2UZGA

Zf-ubp domain of vdu1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'RNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 33
publication title The Solution Structure of the Znf Ubp Domain of Usp33/Vdu1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 95
sequence length 95
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2uzgA00
1JM7B 4PTBA 4LJNA 5D1LB 2FUUA 2F6JA 2KGIA 1K2FA 3U5MA 3U5NA 2DX8A 3SOXA 2Y43A 3N9QA 4V3KC 3ZVYA 5JG6A 1X4IA 5TBNA 3C6WA 2PUYA 4I7BA 5FB0A 1WIMA 2UZGA 5KH3A 4AYCB 4YABA 1WEMA 2MIQA 1WEWA 5TDRA 1WEQA 2IDAA 4P5OB 5B78A 2MD7B 3O35A 2F6NA 4GNFA 2EGPA 2YT5A 5LCWB 5H1UA 3O7AA 5I3LA 5G0FA 2KU3A 2KE1A 1G25A 2H0DA 2LXHC 2YUCA 1T1HA 2YQLA 3M63A 2KGGA 4UP0A 1CHCA 2VJEA 2M1RA 1FBVA 4A0CD 2F42A 3LQHA 3U5PA 2CSYA 2JMDA 3DPLR 2E6RA 3HCTA 2VJEB 2YQMA 2NAAA 1IYMA 3LQJA 3U5OA 3SOWA 2I50A 1V87A 2RSDA 2YSJA 4IC3A 2RI7A 3L1ZB 4YC9A 2CT2A 3ZPVE 5LKXA 2VP7A 3KV5A 1WEPA 4AUQB 5C11A 3N9PA 2YHOA 4B7YC 4L58A 1MM2A 3PHDA 1X4JA 1MM3A 4AP4A 2KWNA 3EB5A 4R2YA 4LK9A 2HYED 4YBMA 3KNVA 4ZQLA 2KWOA 5LKUA 3IHPA 1WEEA 4IC2A 2VJFA 4N3WA 2K1JA 4B86C 2LDRA 2AN6A 1XWHA 5H9MA 1WEOA 5AIUA 2KR4A 2EA6A 4GNDA 4I7DA 4AYCA 1WESA 3KQIA 2ECIA 1WENA 4FO9A 2XEUA 2VJFB 1Z60A 5LKTA 4C9ZA 4FIPA 2OXQC 4ZUXU 1Z2QA 4W4UA 5B75A 2K16A 2VPEA 3LQIA 4LKAA 4ZDTA 2JRJA 5TRBA 2C2VS 2JMJA 2LV9A 4LLBA 2MUMA 2FSAA 3T7LA 1WEUA 5J3XA 2CKLA 4QF2A 3N9NA 3GV4A 2D8SA 4Q6FA 2VPBA 4GNGA 2E6SA 2LN0A 2K17A 3DQVR 2VPDA 1LDKC 2G6QA 3ZVZB 3PUQA 1E4UA 2L80A 4WZ0A 1WEVA 4TKPB 4MVTA 2CKLB 1VYXA 1VD4A 2PNXA 2ECVA 3L11A 2JMIA 5B77A 3O70A 4I7CA 3EB6A 3VK6A 2VPGA 2KWKA 2MA5A 2ECGA 1DVPA 4UI9B 5B8DA 2ECTA 3RTRB 4O64A 3HCSA 2CSZA 5H1TA 4QF3A 2YURA 4GNEA 1ZBDB 2YYRA 2M85A 1JOCA 4BHWA 4R8PK 2YW8A 3V43A 1U6GB 2L43A 4YATA 3O36A 1FP0A 2YSMA 2ECJA 2L5UA 4LADB 2Y1NA 3L1XA 1X4UA 2YHNA 2M3HA 5FEYA 4CCGX 5KH9A 1Z6UA 1WFKA 2LGLA 1N87A 5B76A 1HYJA 2LGGA 2QJ0A 4GB0A 5G05B 2XB1A 3MHHA 4WZ2A 5LKZA 4R7EA 1BORA 2QICA 5H1VA 2ECWA 3GL6A 5TDWA 2KWJA 4S3OB 3M99A 2ECNA 5B79A 1WILA 4UP5A 2FUIA 3C5KA 3N9MA 1WE9A 2KREA 3ZTGA 4PPEA 1F62A 3ZYQA 2M6MA 4A4CA 3RPGC 3ASLA 1LDJB 3MHSA 4YADA 