBVA 2AN6A 4M3LA 3BVHA 2VJFA 5FERA 1NTZK 3RK3D 2LGKA 3C9IA 3VP8A 1WGMA 2KWNA 5I3LA 1L4AC 3L37A 3U5MA 1IFIA 4WZ0A 1OWAA 1N7SD 1WEOA 5KJ7D 5APUA 3N9LA 1RE4C 3QZVA 1LTTC 4GNEA 4IFMA 1HUCA 4I6MC 1SLQA 4P5OB 1GL2B 2IX7C 5AVWB 2E43A 1M1JC 2EODA 1T2KD 4Q6FA 2MNZA 2MD8C 2C9LY 1ZR2A 5TDRA 4DZOA 1GK4A 1X79B 1LWUC 3EFGA 3H32B 2HYED 3M9BA 2YURA 5AW4B 5LKXA 2H0DA 3KPEA 1S9KE 3N9NA 1SQQK 1Z6UA 2QJ0A 3L1ZB 1L0LK 1RF1C 5TABA 1LTJA 2PNXA 4XE5B 3EB5A 4ZUXU 1DX7A 3U1CA 2ZFCA 4LK9A 5CCHC 3UIAA 2MNYA 3HE5B 3RK3C 1JUNA 3RPGB 2VRSA 3N4XA 2XB1A 5AVRB 1JCDA 5B78A 2WZ7A 2FFDC 1N7SC 2C2LA 5KJ7C 3KQIA 2YREA 3TNUA 1J1DC 2I1KA 5AW8B 4R7EA 4YBSA 3MTUE 2LXPC 2WSCH 1NU1K 3FL2A 3RL0D 4GKGA 1GTWA 2M8RA 1E5WA 1T2KC 1WEPA 2FYZA 1LT9A 2WWWA 4GT1A 2KWJA 2JMDA 5B77A 3NMDA 3RL0B 4I7DA 5B75A 1N7LA 5C11A 2IFMA 2N1TC 4Y99C 1FOSE 3I2DA 1VFYA 3U1AA 3ZVYA 2H0DB 5D1LB 2Q3IA 1X8YA 4I7BA 2FKWB 2Q7CA 1FU1A 2K17A 5AIUA 1QL1A 2YKOA 2F6NA 5D1MB 1L4AA 2WPSA 5G04B 4AQRD 3I5CA 2XEUA 1KFNA 4IC3A 3NFQA 1SVFA 2L80A 3VMXA 2D8SA 2E42A 1FZGA 1Z2QA 1HGZA 5BU8B 1HYJA 3ZPVE 1M1JA 3VK6A 1IJDB 2R5DA 1WE9A 4QF3A 5CJ0A 5CCGD 1JY3O 3RL0C 2QIZA 3T7LA 1LWUA 1JCCA 1WEVA 4HH2A 1GDTA 5H1TA 2YSMA 2VPBA 1SFCD 2HFED 4YBMA 1RF1A 3P7KA 4I7CA 2YUCA 3A2AA 2YW8A 1LT9B 4FJCA 1U6GB 1MUUA 3V2NA 1FAVA 1JMMA 2O1JA 2G45A 1VD4A 2LDRA 3M62A 5LKZA 3WMM0 1KQLA 2FSAA 1JO5A 2Q5UA 1S9KD 4IFFA 1IFNA 2CKLB 3VMYA 1IYMA 2FFDA 1N7SA 5KJ7A 3O34A 1FJKA 5AW2B 2IDAA 3DQVR 3CI9A 3CLQA 1WENA 3KNVA 3N9PA 3ZNIA 1L4AB 4FIPA 2ECWA 5AW1B 1F62A 2KLVA 1T3JA 2BASA 4L58A 4LLBA 1NAFA 1YTZI 2XNXA 5B76A 3TSIA 4QF2A 1RY3A 2VP7A 3O37A 1LGHB 4LADB 1J1EC 1KZUB 2YQMA 4C7NA 2RI7A 5TRBA 1GW4A 5KH9A 1N73C 2F6JA 2J58A 1SFCC 1GZLA 3MIWA 3P8MC 3EB6A 2O1KA 1H89A 3O70A 2IFNA 4AP4A 4AVXA 4GNGA 1ZN5A 1ZBDB 5KH7A 3HE5A 1JY3N 3LQIA 1RF1B 2HODA 3ASLA 2XV5A 4XA4A 4KHXA 5CCHD 3ZVZB 2YHNA 1HYIA 3M0DC 5APYA 2J59M 4LJNA 3VYIA 2KP8A 1T3UA 2L5GB 2YO3A 3B8EB 2DX8A 4W7ZA 3RK3B 4ZDTA 3PUQA 3LIDA 2WT7B 2H8PD 5BVZA 1DH3A 2Y1MA 4O64A 2FFDB 2YYRA 1SQXK 1N7SB 1VDFA 5D1KB 4A4BA 3T6RA 1J1DB 2OARA 2Y43A 3OJAB 3C5KA 1NTMK 2LKMA 3V43A 3U5PA 4LC1A 3PP5A 1V87A 2N1TD 3B5ND 4JYCA 2WSEH 2MIQA 2NAAA 2P7JA 1YYCA 2M6MA 4I1LA 4C7NB 4AUWA 1VYXA 3M91A 1WEQA 2N1TB 1OXZA 1CI6B 3A3YB 4Y99B 3RK2D 5FEYA 5APSA 1N2DC 2KE1A 1JY2O 3HCTA 5DKAA 3NG2A 5AW0B 2MA6A 5AW3B 3N7NA 1YTZT 2HODB 5B8DA 3GL6A 1FZCC 3V2RA 1JY3P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPD A;  2BAY A;  1JM7 A;  4LKA A;  5FB1 A;  5APQ A;  1WEU A;  1WIM A;  2G6Q A;  2KIZ A;  5C13 A;  2I50 A;  1DVP A;  5KH3 A;  5AVU B;  1WIL A;  2EGP A;  2XU6 A;  3OAK A;  2L0B A;  5APX A;  3HTK C;  5LKT A;  4F52 B;  4JYB A;  1WFK A;  3ZTG A;  1IO4 A;  2LGL A;  4YBT A;  2M1R A;  5AVS B;  3O33 A;  5AVQ B;  2CKL A;  4NN2 A;  4FO9 A;  4YAT A;  4GNF A;  3M0D A;  3PHD A;  2LV9 A;  5AVV B;  2YHO A;  5FB0 A;  3O8Z A;  2C2V S;  2L43 A;  3M9H A;  2K16 A;  4X3G A;  2YQL A;  3NXS A;  2KWO A;  2Z5H A;  2EA6 A;  3KDP B;  1GU4 A;  3N9Q A;  1JM7 B;  3ZYQ A;  2E6R A;  1GK6 A;  3LIE A;  5APT A;  3V4Q A;  1RMD A;  1MM3 A;  1GD2 E;  2ECI A;  2G43 A;  3LRQ A;  1SP4 A;  4UP5 A;  2YNY A;  1WEW A;  2FUI A;  2KGG A;  1HBW A;  3IHP A;  2Z5I A;  2WT7 A;  5DIN A;  3SOU A;  2VPG A;  5H1V A;  4B86 C;  1CSB A;  4C46 A;  3V5B A;  2R5B A;  4HYT B;  2KGI A;  2JMJ A;  3TYY A;  3LQH A;  2YU4 A;  2VJE B;  5AW9 B;  1WEE A;  5AVZ B;  5TBN A;  2UZG A;  3HTK A;  3IR9 A;  3SWF A;  1A02 F;  4WZ3 B;  1CI6 A;  2RSD A;  3PUR A;  2W6A A;  4YAX A;  2CT2 A;  2N9B A;  3P32 A;  2YSJ A;  1WEM A;  5AW5 B;  1T1H A;  3HCU A;  3A5T A;  2ECJ A;  3VTP C;  2L75 A;  2CSY A;  1BOR A;  1X4U A;  3O36 A;  2H7H A;  4YAB A;  4YAD A;  2VNF A;  2MUM A;  1H88 A;  3KV5 A;  1WES A;  5H9M A;  5AVT B;  3HCS A;  3KV6 A;  3SOX A;  5LCW B;  4CA1 A;  2LQ6 A;  3MGN A;  2ECN A;  4IC2 A;  2PUY A;  2LXH C;  3C6W A;  2P67 A;  1H8A A;  2FUU A;  2YT5 A;  5CMZ A;  1MV8 A;  1FOS F;  4AYC B;  2E6S A;  3GV4 A;  4CCG X;  4B86 A;  3DPL R;  4R8P K;  1HWT C;  5AIT A;  2MT5 A;  4WZ2 A;  4GND A;  2QM7 A;  3RTR B;  5TDW A;  4PTB A;  2LGV A;  4N4F A;  5AVY B;  1Z60 A;  1NWQ A;  2Y1N A;  