2MNZA 3ZPV1 1HYIA 4CA1A 2L0BA 3KV6A 4BBQA 2HDPA 3SOUA 4S3OC 3NG2A 1VFYA 5DINA 4XI1A 2K4DA 3O33A 2MNYA 4NN2A 4FJCA 2LQ6A 5FB1A 2L75A 2G43A 1RMDA 3QZVA 5G04B 3SHBA 4FK5A 2MD8C 4F52B 4YBSA 5FERA 3HCUA 2LRIC 2VNFA 2KYUA 3T6RA 4YAXA 2MA6A 4L7XA 4MSXA 2H0DB 3ZNIA 2LXPC 4V3LC 5DKAA 2EODA 2QIZA 2BAYA 2KFTA 3LRQA 4YBTA 5EYAF 2MT5A 3N9LA 3M62A 3O34A 4A49A 3HTKC 4A4BA 3O37A 3PURA 3FL2A 3I2DA 5TABA 4AVXA 3N9OA 2C2LA 2YU4A 2YREA 5D1MB 2LGVA 2KIZA 2G45A 2LGKA 2ZETC 5KH7A 4WZ3B 4X3GA 1JM7A 3RPGB 1WGMA 5C13A 4N4FA 5D1KB 2Y1MA 4WA6A 5AITA
chains in the Genus database with same CATH superfamily
1JM7B 4PTBA 2CSVA 4LJNA 5D1LB 2FUUA 2F6JA 2KGIA 3Q1DA 1K2FA 3U5MA 3U5NA 2DX8A 3SOXA 2Y43A 3N9QA 4V3KC 3ZVYA 3LJUX 2IQJA 5JG6A 1X4IA 5TBNA 4F1PA 3LDYA 3C6WA 2PUYA 4I7BA 5FB0A 1WIMA 2UZGA 5KH3A 4AYCB 4YABA 1WEMA 5K3QA 2MIQA 1WEWA 4QQ4A 5TDRA 1WEQA 2IDAA 4P5OB 5B78A 2MD7B 3O35A 2F6NA 4GNFA 2EGPA 2YT5A 5LCWB 5H1UA 3O7AA 5I3LA 5G0FA 2KU3A 2KE1A 2XP0A 1G25A 2H0DA 2LXHC 2YUCA 1T1HA 2YQLA 3M63A 2KGGA 4UP0A 3H7HA 1CHCA 2VJEA 3E2DA 2M1RA 1FBVA 4A0CD 2F42A 3LQHA 4OGCA 3U5PA 2CSYA 2JMDA 2JM3A 3JUEA 3DPLR 2E6RA 3HCTA 2VJEB 2LAUA 2YQMA 2NAAA 2YVRA 3FM8C 1IYMA 3LQJA 3U5OA 3SOWA 2I50A 1V87A 2RSDA 2YSJA 4IC3A 2RI7A 3L1ZB 2CT2A 4YC9A 3ZPVE 5LKXA 2VP7A 3KV5A 1WEPA 4AUQB 5C11A 3N9PA 2YHOA 4B7YC 4L58A 1MM2A 3PHDA 1X4JA 2FFWA 2EGMA 1MM3A 4AP4A 3PLWA 2KWNA 2XOCA 3EB5A 3DDTA 4R2YA 4LK9A 2HYED 4YBMA 3KNVA 4ZQLA 2KWOA 5LKUA 3FEHA 3IHPA 1WEEA 2OWAA 4IC2A 2VJFA 4N3WA 2K1JA 4B86C 2LDRA 2AN6A 1XWHA 5H9MA 1WEOA 5AIUA 2KR4A 2EA6A 4GNDA 4I7DA 4AYCA 1WESA 3MDBC 3KQIA 2JUNA 2ECIA 2P57A 1WENA 4FO9A 2XEUA 2VJFB 4O62A 1Z60A 5LKTA 4C9ZA 4FIPA 2OXQC 3T9KA 4ZUXU 1Z2QA 1DCQA 4W4UA 2XOYA 5B75A 2K16A 2VPEA 2CONA 3LQIA 2EXUA 4LKAA 2E61A 4ZDTA 2JRJA 2C2VS 2JMJA 2LV9A 4LLBA 5TRBA 2MUMA 4Z0OA 4H9DA 2FSAA 2DSMA 3T7LA 1WEUA 5SVIA 5J3XA 2CKLA 4QF2A 3N9NA 3GV4A 2D8SA 4Q6FA 2VPBA 4GNGA 2E6SA 2LN0A 2K17A 5SVYA 3DQVR 2VPDA 1LDKC 2G6QA 3ZVZB 3PUQA 1E4UA 2L80A 4WZ0A 3M7KA 1WEVA 4TKPB 5SVIB 4MVTA 3FAOA 2CKLB 1VYXA 1VD4A 2PNXA 2ECVA 3L11A 2JMIA 4Z0RA 5B77A 3O70A 4I7CA 3EB6A 3VK6A 2VPGA 2CRWA 2KWKA 2MA5A 2ECGA 2RR4A 1DVPA 4UI9B 5B8DA 5SVXA 2ECTA 3RTRB 4O64A 3HCSA 2CSZA 5H1TA 4QF3A 2YURA 4GNEA 1ZBDB 2YYRA 2M85A 1JOCA 4BHWA 2B0OE 4R8PK 2YW8A 3V43A 1U6GB 2L43A 4YATA 3O36A 1FP0A 2YSMA 2ECJA 2L5UA 4LADB 2Y1NA 3L1XA 1X4UA 2YHNA 2M3HA 3KDEC 5FEYA 4CCGX 5KH9A 3FANA 1Z6UA 1WFKA 2LGLA 1N87A 5B76A 2CRRA 2KKXA 2KKYA 1HYJA 2LGGA 2QJ0A 4GB0A 5G05B 2XB1A 3MHHA 4WZ2A 5LKZA 2MKEA 4R7EA 1BORA 2QICA 5H1VA 2ECWA 3GL6A 2D8UA 5TDWA 2KWJA 4S3OB 3M99A 2ECNA 5B79A 1WILA 4UP5A 2FUIA 3C5KA 3N9MA 1WE9A 2KREA 3SUBA 3ZTGA 4PPEA 1F62A 3LVQE 3ZYQA 2M6MA 4A4CA 3RPGC 3ASLA 1LDJB 3MHSA 4YADA 2MNZA 3ZPV1 1HYIA 4CA1A 2L0BA 3KV6A 4BBQA 2M13A 3DWDA 3O47A 2HDPA 3SOUA 4S3OC 3NG2A 1VFYA 5DINA 4XI1A 2K4DA 3O33A 2MNYA 4NN2A 4FJCA 2LQ6A 5FB1A 2L75A 2G43A 1RMDA 3QZVA 5G04B 3FJUB 3SHBA 4FK5A 2MD8C 4F52B 4YBSA 5FERA 3HCUA 2LRIC 2VNFA 2KYUA 3T6RA 4YAXA 2MA6A 4L7XA 2L7PA 4MSXA 2H0DB 3ZNIA 2LXPC 4V3LC 5DKAA 2EODA 2QIZA 2BAYA 2KFTA 3LRQA 4YBTA 5EYAF 2MT5A 3N9LA 3M62A 3O34A 4A49A 3HTKC 4A4BA 3O37A 2FD4A 3FL2A 3PURA 1MBMA 3I2DA 5TABA 4AVXA 3N9OA 2C2LA 4OGEA 2YU4A 2XOZA 2YREA 5D1MB 2LGVA 3LVRE 2KIZA 2G45A 2LGKA 2ZETC 5KH7A 4WZ3B 2DJAA 4X3GA 1JM7A 3RPGB 1WGMA 5C13A 4N4FA 5D1KB 2Y1MA 4WA6A 5AITA
chains in the Genus database with same CATH topology
1JM7B 4PTBA 4LJNA 5D1LB 2FUUA 2F6JA 2KGIA 1K2FA 3U5MA 3U5NA 2DX8A 3SOXA 2Y43A 3N9QA 4V3KC 3ZVYA 5JG6A 1X4IA 5TBNA 3C6WA 2PUYA 4I7BA 5FB0A 1WIMA 2UZGA 5KH3A 4AYCB 4YABA 1WEMA 2MIQA 1WEWA 5TDRA 1WEQA 2IDAA 4P5OB 5B78A 2MD7B 3O35A 2F6NA 4GNFA 2EGPA 2YT5A 5LCWB 5H1UA 3O7AA 5I3LA 5G0FA 2KU3A 2KE1A 1G25A 2H0DA 2LXHC 2YUCA 1T1HA 2YQLA 3M63A 2KGGA 4UP0A 1CHCA 2VJEA 2M1RA 1FBVA 4A0CD 2F42A 3LQHA 3U5PA 2CSYA 2JMDA 3DPLR 2E6RA 3HCTA 2VJEB 2YQMA 2NAAA 1IYMA 3LQJA 3U5OA 3SOWA 2I50A 1V87A 2RSDA 2YSJA 4IC3A 2RI7A 3L1ZB 4YC9A 2CT2A 3ZPVE 5LKXA 2VP7A 3KV5A 1WEPA 4AUQB 5C11A 3N9PA 2YHOA 4B7YC 4L58A 1MM2A 3PHDA 1X4JA 1MM3A 4AP4A 2KWNA 3EB5A 4R2YA 4LK9A 2HYED 4YBMA 3KNVA 4ZQLA 2KWOA 5LKUA 3IHPA 1WEEA 4IC2A 2VJFA 4N3WA 2K1JA 4B86C 2LDRA 2AN6A 1XWHA 5H9MA 1WEOA 5AIUA 2KR4A 2EA6A 4GNDA 4I7DA 4AYCA 1WESA 3KQIA 2ECIA 1WENA 4FO9A 2XEUA 2VJFB 1Z60A 