4I2L C;  2ZET C;  4S3O B;  3HE4 A;  4C9Z A;  1CHC A;  5AW6 B;  2ECG A;  2LN0 A;  2HDP A;  3O7A A;  2KRE A;  3VMZ A;  3A7O A;  5EYA F;  4XI1 A;  3VN0 A;  2C9N Y;  2QM8 A;  5B79 A;  3MHS A;  4L7X A;  3M0A A;  4BHW A;  1HJB A;  2VJF B;  5G05 B;  4AUQ B;  2VPE A;  2LGG A;  3SOW A;  2YO2 A;  1G2C B;  3U5N A;  2KR4 A;  1K2F A;  3L11 A;  2VJE A;  4S3O C;  1G25 A;  3NTN A;  2F42 A;  3MD0 A;  1LDK C;  1X4I A;  3N9O A;  2ECT A;  2JRJ A;  3L1X A;  1N87 A;  3MHH A;  5APV A;  3M63 A;  3LQJ A;  3HE4 B;  5LKU A;  2WTY A;  3RPG C;  4V3L C;  2MD7 B;  3ZPV 1;  2QIC A;  2K4D A;  4FK5 A;  4N3W A;  3U5O A;  4A4C A;  3O35 A;  2WPR A;  1JNM A;  4ZQL A;  4UP0 A;  2W27 A;  3TNU B;  2JJL A;  4B7Y C;  4RES B;  3SHB A;  2KU3 A;  4YC9 A;  3TK1 A;  3M99 A;  2WPQ A;  2R32 A;  3M06 A;  2MA5 A;  1J2J B;  5AVX B;  3N9M A;  2LRI C;  2JMI A;  3V4W A;  4WA6 A;  2KYU A;  4AYC A;  2R3C A;  1LDJ B;  3KQG A;  4MVT A;  4EOT A;  1A02 J;  2XZR A;  1MFZ A;  5G0F A;  4A0C D;  4BBQ A;  2KWK A;  1XWH A;  2OXQ C;  2ECV A;  4A49 A;  2M85 A;  5APW A;  2M3H A;  2IPP A;  5AW7 B;  4PPE A;  1GU5 A;  5H1U A;  4V3K C;  3T97 A;  1FP0 A;  3L35 A;  4R2Y A;  4MSX A;  2ZXE B;  4UI9 B;  4TKP B;  5JG6 A;  2P2U A;  3L36 A;  2K1J A;  1X4J A;  4W4U A;  2CSZ A;  4GB0 A;  2L5U A;  1MM2 A;  1JOC A;  1CZQ A;  1E4U A;  1FBV A;  2AN6 A;  4M3L A;  2VJF A;  5FER A;  2LGK A;  1WGM A;  2KWN A;  5I3L A;  3L37 A;  3U5M A;  4WZ0 A;  1OWA A;  1WEO A;  5APU A;  3N9L A;  3QZV A;  4GNE A;  1HUC A;  4I6M C;  1SLQ A;  4P5O B;  2E43 A;  5AVW B;  2MD8 C;  2EOD A;  1T2K D;  4Q6F A;  2MNZ A;  2C9L Y;  5TDR A;  4DZO A;  1GK4 A;  2HYE D;  3M9B A;  2YUR A;  5AW4 B;  5LKX A;  2H0D A;  3N9N A;  1S9K E;  1Z6U A;  2QJ0 A;  3L1Z B;  5TAB A;  2PNX A;  4XE5 B;  3EB5 A;  4ZUX U;  2ZFC A;  4LK9 A;  3UIA A;  2MNY A;  3HE5 B;  1JUN A;  3RPG B;  2VRS A;  2XB1 A;  5AVR B;  5B78 A;  2C2L A;  3KQI A;  2YRE A;  3TNU A;  5AW8 B;  4R7E A;  4YBS A;  2LXP C;  3FL2 A;  4GKG A;  1GTW A;  1WEP A;  1T2K C;  4GT1 A;  2WWW A;  2KWJ A;  5B77 A;  2JMD A;  3NMD A;  4I7D A;  5B75 A;  5C11 A;  1FOS E;  3I2D A;  1VFY A;  3ZVY A;  2H0D B;  5D1L B;  2Q3I A;  1X8Y A;  4I7B A;  2Q7C A;  2K17 A;  5AIU A;  2F6N A;  5D1M B;  2WPS A;  5G04 B;  4AQR D;  3I5C A;  2XEU A;  4IC3 A;  3NFQ A;  2L80 A;  3VMX A;  2D8S A;  2E42 A;  1Z2Q A;  1HYJ A;  3ZPV E;  3VK6 A;  2R5D A;  1WE9 A;  4QF3 A;  2QIZ A;  3T7L A;  1WEV A;  5H1T A;  2YSM A;  2VPB A;  4YBM A;  3P7K A;  4I7C A;  2YUC A;  3A2A A;  2YW8 A;  4FJC A;  1U6G B;  1MUU A;  1FAV A;  5LKZ A;  2G45 A;  2LDR A;  1VD4 A;  3M62 A;  1KQL A;  2FSA A;  2Q5U A;  1S9K D;  2CKL B;  3VMY A;  1IYM A;  3O34 A;  5AW2 B;  2IDA A;  3DQV R;  3N9P A;  1WEN A;  3KNV A;  3ZNI A;  4FIP A;  2ECW A;  5AW1 B;  1F62 A;  2BAS A;  4L58 A;  4LLB A;  1NAF A;  5B76 A;  4QF2 A;  2VP7 A;  3O37 A;  4LAD B;  2YQM A;  4C7N A;  2RI7 A;  5TRB A;  5KH9 A;  2F6J A;  1GZL A;  3P8M C;  3EB6 A;  1H89 A;  3O70 A;  4AP4 A;  4AVX A;  4GNG A;  1ZBD B;  5KH7 A;  3HE5 A;  3LQI A;  3ASL A;  2XV5 A;  4KHX A;  3ZVZ B;  2YHN A;  1HYI A;  5APY A;  4LJN A;  3VYI A;  2KP8 A;  2YO3 A;  3B8E B;  2DX8 A;  4ZDT A;  3PUQ A;  3LID A;  2WT7 B;  1DH3 A;  2Y1M A;  4O64 A;  5D1K B;  2YYR A;  4A4B A;  3T6R A;  2Y43 A;  3C5K A;  3V43 A;  3U5P A;  4LC1 A;  1V87 A;  4JYC A;  2MIQ A;  2NAA A;  2P7J A;  1YYC A;  2M6M A;  4C7N B;  4AUW A;  1VYX A;  3M91 A;  1WEQ A;  1OXZ A;  1CI6 B;  3A3Y B;  5FEY A;  5J3X A;  5APS A;  2KE1 A;  3HCT A;  5DKA A;  3NG2 A;  5AW0 B;  2MA6 A;  5AW3 B;  5B8D A;  3GL6 A;  2KFT A; 
#chains in the Genus database with same CATH topology