5LKTA 4C9ZA 4FIPA 2OXQC 4ZUXU 1Z2QA 4W4UA 5B75A 2K16A 2VPEA 3LQIA 4LKAA 4ZDTA 2JRJA 5TRBA 2C2VS 2JMJA 2LV9A 4LLBA 2MUMA 2FSAA 3T7LA 1WEUA 5J3XA 2CKLA 4QF2A 3N9NA 3GV4A 2D8SA 4Q6FA 2VPBA 4GNGA 2E6SA 2LN0A 2K17A 3DQVR 2VPDA 1LDKC 2G6QA 3ZVZB 3PUQA 1E4UA 2L80A 4WZ0A 1WEVA 4TKPB 4MVTA 2CKLB 1VYXA 1VD4A 2PNXA 2ECVA 3L11A 2JMIA 5B77A 3O70A 4I7CA 3EB6A 3VK6A 2VPGA 2KWKA 2MA5A 2ECGA 1DVPA 4UI9B 5B8DA 2ECTA 3RTRB 4O64A 3HCSA 2CSZA 5H1TA 4QF3A 2YURA 4GNEA 1ZBDB 2YYRA 2M85A 1JOCA 4BHWA 4R8PK 2YW8A 3V43A 1U6GB 2L43A 4YATA 3O36A 1FP0A 2YSMA 2ECJA 2L5UA 4LADB 2Y1NA 3L1XA 1X4UA 2YHNA 2M3HA 5FEYA 4CCGX 5KH9A 1Z6UA 1WFKA 2LGLA 1N87A 5B76A 1HYJA 2LGGA 2QJ0A 4GB0A 5G05B 2XB1A 3MHHA 4WZ2A 5LKZA 4R7EA 1BORA 2QICA 5H1VA 2ECWA 3GL6A 5TDWA 2KWJA 4S3OB 3M99A 2ECNA 5B79A 1WILA 4UP5A 2FUIA 3C5KA 3N9MA 1WE9A 2KREA 3ZTGA 4PPEA 1F62A 3ZYQA 2M6MA 4A4CA 3RPGC 3ASLA 1LDJB 3MHSA 4YADA 2MNZA 3ZPV1 1HYIA 4CA1A 2L0BA 3KV6A 4BBQA 2HDPA 3SOUA 4S3OC 3NG2A 1VFYA 5DINA 4XI1A 2K4DA 3O33A 2MNYA 4NN2A 4FJCA 2LQ6A 5FB1A 2L75A 2G43A 1RMDA 3QZVA 5G04B 3SHBA 4FK5A 2MD8C 4F52B 4YBSA 5FERA 3HCUA 2LRIC 2VNFA 2KYUA 3T6RA 4YAXA 2MA6A 4L7XA 4MSXA 2H0DB 3ZNIA 2LXPC 4V3LC 5DKAA 2EODA 2QIZA 2BAYA 2KFTA 3LRQA 4YBTA 5EYAF 2MT5A 3N9LA 3M62A 3O34A 4A49A 3HTKC 4A4BA 3O37A 3PURA 3FL2A 3I2DA 5TABA 4AVXA 3N9OA 2C2LA 2YU4A 2YREA 5D1MB 2LGVA 2KIZA 2G45A 2LGKA 2ZETC 5KH7A 4WZ3B 4X3GA 1JM7A 3RPGB 1WGMA 5C13A 4N4FA 5D1KB 2Y1MA 4WA6A 5AITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JM7 B;  4PTB A;  4LJN A;  5D1L B;  2FUU A;  2F6J A;  2KGI A;  1K2F A;  3U5M A;  3U5N A;  2DX8 A;  3SOX A;  2Y43 A;  3N9Q A;  4V3K C;  3ZVY A;  5JG6 A;  1X4I A;  5TBN A;  3C6W A;  2PUY A;  4I7B A;  5FB0 A;  1WIM A;  2UZG A;  5KH3 A;  4AYC B;  4YAB A;  1WEM A;  2MIQ A;  1WEW A;  5TDR A;  1WEQ A;  2IDA A;  4P5O B;  5B78 A;  2MD7 B;  3O35 A;  2F6N A;  4GNF A;  2EGP A;  2YT5 A;  5LCW B;  5H1U A;  3O7A A;  5I3L A;  5G0F A;  2KU3 A;  2KE1 A;  1G25 A;  2H0D A;  2LXH C;  2YUC A;  1T1H A;  2YQL A;  3M63 A;  2KGG A;  4UP0 A;  1CHC A;  2VJE A;  2M1R A;  1FBV A;  4A0C D;  2F42 A;  3LQH A;  3U5P A;  2CSY A;  2JMD A;  3DPL R;  2E6R A;  3HCT A;  2VJE B;  2YQM A;  2NAA A;  1IYM A;  3LQJ A;  3U5O A;  3SOW A;  2I50 A;  1V87 A;  2RSD A;  2YSJ A;  4IC3 A;  2RI7 A;  3L1Z B;  4YC9 A;  2CT2 A;  3ZPV E;  5LKX A;  2VP7 A;  3KV5 A;  1WEP A;  4AUQ B;  5C11 A;  3N9P A;  2YHO A;  4B7Y C;  4L58 A;  1MM2 A;  3PHD A;  1X4J A;  1MM3 A;  4AP4 A;  2KWN A;  3EB5 A;  4R2Y A;  4LK9 A;  2HYE D;  4YBM A;  3KNV A;  4ZQL A;  2KWO A;  5LKU A;  3IHP A;  1WEE A;  4IC2 A;  2VJF A;  4N3W A;  2K1J A;  4B86 C;  2LDR A;  2AN6 A;  1XWH A;  5H9M A;  1WEO A;  5AIU A;  2KR4 A;  2EA6 A;  4GND A;  4I7D A;  4AYC A;  1WES A;  3KQI A;  2ECI A;  1WEN A;  4FO9 A;  2XEU A;  2VJF B;  1Z60 A;  5LKT A;  4C9Z A;  4FIP A;  2OXQ C;  4ZUX U;  1Z2Q A;  4W4U A;  5B75 A;  2K16 A;  2VPE A;  3LQI A;  4LKA A;  4ZDT A;  2JRJ A;  5TRB A;  2C2V S;  2JMJ A;  2LV9 A;  4LLB A;  2MUM A;  2FSA A;  3T7L A;  1WEU A;  5J3X A;  2CKL A;  4QF2 A;  3N9N A;  3GV4 A;  2D8S A;  4Q6F A;  2VPB A;  4GNG A;  2E6S A;  2LN0 A;  2K17 A;  3DQV R;  2VPD A;  1LDK C;  2G6Q A;  3ZVZ B;  3PUQ A;  1E4U A;  2L80 A;  4WZ0 A;  1WEV A;  4TKP B;  4MVT A;  2CKL B;  1VYX A;  1VD4 A;  2PNX A;  2ECV A;  3L11 A;  2JMI A;  5B77 A;  3O70 A;  4I7C A;  3EB6 A;  3VK6 A;  2VPG A;  2KWK A;  2MA5 A;  2ECG A;  1DVP A;  4UI9 B;  5B8D A;  2ECT A;  3RTR B;  4O64 A;  3HCS A;  2CSZ A;  5H1T A;  4QF3 A;  2YUR A;  4GNE A;  1ZBD B;  2YYR A;  2M85 A;  1JOC A;  4BHW A;  4R8P K;  2YW8 A;  3V43 A;  1U6G B;  2L43 A;  4YAT A;  3O36 A;  1FP0 A;  2YSM A;  2ECJ A;  2L5U A;  4LAD B;  2Y1N A;  3L1X A;  1X4U A;  2YHN A;  2M3H A;  5FEY A;  4CCG X;  5KH9 A;  1Z6U A;  1WFK A;  2LGL A;  1N87 A;  5B76 A;  1HYJ A;  2LGG A;  2QJ0 A;  4GB0 A;  5G05 B;  2XB1 A;  3MHH A;  4WZ2 A;  5LKZ A;  4R7E A;  1BOR A;  2QIC A;  5H1V A;  2ECW A;  3GL6 A;  5TDW A;  2KWJ A;  4S3O B;  3M99 A;  2ECN A;  5B79 A;  1WIL A;  4UP5 A;  2FUI A;  3C5K A;  3N9M A;  1WE9 A;  2KRE A;  3ZTG A;  4PPE A;  1F62 A;  3ZYQ A;  2M6M A;  4A4C A;  3RPG C;  3ASL A;  1LDJ B;  3MHS A;  4YAD A;  2MNZ A;  3ZPV 1;  1HYI A;  4CA1 A;  2L0B A;  3KV6 A;  4BBQ A;  2HDP A;  3SOU A;  4S3O C;  3NG2 A;  1VFY A;  5DIN A;  