 2IZ0 A;  1NKZ B;  2VPD A;  2E5Y A;  5FB1 A;  1JEK A;  1WEU A;  4H44 D;  4R4L A;  3CCR P;  1N86 A;  1DVP A;  1SFC A;  1WIL A;  3CX5 H;  3OAK A;  1PP9 J;  2L0B A;  3HTK C;  1IZN B;  4JYB A;  3ZTG A;  5AVS B;  4NN2 A;  4FO9 A;  4GNF A;  5SVI B;  1NH4 A;  1QLE D;  2YHO A;  1L2P A;  4IL6 E;  1RE4 A;  2BCC J;  2Z5H A;  3KYQ A;  4QQ4 A;  1IFM A;  1U7J A;  1PP9 G;  3U59 A;  3BAT A;  3H1I D;  2IQJ A;  2PRR A;  1GK6 A;  2YKQ A;  2JUN A;  2POH A;  2KYV A;  3H1L D;  1PPJ G;  3V4Q A;  1PP9 E;  2ECI A;  1GD2 E;  4KJM A;  2BCC G;  4UP5 A;  2WQY C;  1WEW A;  2FUI A;  1DEB A;  2WT7 A;  2D2C C;  5H1V A;  2FBW C;  3V6I A;  1FZF A;  5B5E E;  1PPJ E;  2BCC E;  3TYY A;  5AVZ B;  4WY4 C;  3PTZ A;  1KYO D;  2KKX A;  1YJ9 P;  2K1A A;  2UZG A;  1OW7 A;  1R5S A;  3SWF A;  4WZ3 B;  2E61 A;  5E79 E;  3PUR A;  1IFJ A;  2W6A A;  2RH0 A;  3OA7 A;  1KB9 D;  2QJK C;  1GW3 A;  2B89 A;  3VTP C;  1HTL C;  3GHG C;  1BOR A;  3O6Q B;  2QIW A;  2OYH A;  1FZC B;  4YAD A;  1H88 A;  1VQO P;  5H9M A;  3MUD A;  1P84 E;  3HCS A;  3KV6 A;  3A0B E;  3I55 P;  3L75 D;  1FZA A;  3EQ2 A;  2CPS A;  1SQQ J;  2ECN A;  1L0L J;  2LXH C;  1ZME C;  1AQT A;  1KIL B;  3VP9 A;  1MV8 A;  4AYC B;  2CSV A;  4R8P K;  5KLV K;  2A45 I;  2OQQ A;  4WZ2 A;  1LTS C;  3CX5 D;  4IFD K;  2QJP B;  1NWQ A;  1URQ A;  1AQ5 A;  1SQQ G;  1NTK K;  1NU1 J;  2J5U A;  1L0L G;  1CHC A;  4C7R A;  2ECG A;  3AE8 C;  3D6Y A;  4OGQ C;  5B79 A;  1MFT A;  3SFE C;  4L75 A;  1SQQ E;  1L0L E;  1NU1 G;  2YO2 A;  1RH5 B;  2GUV A;  2KR4 A;  1LTB C;  2RMZ A;  1SQB K;  1K2F A;  2F42 A;  3MD0 A;  1S4X A;  5KKZ C;  2M0B A;  1LDK C;  1X4I A;  3L1X A;  1N87 A;  1NU1 E;  1BDC A;  2FYU K;  3HE4 B;  3GW6 A;  2QA4 P;  2WTY A;  1BCC J;  3TF5 A;  1LTJ B;  1Q7Y Q;  2OYI B;  4BRY B;  3O35 A;  2WPR A;  2K88 A;  1DD4 A;  3M99 A;  1BCC G;  2R32 A;  4D6T D;  3BRT B;  2MA5 A;  2FXM A;  5KAF H;  1PGP A;  3HD7 B;  2JMI A;  2RN0 A;  4WA6 A;  1KIL A;  3JCU H;  2KYU A;  2L7P A;  4AYC A;  1BCC E;  1LDJ B;  5KAI H;  1GL2 A;  4GIF A;  3Q5S A;  5G0F A;  4A0C D;  1XWH A;  2HLO A;  2IPP A;  5AW7 B;  1GU5 A;  3T97 A;  3L35 A;  1LT9 C;  1NOH A;  2G3A A;  1VF5 C;  3CXH E;  5JG6 A;  2R44 A;  1WMK A;  2W8Z A;  1EZV D;  3BVH A;  3PHL A;  2ZT9 D;  1KMI Z;  1L4A C;  3E7K A;  1WEO A;  5APU A;  1KD1 Q;  1RE4 C;  1K04 A;  1HUC A;  4I6M C;  1M57 D;  1M1J C;  2EOD A;  4Q6F A;  2C9L Y;  3H32 B;  4KT0 J;  5LKX A;  3KPE A;  1S9K E;  2WSE J;  2JP3 A;  1LTJ A;  3S4R A;  4NPD A;  4LK9 A;  4BRY A;  4Z0O A;  4UB8 H;  5AVR B;  4PD4 H;  3AEC C;  1S72 P;  1N7S C;  2WSC H;  3FL2 A;  3H1K D;  3RL0 D;  2M8R A;  1E5W A;  4L76 A;  1T2K C;  2FYZ A;  2KWJ A;  3NMD A;  1KTM A;  4HJG H;  4PD4 I;  3U1A A;  5DJT B;  2H0D B;  1X8Y A;  1S2E A;  2K17 A;  4YPC A;  2YKO A;  1NJI Q;  2ZYA A;  4IC3 A;  3NFQ A;  1SVF A;  2L80 A;  1HGZ A;  2QE7 H;  2OTK E;  2KZI A;  2IZ1 A;  5CCG D;  1ZP0 C;  1JCC A;  1WEV A;  3H7H A;  2YSM A;  2E76 D;  2VPB A;  1OX3 A;  4H13 D;  1RF1 A;  4I7C A;  2YW8 A;  4K3A A;  3K5B A;  1U6G B;  3T9K A;  1MUU A;  3M62 A;  1JO5 A;  2Q5U A;  2CKL B;  1IFN A;  2KK7 A;  1SQX D;  4ASV A;  3O34 A;  3N9P A;  3CI9 A;  1OIP A;  1VL2 A;  1F62 A;  2E74 D;  1BE3 E;  1YTZ I;  1RY3 A;  2M13 A;  1KZU B;  4C7N A;  2RI7 A;  2F6J A;  3DWD A;  1GZL A;  3MIW A;  1H89 A;  3O70 A;  3R4Y A;  3LQI A;  3ZVZ B;  2YHN A;  5APY A;  5EFW B;  2SPZ A;  3PUQ A;  1YBK A;  1SQV D;  2Y1M A;  4O64 A;  5CBN A;  5KLV J;  2FFD B;  1VDF A;  4A4B A;  1YIT P;  2WVR A;  2OAR A;  2Y43 A;  3CME P;  4PD4 D;  2LKM A;  1NVO A;  3LW5 J;  3PP5 A;  3AE2 C;  2MIQ A;  2NAA A;  4I1L A;  1NYH A;  4WVZ A;  1WEQ A;  3KXD A;  2ZYD A;  1CI6 B;  5J3X A;  4Y99 B;  4IL6 H;  5APS A;  4IL6 X;  5DKA A;  5AW0 B;  5AW3 B;  1NTM E;  1VQ5 P;  3QH9 A;  1OVR A;  3V2R A;  1FZC C;  1WT6 A;  3L73 J;  2BAY A;  3C8V A;  1FZB A;  1AVO A;  1WIM A;  3L70 E;  1HGV A;  2G6Q A;  1SQB J;  5C13 A;  2I50 A;  5AVU B;  2XU6 A;  5LKT A;  2LGL A;  4YBT A;  3O33 A;  2CKL A;  2FYU J;  3L73 G;  3BCC D;  5AVV B;  3EWK A;  2D2C D;  2C2V S;  2L43 A;  3RBX A;  1HH0 A;  5B5E H;  4X3G A;  1SQB G;  1S1C X;  2QJP C;  2KWO A;  3KDP B;  1BGY J;  1VQ7 P;  3L73 E;  4ZKP A;  4WY4 D;  1OVU A;  2M3E A;  2FYU G;  2E6R A;  1SQB E;  1IK9 A;  5E79 H;  3GG2 A;  1J1E B;  5APT A;  1LNQ A;  4N78 E;  1SFC B;  1MM3 A;  2G43 A;  2KB7 P;  2NPS C;  2KGG A;  1BGY G;  2ZJS E;  5CCH A;  1SQP K;  2FYU E;  1ZR4 A;  5DIN A;  3PH0 A;  4B86 C;  1CSB A;  4N3Y B;  2R5B A;  5CJ4 A;  2UWJ E;  1EDJ A;  4TT3 H;  3LQH A;  5BU5 A;  1BGY E;  3CL3 D;  3G3Z A;  3HUS A;  2VJE B;  1M7L A;  1P84 H;  2HPC B;  3A0B H;  2IBZ I;  2FFW A;  2JEE A;  2WPV B;  1CI6 A;  2PGD A;  1JY2 P;  2RSD A;  2OYI C;  4EIJ A;  4YAX A;  2PAJ A;  3HCU A;  3A5T A;  1P84 I;  4BXL A;  1X4U A;  2H7H A;  2XP0 A;  3KV5 A;  1WES A;  3FGA D;  3P8C E;  3HD7 C;  4OGQ D;  1PGO A;  3AEE C;  4CA1 A;  2W90 A;  3MGN A;  1L0N K;  2EGM A;  2I8D A;  1G2C A;  3C6W A;  2FUU A;  3O47 A;  5CMZ A;  3VOP A;  3DPL R;  3EFF K;  3RK2 B;  1PP9 D;  2QM7 A;  2A06 G;  5TDW A;  4N4F A;  5AVY B;  1Z60 A;  1G1I A;  2ZET C;  4S3O B;  2XOY A;  5AW6 B;  1KN7 A;  4H0L B;  1OMI A;  2KRE A;  2KSE A;  2OYH B;  1HF9 A;  2M5A A;  4XI1 A;  3DDT A;  1PPJ D;  2A06 E;  3Q1M A;  2BCC D;  3IAO A;  1ZXG A;  2VJF B;  2YKP A;  5G05 B;  2VPE A;  3M7K A;  1M8O B;  2M3B A;  4DJG A;  2G8Y A;  5M1B A;  1YIJ P;  5TIS E;  1FBM A;  2VJE A;  1G25 A;  2HPC A;  3TGU J;  2YVR A;  2W6B A;  3ITK A;  2H88 C;  3L74 J;  4BWN A;  3M63 A;  1URQ B;  2IYO A;  3LQJ A;  1Y47 A;  4OVN F;  1HVV A;  1QX8 A;  1JTH A;  2MD7 B;  1IFD A;  3ZPV 1;  2K37 A;  1PV3 A;  2LXC B;  1P84 D;  3TGU G;  3BRV B;  4FK5 A;  2CPB A;  3U5O A;  2XOZ A;  3CC7 P;  2P1J A;  1PIX A;  3L74 G;  2LAU A;  1Q86 Q;  3TNU B;  1T6A A;  4YC9 A;  3CXH H;  1VF5 D;  2WPQ A;  3PLW A;  3M06 A;  5GTI E;  1OZH A;  3L74 E;  2V7Q J;  5AVX B;  3SWK A;  2IBZ G;  3H1I J;  1QVG O;  3D6Z A;  3B4S A;  1L4A D;  3CXH I;  4MVT A;  1LTI C;  3G6E P;  2JKV A;  3H1L J;  4EOT A;  1XTC C;  1MKM A;  2IBZ E;  2KWK A;  2ECV A;  3MDB C;  1SQQ D;  5APW A;  2KSJ A;  2M3H A;  1L0L D;  4V3K C;  1Y9B A;  1RF0 A;  3H1I G;  3II6 A;  4TKP B;  3L36 A;  1UIX A;  2WSF J;  1X4J A;  2CSZ A;  4GB0 A;  3M9Q A;  2A45 H;  1RQV A;  2KIK A;  1CW5 A;  1RE3 A;  3VMA A;  3AED C;  1FBV A;  3H1L G;  4M3L A;  2VJF A;  5FER A;  1NTZ K;  1R8E A;  1WGM A;  2ZT9 B;  3L37 A;  1NU1 D;  3U5M A;  1N7S D;  3S9O A;  3E2D A;  4R4M A;  2Q1K A;  4GNE A;  4RJT A;  1VQK P;  4P5O B;  1GL2 B;  2IX7 C;  5AVW B;  3Q2Y A;  4RKU J;  2MD8 C;  1T2K D;  5TDR A;  1GK4 A;  1X79 B;  1LWU C;  5B66 E;  2QJ0 A;  5TAB A;  3T97 B;  4ZUX U;  1VQ4 P;  2DJA A;  3U1C A;  5CCH C;  3UIA A;  2MNY A;  3HE5 B;  3RPG B;  2VRS A;  3N4X A;  5B78 A;  2WZ7 A;  2FFD C;  1YJN P;  2JWA A;  3CCE P;  2C2L A;  5KJ7 C;  3KQI A;  4EDF A;  3TNU A;  2I1K A;  4R7E A;  4F1P A;  3KHU A;  1GTW A;  1BCC D;  1WEP A;  1EXJ A;  2WWW A;  3SSU A;  2JMD A;  1LP1 A;  3RL0 B;  1Q2N A;  1N7L A;  2R3S A;  4Y99 C;  2AXT E;  4I7B A;  2FKW B;  1FU1 A;  1QL1 A;  2AEM A;  5H2F E;  5D1M B;  4XFJ A;  3CXH D;  2WPS A;  2YMK A;  2XEU A;  2OGU A;  3JSV C;  2D8S A;  1Z2Q A;  1SQP J;  1FC2 C;  4OWF A;  2QJY B;  3RL0 g;  2Q6Q A;  3S1K A;  4QF3 A;  3G9R A;  2QIZ A;  3T7L A;  1H0T B;  1ZOY C;  1GMJ A;  3H1H J;  2HFE D;  3G71 P;  1LJ2 A;  2NZ2 A;  1FAV A;  2O1J A;  1SQP G;  1KQL A;  3FXD A;  1S9K D;  1R5L A;  3DQV R;  3CLQ A;  1ZRT D;  3H1H G;  2ECW A;  5AW1 B;  1FE6 A;  2KLV A;  2BAS A;  1QVF O;  1SQP E;  3FM8 C;  1NAF A;  2W83 C;  2XNX A;  3CCL P;  2DSM A;  2VP7 A;  1K05 A;  1U57 A;  4PJ0 E;  1J1E C;  5TRB A;  1W5C E;  1EDI A;  1LT1 A;  2J58 A;  1SFC C;  3P8M C;  3EB6 A;  2O1K A;  3H1H E;  2OYO A;  3GF3 A;  3F89 A;  4AP4 A;  3QWO C;  5KH7 A;  2QVA A;  3HE5 A;  1RF1 B;  3H1J J;  4XA4 A;  2CON A;  4KHX A;  1L0N J;  3VYI A;  2KP8 A;  1T3U A;  2L5G B;  3AE9 C;  3RK3 B;  1DH3 A;  2IDB A;  1J1D B;  3CC2 P;  3H1J G;  3C5K A;  4LC1 A;  1L0N G;  2N1T D;  4JYC A;  1YYC A;  4C7N B;  3A3Y B;  3WU2 E;  1N2D C;  2B88 A;  2MA6 A;  3H1J E;  4PV1 B;  1L0N E;  5B8D A;  4A49 A;  3PJS K;  1JY3 P;  2XDJ A;  1JM7 A;  1H0T A;  1DCQ A;  2KNC B;  5CCG A;  1WRG A;  1OW6 A;  4K35 A;  1N73 A;  5CHX A;  5KH3 A;  1EQ7 A;  1VQM P;  2EGP A;  5APX A;  4F52 B;  3GF7 A;  3TDK A;  1BE3 D;  3I56 P;  2NPS D;  3RK2 C;  3M0D A;  3PHD A;  3O8Z A;  2O01 J;  3A0H E;  3IN6 A;  2K16 A;  1BSN A;  3FAN A;  3FX0 A;  2Q9I A;  2EA6 A;  2V4H A;  1GU4 A;  4H0L C;  1JY2 N;  1KIL E;  2OYH C;  3MUD C;  4WY4 B;  2XKM A;  5KTB A;  1QL2 A;  1LTG C;  1S3J A;  3SFD C;  2LR2 A;  2Y0D A;  3CC4 P;  1SP4 A;  1PL5 A;  4GOD A;  3RGU A;  1PZQ A;  3E1I A;  3IHP A;  3D70 A;  3BAS A;  3L4F A;  2O01 N;  4C46 A;  4DCK A;  4L73 A;  2E75 B;  