4XI1 A;  2K4D A;  3O33 A;  2MNY A;  4NN2 A;  4FJC A;  2LQ6 A;  5FB1 A;  2L75 A;  2G43 A;  1RMD A;  3QZV A;  5G04 B;  3SHB A;  4FK5 A;  2MD8 C;  4F52 B;  4YBS A;  5FER A;  3HCU A;  2LRI C;  2VNF A;  2KYU A;  3T6R A;  4YAX A;  2MA6 A;  4L7X A;  4MSX A;  2H0D B;  3ZNI A;  2LXP C;  4V3L C;  5DKA A;  2EOD A;  2QIZ A;  2BAY A;  2KFT A;  3LRQ A;  4YBT A;  5EYA F;  2MT5 A;  3N9L A;  3M62 A;  3O34 A;  4A49 A;  3HTK C;  4A4B A;  3O37 A;  3PUR A;  3FL2 A;  3I2D A;  5TAB A;  4AVX A;  3N9O A;  2C2L A;  2YU4 A;  2YRE A;  5D1M B;  2LGV A;  2KIZ A;  2G45 A;  2LGK A;  2ZET C;  5KH7 A;  4WZ3 B;  4X3G A;  1JM7 A;  3RPG B;  1WGM A;  5C13 A;  4N4F A;  5D1K B;  2Y1M A;  4WA6 A;  5AIT A; 
#chains in the Genus database with same CATH topology
 1JM7 B;  4PTB A;  2CSV A;  4LJN A;  5D1L B;  2FUU A;  2F6J A;  2KGI A;  3Q1D A;  1K2F A;  3U5M A;  3U5N A;  2DX8 A;  3SOX A;  2Y43 A;  3N9Q A;  4V3K C;  3ZVY A;  3LJU X;  2IQJ A;  5JG6 A;  1X4I A;  5TBN A;  4F1P A;  3LDY A;  3C6W A;  2PUY A;  4I7B A;  5FB0 A;  1WIM A;  2UZG A;  5KH3 A;  4AYC B;  4YAB A;  1WEM A;  5K3Q A;  2MIQ A;  1WEW A;  4QQ4 A;  5TDR A;  1WEQ A;  2IDA A;  4P5O B;  5B78 A;  2MD7 B;  3O35 A;  2F6N A;  4GNF A;  2EGP A;  2YT5 A;  5LCW B;  5H1U A;  3O7A A;  5I3L A;  5G0F A;  2KU3 A;  2KE1 A;  2XP0 A;  1G25 A;  2H0D A;  2LXH C;  2YUC A;  1T1H A;  2YQL A;  3M63 A;  2KGG A;  4UP0 A;  3H7H A;  1CHC A;  2VJE A;  3E2D A;  2M1R A;  1FBV A;  4A0C D;  2F42 A;  3LQH A;  4OGC A;  3U5P A;  2CSY A;  2JMD A;  2JM3 A;  3JUE A;  3DPL R;  2E6R A;  3HCT A;  2VJE B;  2LAU A;  2YQM A;  2NAA A;  2YVR A;  3FM8 C;  1IYM A;  3LQJ A;  3U5O A;  3SOW A;  2I50 A;  1V87 A;  2RSD A;  2YSJ A;  4IC3 A;  2RI7 A;  3L1Z B;  2CT2 A;  4YC9 A;  3ZPV E;  5LKX A;  2VP7 A;  3KV5 A;  1WEP A;  4AUQ B;  5C11 A;  3N9P A;  2YHO A;  4B7Y C;  4L58 A;  1MM2 A;  3PHD A;  1X4J A;  2FFW A;  2EGM A;  1MM3 A;  4AP4 A;  3PLW A;  2KWN A;  2XOC A;  3EB5 A;  3DDT A;  4R2Y A;  4LK9 A;  2HYE D;  4YBM A;  3KNV A;  4ZQL A;  2KWO A;  5LKU A;  3FEH A;  3IHP A;  1WEE A;  2OWA A;  4IC2 A;  2VJF A;  4N3W A;  2K1J A;  4B86 C;  2LDR A;  2AN6 A;  1XWH