3AEG C;  1NTM D;  1URQ C;  3HD7 D;  5AW9 B;  3HTK A;  1Y8A A;  3IR9 A;  1A02 F;  2QEX P;  2Y9Y A;  3V2Q A;  1DIP A;  2Y0C A;  3L70 D;  2CT2 A;  2N9B A;  3P32 A;  3F5H A;  1WEM A;  5AW5 B;  2QRX A;  1NTZ J;  4YXD C;  2CSY A;  2KNC A;  1S5L E;  1OVV A;  4MN4 C;  2AEJ A;  4YAB A;  3L71 J;  1FJP A;  2WIT A;  4ASW A;  4O9B A;  2FYN B;  1XTG B;  2H43 A;  5AVT B;  2RR4 A;  2YIU B;  3HUS B;  4OGQ B;  1NTK J;  1NTZ G;  2LQ6 A;  3L73 D;  4OGE A;  2HYN A;  3B5N B;  4OH8 B;  1H8A A;  4ZKU A;  2YT5 A;  1SQB D;  1FOS F;  2E6S A;  2Z4E A;  3GV4 A;  5KLV G;  3L71 G;  2P57 A;  1VQ6 P;  5TIS H;  1NTZ E;  4N78 D;  2LGV A;  1JMB A;  2Y1N A;  1NTK G;  1RHZ B;  2FYU D;  4C9Z A;  2ITA A;  4WY4 A;  5KLV E;  3L71 E;  2HDP A;  3VMZ A;  4L74 A;  3A7O A;  4H44 B;  4NPF X;  3MHS A;  1NKN A;  4L7X A;  1HJB A;  1BGY D;  2I1J A;  1KIL C;  1NTK E;  1T8Z A;  2JWD A;  4LLH A;  1GL2 C;  2KZJ A;  2LGG A;  1Q82 Q;  3SOW A;  3OW2 O;  3GHG A;  1G2C B;  1X22 A;  2JO1 A;  1G1J A;  2N9Y B;  2P58 A;  3RK3 E;  5GTI H;  4JPZ B;  3N9O A;  2C0W A;  3KZI E;  2JRJ A;  2GA1 A;  3MHH A;  5APV A;  1M56 D;  3GMA A;  5LKU A;  3USS A;  3AE4 C;  3RPG C;  4V3L C;  2M5A B;  1VPC A;  1AJY A;  3P8C D;  3CWB J;  1NHL A;  2K4D A;  4A4C A;  2GUS A;  2EXU A;  4UP0 A;  3BCC J;  4RES B;  3SHB A;  2KU3 A;  3MHV A;  3SWY A;  3L72 D;  4O62 A;  2K9J B;  5SVY A;  3CWB G;  1VF5 B;  2V7Q H;  1LTJ C;  4U7J A;  3V4W A;  3B5N A;  3PLN A;  2OTJ P;  3BCC G;  3G4S P;  2OWA A;  5SVX A;  3KQG A;  2QJY C;  3FEH A;  3CWB E;  2A06 D;  1JTH B;  4BBQ A;  2XZR A;  2W6J H;  2OXQ C;  4UB6 E;  1E79 H;  5DJU B;  4HB1 A;  2M85 A;  5CCG C;  1DD3 A;  1DEE G;  3V2P A;  1PFI A;  2B9B A;  1M1J B;  5B66 H;  1VQN P;  1FP0 A;  4R2Y A;  1IC2 A;  1USD A;  4MSX A;  2ZXE B;  1KV4 A;  2L91 A;  2WSF H;  1FDM A;  2YMY A;  1MM2 A;  2L5U A;  1JOC A;  2AN6 A;  1X0T A;  2YXR B;  3VP8 A;  3B71 A;  3Q1D A;  5I3L A;  1IFI A;  5KJ7 D;  3N9L A;  4U3F J;  1K73 Q;  3CCM P;  4IFM A;  1AA0 A;  1SLQ A;  2E43 A;  2Y0E A;  5GTH E;  1BSH A;  4DZO A;  3EFG A;  2HR3 A;  3M9B A;  1KYO I;  1Z6U A;  3L1Z B;  4I7Z B;  1RF1 C;  2AXT H;  3E1R A;  2PNX A;  1IK7 A;  2B87 B;  4XE5 B;  3EB5 A;  4U3F G;  5H2F H;  4ZNC A;  1M90 Q;  1Q90 D;  3RK3 C;  1OW8 A;  1JUN A;  2XB1 A;  3CPW O;  1JCD A;  3L74 D;  2MKE A;  2YRE A;  1J1D C;  1N8R Q;  1PGQ A;  3MTU E;  1U7M A;  4U3F E;  1W2B O;  3LVQ E;  4GKG A;  1LT9 A;  4GT1 A;  5B77 A;  2K9J A;  5B75 A;  2IFM A;  3KDE C;  2IBZ D;  3I2D A;  1EXI A;  3ZVY A;  1OFC X;  2Q3I A;  4PV1 C;  5AIU A;  1L4A A;  3JUE A;  5G04 B;  3AE1 C;  4WWI A;  3CX5 I;  1FZG A;  1HYJ A;  1M1J A;  2NRG A;  3AEF C;  4Z1M H;  5K5G B;  2R5D A;  4PJ0 H;  4GOE A;  2MKV A;  5H1T A;  1TU3 F;  3CCU P;  1SFC D;  3P7K A;  3TGU E;  1PGJ A;  1QEX A;  1LP1 B;  4FJC A;  3CD6 P;  5LKZ A;  2G45 A;  3WMM 0;  3VMY A;  4OGC A;  1N7S A;  2IDA A;  3WUV A;  3KNV A;  3FWL A;  1FDO A;  1T3J A;  4L58 A;  4LLB A;  3CCJ P;  4QF2 A;  3O37 A;  2O3J A;  3H25 A;  1LGH B;  2YQM A;  2B87 A;  4YTP C;  2IFN A;  1KQS O;  1VQ9 P;  4AVX A;  3WU2 H;  4GNG A;  1ZN5 A;  2CRR A;  1JY3 N;  2HOD A;  3ASL A;  1HYI A;  4H9D A;  4LJN A;  3AE7 C;  3H1I E;  5C39 A;  2E75 C;  2DX8 A;  4ZDT A;  3LID A;  2H8P D;  5BVZ A;  5D1K B;  1SQX K;  3ZDM A;  3H1L E;  2WSS H;  2BEZ F;  4NPE A;  2YXQ B;  3OJA B;  3CCQ P;  2QSI A;  3JC2 2;  1NTM K;  3V43 A;  3U5P A;  5SVI A;  2WSE H;  2P7J A;  2M6M A;  4AUW A;  1VYX A;  2N1T B;  1OXZ A;  1BDD A;  3RK2 D;  5FEY A;  2KE1 A;  3HCT A;  1JY2 O;  3A0H H;  5KLI B;  1NAY A;  3RBZ A;  3MZW B;  2IYP A;  3W68 A;  1YTZ T;  3L75 J;  1KYO E;  3GL6 A;  1SS1 A;  2KFT A;  2FYN C;  4H0L D;  3R2P A;  4LKA A;  5APQ A;  3LDY A;  4JQ0 D;  2KIZ A;  1KB9 E;  4GDO A;  2YIU C;  3HUS C;  1SQV K;  3IF4 A;  2ZVO B;  1EZV I;  1LTA C;  3B5N C;  1SQP D;  1WFK A;  1IO4 A;  3L75 G;  2M1R A;  5AVQ B;  4YAT A;  2LV9 A;  5FB0 A;  2NPS B;  3M9H A;  2O01 H;  3H1H D;  2YQL A;  2FY8 A;  4A7P A;  4WB4 A;  3NXS A;  3L75 E;  3Q5P A;  3N9Q A;  1URQ D;  2CRW A;  4H44 C;  3IFM A;  1JM7 B;  3ZYQ A;  1NO4 A;  1MBM A;  1Q81 Q;  3LIE A;  4EYY Q;  3CX5 E;  2E76 B;  2PFX A;  1N73 B;  4H13 B;  1RMD A;  3LRQ A;  2YNY A;  1FZE A;  1HBW A;  3O6Q A;  2Z5I A;  1KC8 Q;  3SOU A;  2VPG A;  1FZC A;  2DW3 A;  1S5L H;  3V5B A;  1S5L X;  4HYT B;  2KGI A;  3Q5R A;  1AFO A;  2JMJ A;  2CK3 H;  2KOG A;  2MJZ A;  2ZYG A;  3H1J D;  2YU4 A;  5TJH A;  2P10 A;  1WEE A;  1L0N D;  5TBN A;  2E74 B;  2N1T A;  2E5T A;  2JR8 A;  3FJU B;  2YSJ A;  1T1H A;  4RO0 A;  4D6T J;  2ECJ A;  2L75 A;  3WUT A;  4QMA A;  3O36 A;  1VQ8 P;  4IOI H;  1HJ0 A;  2Y9Z A;  2VNF A;  2C0X A;  2Q3E A;  2MUM A;  4HKZ H;  1X9V A;  2XND H;  3SOX A;  4D6T G;  5LCW B;  3LW5 H;  1W2E A;  1KIL D;  3PRJ A;  4IC2 A;  2PUY A;  4N6J A;  4JF7 A;  2NPS A;  3HTK B;  2P67 A;  1GL2 D;  4CCG X;  4B86 A;  1RQU A;  1HWT C;  5AIT A;  2MT5 A;  4D6T E;  3H6P A;  1EDK A;  2A45 G;  5CBO A;  4GND A;  3RTR B;  1AVY A;  4PTB A;  4I2L C;  3HE4 A;  3KZI H;  4Z0R A;  1USE A;  2LN0 A;  3O7A A;  4CPG A;  5EYA F;  3VN0 A;  1ZRT E;  2C9N Y;  2QM8 A;  1KQF B;  2OYI A;  1EC5 A;  1EZV G;  3M0A A;  4BHW A;  2LXB A;  4WBA A;  1KOR A;  4Y28 J;  4AUQ B;  1Z56 A;  3U5N A;  1MZ9 A;  1EZV E;  3L11 A;  4DOJ A;  2D2C B;  4S3O C;  3NTN A;  4I7Z C;  1KFM A;  3HD7 A;  3Q3D A;  1RF0 C;  1D7M A;  2ECT A;  3H1K J;  1RE3 C;  1JB0 J;  2D8U A;  4LGD E;  3CCS P;  2QIC A;  4N3W A;  2KKY A;  1BE3 J;  4W80 A;  4UB6 H;  1NGM B;  1JNM A;  4ZQL A;  2QJK B;  2ZVN B;  2W27 A;  2B0O E;  3FXE A;  2PP6 A;  2JJL A;  4B7Y C;  3GHG B;  3H1K G;  3TK1 A;  1VQL P;  4YXW H;  2OTL P;  1FDI A;  1J2J B;  1NTZ D;  5K3Q A;  4W7Y A;  3N9M A;  1YQ3 C;  2KS1 B;  2LRI C;  1BE3 G;  3H1K E;  3D71 A;  2R3C A;  5KLV D;  3L71 D;  4EI2 A;  3AE3 C;  5GTH H;  2FXP A;  1A02 J;  1MFZ A;  3H32 A;  1JM0 A;  3HRN A;  1NTK D;  4PPE A;  5H1U A;  1ZV8 A;  1KQG B;  1ZLL A;  1YI2 P;  1SQX J;  2K9Y A;  1LWU B;  3FWN A;  4UI9 B;  2P2U A;  2K1J A;  4W4U A;  2GM4 A;  1CZQ A;  2HG5 D;  1NTM J;  1E4U A;  5KAF E;  2AXC A;  3RK3 D;  2XOC A;  2LGK A;  3JCU E;  3C9I A;  2KWN A;  2RKL A;  4WZ0 A;  1OWA A;  1VQP P;  2QG4 A;  5KAI E;  2ZAE B;  3QZV A;  1LTT C;  3AE5 C;  3L70 J;  1SQX G;  3AE6 C;  1YQ4 C;  2MNZ A;  3LJU X;  1ZR2 A;  1ZW0 A;  1NTM G;  2HYE D;  2YUR A;  5AW4 B;  2H0D A;  3N9N A;  3ABV C;  1SQQ K;  1IFP A;  1L0L K;  1SQX E;  5KKZ B;  1SQV J;  4PV1 D;  1DX7 A;  2ZFC A;  3L70 G;  3W67 A;  3AEA C;  2ZT9 C;  2FXO A;  4ZMD A;  5AW8 B;  2WSC J;  2LXP C;  4YBS A;  1NU1 K;  1SQV G;  2KI7 B;  4I7D A;  3CWB D;  5C11 A;  2ZXX A;  2KS1 A;  2N1T C;  1FOS E;  1VFY A;  1YJW P;  2FD4 A;  5KLI C;  5D1L B;  4TLF A;  1SQV E;  2Q7C A;  2K3R A;  2BEQ D;  2F6N A;  1AV1 A;  4JBZ A;  1QGK B;  4AQR D;  3I5C A;  1KFN A;  4UB8 E;  1EDL A;  3WUU A;  3VMX A;  4GOF A;  2E42 A;  4PD4 E;  5BU8 B;  3ZPV E;  3VK6 A;  1IJD B;  1WE9 A;  5CJ0 A;  1JY3 O;  3RL0 C;  3LVR E;  1UII A;  1LWU A;  1YHQ P;  4HH2 A;  1GDT A;  4YBM A;  3FAO A;  2YUC A;  3A2A A;  1LT9 B;  2AEF A;  2KUB A;  2KLU A;  5L8R J;  3V2N A;  1JMM A;  2LDR A;  1VD4 A;  2FSA A;  4IFF A;  1IYM A;  3CMA P;  2WMM A;  2FFD A;  2E75 D;  5KJ7 A;  3CCV P;  1FJK A;  3GLM A;  5AW2 B;  1WEN A;  3ZNI A;  1L4A B;  4FIP A;  3C1L A;  5B76 A;  3TSI A;  4LAD B;  1FS0 E;  3BCC E;  1GW4 A;  5KH9 A;  2E76 C;  1N73 C;  4H13 C;  4U3F D;  3MP7 B;  1ZBD B;  2JM3 A;  3L72 J;  2XV5 A;  5CCH D;  2H89 C;  3M0D C;  2J59 M;  1KYO H;  1M1K Q;  2KXP B;  1K8A Q;  2YO3 A;  3B8E B;  4W7Z A;  2WT7 B;  2YYR A;  1N7S B;  1KB9 H;  3AEB C;  3T6R A;  2E74 C;  3L72 G;  1K9M Q;  1V87 A;  3B5N D;  3SUB A;  3M91 A;  1KB9 I;  2JDI H;  4DT0 A;  3L72 E;  3NG2 A;  3TGU D;  3N7N A;  2HOD B; 
#chains in the Genus database with same CATH homology