A;  5H9M A;  1WEO A;  5AIU A;  2KR4 A;  2EA6 A;  4GND A;  4I7D A;  4AYC A;  1WES A;  3MDB C;  3KQI A;  2JUN A;  2ECI A;  2P57 A;  1WEN A;  4FO9 A;  2XEU A;  2VJF B;  4O62 A;  1Z60 A;  5LKT A;  4C9Z A;  4FIP A;  2OXQ C;  3T9K A;  4ZUX U;  1Z2Q A;  1DCQ A;  4W4U A;  2XOY A;  5B75 A;  2K16 A;  2VPE A;  2CON A;  3LQI A;  2EXU A;  4LKA A;  2E61 A;  4ZDT A;  2JRJ A;  2C2V S;  2JMJ A;  2LV9 A;  4LLB A;  5TRB A;  2MUM A;  4Z0O A;  4H9D A;  2FSA A;  2DSM A;  3T7L A;  1WEU A;  5SVI A;  5J3X A;  2CKL A;  4QF2 A;  3N9N A;  3GV4 A;  2D8S A;  4Q6F A;  2VPB A;  4GNG A;  2E6S A;  2LN0 A;  2K17 A;  5SVY A;  3DQV R;  2VPD A;  1LDK C;  2G6Q A;  3ZVZ B;  3PUQ A;  1E4U A;  2L80 A;  4WZ0 A;  3M7K A;  1WEV A;  4TKP B;  5SVI B;  4MVT A;  3FAO A;  2CKL B;  1VYX A;  1VD4 A;  2PNX A;  2ECV A;  3L11 A;  2JMI A;  4Z0R A;  5B77 A;  3O70 A;  4I7C A;  3EB6 A;  3VK6 A;  2VPG A;  2CRW A;  2KWK A;  2MA5 A;  2ECG A;  2RR4 A;  1DVP A;  4UI9 B;  5B8D A;  5SVX A;  2ECT A;  3RTR B;  4O64 A;  3HCS A;  2CSZ A;  5H1T A;  4QF3 A;  2YUR A;  4GNE A;  1ZBD B;  2YYR A;  2M85 A;  1JOC A;  4BHW A;  2B0O E;  4R8P K;  2YW8 A;  3V43 A;  1U6G B;  2L43 A;  4YAT A;  3O36 A;  1FP0 A;  2YSM A;  2ECJ A;  2L5U A;  4LAD B;  2Y1N A;  3L1X A;  1X4U A;  2YHN A;  2M3H A;  3KDE C;  5FEY A;  4CCG X;  5KH9 A;  3FAN A;  1Z6U A;  1WFK A;  2LGL A;  1N87 A;  5B76 A;  2CRR A;  2KKX A;  2KKY A;  1HYJ A;  2LGG A;  2QJ0 A;  4GB0 A;  5G05 B;  2XB1 A;  3MHH A;  4WZ2 A;  5LKZ A;  2MKE A;  4R7E A;  1BOR A;  2QIC A;  5H1V A;  2ECW A;  3GL6 A;  2D8U A;  5TDW A;  2KWJ A;  4S3O B;  3M99 A;  2ECN A;  5B79 A;  1WIL A;  4UP5 A;  2FUI A;  3C5K A;  3N9M A;  1WE9 A;  2KRE A;  3SUB A;  3ZTG A;  4PPE A;  1F62 A;  3LVQ E;  3ZYQ A;  2M6M A;  4A4C A;  3RPG C;  3ASL A;  1LDJ B;  3MHS A;  4YAD A;  2MNZ A;  3ZPV 1;  1HYI A;  4CA1 A;  2L0B A;  3KV6 A;  4BBQ A;  2M13 A;  3DWD A;  3O47 A;  2HDP A;  3SOU A;  4S3O C;  3NG2 A;  1VFY A;  5DIN A;  4XI1 A;  2K4D A;  3O33 A;  2MNY A;  4NN2 A;  4FJC A;  2LQ6 A;  5FB1 A;  2L75 A;  2G43 A;  1RMD A;  3QZV A;  5G04 B;  3FJU B;  3SHB A;  4FK5 A;  2MD8 C;  4F52 B;  4YBS A;  5FER