 2XDJ A;  2VPD A;  1NKZ B;  1WT6 A;  2BAY A;  1JM7 A;  3R2P A;  4LKA A;  5FB1 A;  1FZB A;  5APQ A;  1WEU A;  5CCG A;  1WIM A;  1HGV A;  2G6Q A;  2KIZ A;  1WRG A;  5C13 A;  3HUS C;  1SQV K;  2I50 A;  5J3X A;  1N73 A;  1N86 A;  5CHX A;  1SFC A;  1DVP A;  5KH3 A;  5AVU B;  1EQ7 A;  1LTA C;  1WIL A;  2XU6 A;  3OAK A;  2EGP A;  2L0B A;  5APX A;  3HTK C;  5LKT A;  3B5N C;  4F52 B;  4JYB A;  1WFK A;  3ZTG A;  1IO4 A;  2LGL A;  4YBT A;  2M1R A;  5AVS B;  3O33 A;  5AVQ B;  2CKL A;  4NN2 A;  4FO9 A;  4YAT A;  2NPS D;  4GNF A;  3RK2 C;  3M0D A;  1NH4 A;  3PHD A;  2LV9 A;  5AVV B;  2YHO A;  5FB0 A;  3O8Z A;  2C2V S;  2L43 A;  2NPS B;  3M9H A;  2O01 H;  1HH0 A;  2K16 A;  4X3G A;  2YQL A;  4WB4 A;  1RE4 A;  3NXS A;  2KWO A;  2Z5H A;  2Q9I A;  2EA6 A;  3KDP B;  3KYQ A;  1IFM A;  1GU4 A;  1JY2 N;  2OYH C;  3N9Q A;  1URQ D;  4ZKP A;  3U59 A;  3BAT A;  4WY4 D;  3IFM A;  1JM7 B;  3ZYQ A;  1NO4 A;  2E6R A;  1GK6 A;  1IK9 A;  4WY4 B;  2YKQ A;  2XKM A;  5KTB A;  1QL2 A;  3LIE A;  1LTG C;  1J1E B;  5APT A;  2POH A;  2KYV A;  3V4Q A;  4N78 E;  1N73 B;  1RMD A;  1SFC B;  1GD2 E;  1MM3 A;  2ECI A;  2G43 A;  1SP4 A;  3LRQ A;  4UP5 A;  2KB7 P;  2YNY A;  1WEW A;  1FZE A;  2FUI A;  2NPS C;  1DEB A;  5CCH A;  3E1I A;  2KGG A;  1HBW A;  1SQP K;  3IHP A;  1ZR4 A;  2Z5I A;  2WT7 A;  5DIN A;  3BAS A;  3SOU A;  2VPG A;  5H1V A;  4B86 C;  1FZC A;  3L4F A;  1FZF A;  1CSB A;  4N3Y B;  4C46 A;  3V5B A;  2R5B A;  4HYT B;  2KGI A;  1AFO A;  5CJ4 A;  2JMJ A;  2KOG A;  3TYY A;  3LQH A;  2MJZ A;  3CL3 D;  5BU5 A;  3G3Z A;  3HUS A;  1URQ C;  3HD7 D;  2VJE B;  1M7L A;  2HPC B;  2YU4 A;  5AW9 B;  1WEE A;  5AVZ B;  4WY4 C;  5TBN A;  2UZG A;  3HTK A;  2JEE A;  2N1T A;  3IR9 A;  3SWF A;  1A02 F;  1CI6 A;  4WZ3 B;  1JY2 P;  2RSD A;  2OYI C;  3V2Q A;  1IFJ A;  3PUR A;  2W6A A;  4EIJ A;  4YAX A;  2CT2 A;  3OA7 A;  2N9B A;  3P32 A;  2PAJ A;  2YSJ A;  1WEM A;  2KFT A;  5AW5 B;  1GW3 A;  1T1H A;  3HCU A;  3A5T A;  2ECJ A;  3VTP C;  2L75 A;  1HTL C;  2CSY A;  3GHG C;  1BOR A;  1X4U A;  3O36 A;  2OYH A;  2H7H A;  1FZC B;  4YAD A;  4YAB A;  2VNF A;  2C0X A;  1FJP A;  2MUM A;  2WIT A;  4O9B A;  1H88 A;  3KV5 A;  1WES A;  3P8C E;  1XTG B;  3HD7 C;  2H43 A;  5H9M A;  1X9V A;  3MUD A;  5AVT B;  3HCS A;  3KV6 A;  3SOX A;  1FZA A;  3HUS B;  5LCW B;  3EQ2 A;  4CA1 A;  2CPS A;  3LW5 H;  1W2E A;  3MGN A;  2LQ6 A;  1L0N K;  1KIL D;  2ECN A;  4IC2 A;  2PUY A;  4N6J A;  2LXH C;  4JF7 A;  1G2C A;  2HYN A;  2NPS A;  3C6W A;  3HTK B;  2P67 A;  3B5N B;  4OH8 B;  1H8A A;  2FUU A;  1KIL B;  4ZKU A;  2YT5 A;  1GL2 D;  5CMZ A;  3VP9 A;  1MV8 A;  1FOS F;  4AYC B;  2E6S A;  2Z4E A;  3GV4 A;  4B86 A;  3VOP A;  3DPL R;  4CCG X;  4R8P K;  5KLV K;  2A45 I;  1HWT C;  3RK2 B;  5AIT A;  2MT5 A;  3H6P A;  4WZ2 A;  1LTS C;  2A45 G;  4GND A;  4N78 D;  2QM7 A;  3RTR B;  5TDW A;  4PTB A;  2LGV A;  4N4F A;  5AVY B;  4IFD K;  1Z60 A;  1NWQ A;  2Y1N A;  1G1I A;  1URQ A;  4I2L C;  3HE4 A;  1NTK K;  1AQ5 A;  2ZET C;  4S3O B;  4C9Z A;  4WY4 A;  1CHC A;  5AW6 B;  4C7R A;  2ECG A;  2LN0 A;  2HDP A;  3O7A A;  2KRE A;  3VMZ A;  2OYH B;  3A7O A;  5EYA F;  4XI1 A;  3VN0 A;  2C9N Y;  2QM8 A;  5B79 A;  2OYI A;  3MHS A;  1NKN A;  4L7X A;  3M0A A;  4BHW A;  1HJB A;  2I1J A;  1KIL C;  4WBA A;  1T8Z A;  4LLH A;  2VJF B;  2YKP A;  5G05 B;  4AUQ B;  1GL2 C;  2VPE A;  2LGG A;  3SOW A;  2M3B A;  1Z56 A;  3GHG A;  2YO2 A;  1G2C B;  2GUV A;  3U5N A;  2KR4 A;  1LTB C;  1MZ9 A;  1SQB K;  1K2F A;  1FBM A;  3L11 A;  4DOJ A;  2VJE A;  4S3O C;  1G25 A;  2HPC A;  3NTN A;  2W6B A;  1G1J A;  2F42 A;  3MD0 A;  1KFM A;  3HD7 A;  1LDK C;  1RF0 C;  1X4I A;  3N9O A;  2C0W A;  2ECT A;  2JRJ A;  3L1X A;  1N87 A;  3MHH A;  5APV A;  3M63 A;  1URQ B;  3LQJ A;  2FYU K;  3HE4 B;  5LKU A;  2WTY A;  1RE3 C;  1HVV A;  3RPG C;  1LTJ B;  4LGD E;  4V3L C;  1JTH A;  1VPC A;  1IFD A;  2MD7 B;  3ZPV 1;  3P8C D;  2QIC A;  2OYI B;  1NHL A;  3BRV B;  2K4D A;  2CPB A;  4FK5 A;  4N3W A;  3U5O A;  3O35 A;  2GUS A;  4A4C A;  2WPR A;  4W80 A;  2P1J A;  1JNM A;  4ZQL A;  4UP0 A;  2W27 A;  2PP6 A;  3TNU B;  2JJL A;  4B7Y C;  4RES B;  3GHG B;  3SHB A;  2KU3 A;  4YC9 A;  3SWY A;  3TK1 A;  3M99 A;  2WPQ A;  2R32 A;  3M06 A;  3BRT B;  2MA5 A;  1J2J B;  4W7Y A;  5AVX B;  3N9M A;  2FXM A;  1LTJ C;  2LRI C;  3HD7 B;  2JMI A;  3V4W A;  4WA6 A;  3B5N A;  1KIL A;  2KYU A;  4AYC A;  2R3C A;  1L4A D;  1LDJ B;  1GL2 A;  3KQG A;  4MVT A;  1LTI C;  4GIF A;  4EOT A;  1XTC C;  1JTH B;  1A02 J;  2XZR A;  1MFZ A;  3H32 A;  5G0F A;  4A0C D;  2KWK A;  4BBQ A;  3HRN A;  1XWH A;  2OXQ C;  2ECV A;  4A49 A;  2HLO A;  2M85 A;  5CCG C;  5APW A;  2KSJ A;  3V2P A;  1PFI A;  2IPP A;  5AW7 B;  2M3H A;  1GU5 A;  4PPE A;  5H1U A;  1ZV8 A;  1M1J B;  4V3K C;  3T97 A;  1FP0 A;  3L35 A;  4R2Y A;  1IC2 A;  1LT9 C;  1NOH A;  1RF0 A;  1ZLL A;  4MSX A;  2ZXE B;  3II6 A;  1LWU B;  4UI9 B;  4TKP B;  5JG6 A;  2P2U A;  3L36 A;  2K1J A;  1X4J A;  4W4U A;  2CSZ A;  2WSF H;  3M9Q A;  4GB0 A;  2A45 H;  2GM4 A;  2YMY A;  1FDM A;  1MM2 A;  2L5U A;  1CW5 A;  1JOC A;  1CZQ A;  1RE3 A;  2HG5 D;  1E4U A;  1FBV A;  2AN6 A;  4M3L A;  3BVH A;  2VJF A;  5FER A;  1NTZ K;  3RK3 D;  2LGK A;  3C9I A;  3VP8 A;  1WGM A;  2KWN A;  5I3L A;  1L4A C;  3L37 A;  3U5M A;  1IFI A;  4WZ0 A;  1OWA A;  1N7S D;  1WEO A;  5KJ7 D;  5APU A;  3N9L A;  1RE4 C;  3QZV A;  1LTT C;  4GNE A;  4IFM A;  1HUC A;  4I6M C;  1SLQ A;  4P5O B;  1GL2 B;  2IX7 C;  5AVW B;  2E43 A;  1M1J C;  2EOD A;  1T2K D;  4Q6F A;  2MNZ A;  2MD8 C;  2C9L Y;  1ZR2 A;  5TDR A;  4DZO A;  1GK4 A;  1X79 B;  1LWU C;  3EFG A;  3H32 B;  2HYE D;  3M9B A;  2YUR A;  5AW4 B;  5LKX A;  2H0D A;  3KPE A;  1S9K E;  3N9N A;  1SQQ K;  1Z6U A;  2QJ0 A;  3L1Z B;  1L0L K;  1RF1 C;  5TAB A;  1LTJ A;  2PNX A;  4XE5 B;  3EB5 A;  4ZUX U;  1DX7 A;  3U1C A;  2ZFC A;  4LK9 A;  5CCH C;  3UIA A;  2MNY A;  3HE5 B;  3RK3 C;  1JUN A;  3RPG B;  2VRS A;  3N4X A;  2XB1 A;  5AVR B;  1JCD A;  5B78 A;  2WZ7 A;  2FFD C;  1N7S C;  2C2L A;  5KJ7 C;  3KQI A;  2YRE A;  3TNU A;  1J1D C;  2I1K A;  5AW8 B;  4R7E A;  4YBS A;  3MTU E;  2LXP C;  2WSC H;  1NU1 K;  3FL2 A;  3RL0 D;  4GKG A;  1GTW A;  2M8R A;  1E5W A;  1T2K C;  1WEP A;  2FYZ A;  1LT9 A;  2WWW A;  4GT1 A;  2KWJ A;  2JMD A;  5B77 A;  3NMD A;  3RL0 B;  4I7D A;  5B75 A;  1N7L A;  5C11 A;  2IFM A;  2N1T C;  4Y99 C;  1FOS E;  3I2D A;  1VFY A;  3U1A A;  3ZVY A;  2H0D B;  5D1L B;  2Q3I A;  1X8Y A;  4I7B A;  2FKW B;  2Q7C A;  1FU1 A;  2K17 A;  5AIU A;  1QL1 A;  2YKO A;  2F6N A;  5D1M B;  1L4A A;  2WPS A;  5G04 B;  4AQR D;  3I5C A;  2XEU A;  1KFN A;  4IC3 A;  3NFQ A;  1SVF A;  2L80 A;  3VMX A;  2D8S A;  2E42 A;  1FZG A;  1Z2Q A;  1HGZ A;  5BU8 B;  1HYJ A;  3ZPV E;  1M1J A;  3VK6 A;  1IJD B;  2R5D A;  1WE9 A;  4QF3 A;  5CJ0 A;  5CCG D;  1JY3 O;  3RL0 C;  2QIZ A;  3T7L A;  1LWU A;  1JCC A;  1WEV A;  4HH2 A;  1GDT A;  5H1T A;  2YSM A;  2VPB A;  1SFC D;  2HFE D;  4YBM A;  1RF1 A;  3P7K A;  4I7C A;  2YUC A;  3A2A A;  2YW8 A;  1LT9 B;  4FJC A;  1U6G B;  1MUU A;  3V2N A;  1FAV A;  1JMM A;  2O1J A;  2G45 A;  1VD4 A;  2LDR A;  3M62 A;  5LKZ A;  3WMM 0;  1KQL A;  2FSA A;  1JO5 A;  2Q5U A;  1S9K D;  4IFF A;  1IFN A;  2CKL B;  3VMY A;  1IYM A;  2FFD A;  1N7S A;  5KJ7 A;  3O34 A;  1FJK A;  5AW2 B;  2IDA A;  3DQV R;  3CI9 A;  3CLQ A;  1WEN A;  3KNV A;  3N9P A;  3ZNI A;  1L4A B;  4FIP A;  2ECW A;  5AW1 B;  1F62 A;  2KLV A;  1T3J A;  2BAS A;  4L58 A;  4LLB A;  1NAF A;  1YTZ I;  2XNX A;  5B76 A;  3TSI A;  4QF2 A;  1RY3 A;  2VP7 A;  3O37 A;  1LGH B;  4LAD B;  1J1E C;  1KZU B;  2YQM A;  4C7N A;  2RI7 A;  5TRB A;  1GW4 A;  5KH9 A;  1N73 C;  2F6J A;  2J58 A;  1SFC C;  1GZL A;  3MIW A;  3P8M C;  3EB6 A;  2O1K A;  1H89 A;  3O70 A;  2IFN A;  4AP4 A;  4AVX A;  4GNG A;  1ZN5 A;  1ZBD B;  5KH7 A;  3HE5 A;  1JY3 N;  3LQI A;  1RF1 B;  2HOD A;  3ASL A;  2XV5 A;  4XA4 A;  4KHX A;  5CCH D;  3ZVZ B;  2YHN A;  1HYI A;  3M0D C;  5APY A;  2J59 M;  4LJN A;  3VYI A;  2KP8 A;  1T3U A;  2L5G B;  2YO3 A;  3B8E B;  2DX8 A;  4W7Z A;  3RK3 B;  4ZDT A;  3PUQ A;  3LID A;  2WT7 B;  2H8P D;  5BVZ A;  1DH3 A;  2Y1M A;  4O64 A;  2FFD B;  2YYR A;  1SQX K;  1N7S B;  1VDF A;  5D1K B;  4A4B A;  3T6R A;  1J1D B;  2OAR A;  2Y43 A;  3OJA B;  3C5K A;  1NTM K;  2LKM A;  3V43 A;  3U5P A;  4LC1 A;  3PP5 A;  1V87 A;  2N1T D;  3B5N D;  4JYC A;  2WSE H;  2MIQ A;  2NAA A;  2P7J A;  1YYC A;  2M6M A;  4I1L A;  4C7N B;  4AUW A;  1VYX A;  3M91 A;  1WEQ A;  2N1T B;  1OXZ A;  1CI6 B;  3A3Y B;  4Y99 B;  3RK2 D;  5FEY A;  5APS A;  1N2D C;  2KE1 A;  1JY2 O;  3HCT A;  5DKA A;  3NG2 A;  5AW0 B;  2MA6 A;  5AW3 B;  3N7N A;  1YTZ T;  2HOD B;  5B8D A;  3GL6 A;  1FZC C;  3V2R A;  1JY3 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...