A;  3HCU A;  2LRI C;  2VNF A;  2KYU A;  3T6R A;  4YAX A;  2MA6 A;  4L7X A;  2L7P A;  4MSX A;  2H0D B;  3ZNI A;  2LXP C;  4V3L C;  5DKA A;  2EOD A;  2QIZ A;  2BAY A;  2KFT A;  3LRQ A;  4YBT A;  5EYA F;  2MT5 A;  3N9L A;  3M62 A;  3O34 A;  4A49 A;  3HTK C;  4A4B A;  3O37 A;  2FD4 A;  3FL2 A;  3PUR A;  1MBM A;  3I2D A;  5TAB A;  4AVX A;  3N9O A;  2C2L A;  4OGE A;  2YU4 A;  2XOZ A;  2YRE A;  5D1M B;  2LGV A;  3LVR E;  2KIZ A;  2G45 A;  2LGK A;  2ZET C;  5KH7 A;  4WZ3 B;  2DJA A;  4X3G A;  1JM7 A;  3RPG B;  1WGM A;  5C13 A;  4N4F A;  5D1K B;  2Y1M A;  4WA6 A;  5AIT A; 
#chains in the Genus database with same CATH homology
 1JM7 B;  4PTB A;  4LJN A;  5D1L B;  2FUU A;  2F6J A;  2KGI A;  1K2F A;  3U5M A;  3U5N A;  2DX8 A;  3SOX A;  2Y43 A;  3N9Q A;  4V3K C;  3ZVY A;  5JG6 A;  1X4I A;  5TBN A;  3C6W A;  2PUY A;  4I7B A;  5FB0 A;  1WIM A;  2UZG A;  5KH3 A;  4AYC B;  4YAB A;  1WEM A;  2MIQ A;  1WEW A;  5TDR A;  1WEQ A;  2IDA A;  4P5O B;  5B78 A;  2MD7 B;  3O35 A;  2F6N A;  4GNF A;  2EGP A;  2YT5 A;  5LCW B;  5H1U A;  3O7A A;  5I3L A;  5G0F A;  2KU3 A;  2KE1 A;  1G25 A;  2H0D A;  2LXH C;  2YUC A;  1T1H A;  2YQL A;  3M63 A;  2KGG A;  4UP0 A;  1CHC A;  2VJE A;  2M1R A;  1FBV A;  4A0C D;  2F42 A;  3LQH A;  3U5P A;  2CSY A;  2JMD A;  3DPL R;  2E6R A;  3HCT A;  2VJE B;  2YQM A;  2NAA A;  1IYM A;  3LQJ A;  3U5O A;  3SOW A;  2I50 A;  1V87 A;  2RSD A;  2YSJ A;  4IC3 A;  2RI7 A;  3L1Z B;  4YC9 A;  2CT2 A;  3ZPV E;  5LKX A;  2VP7 A;  3KV5 A;  1WEP A;  4AUQ B;  5C11 A;  3N9P A;  2YHO A;  4B7Y C;  4L58 A;  1MM2 A;  3PHD A;  1X4J A;  1MM3 A;  4AP4 A;  2KWN A;  3EB5 A;  4R2Y A;  4LK9 A;  2HYE D;  4YBM A;  3KNV A;  4ZQL A;  2KWO A;  5LKU A;  3IHP A;  1WEE A;  4IC2 A;  2VJF A;  4N3W A;  2K1J A;  4B86 C;  2LDR A;  2AN6 A;  1XWH A;  5H9M A;  1WEO A;  5AIU A;  2KR4 A;  2EA6 A;  4GND A;  4I7D A;  4AYC A;  1WES A;  3KQI A;  2ECI A;  1WEN A;  4FO9 A;  2XEU A;  2VJF B;  1Z60 A;  5LKT A;  4C9Z A;  4FIP A;  2OXQ C;  4ZUX U;  1Z2Q A;  4W4U A;  5B75 A;  2K16 A;  2VPE A;  3LQI A;  4LKA A;  4ZDT A;  2JRJ A;  5TRB A;  2C2V S;  2JMJ A;  2LV9 A;  4LLB A;  2MUM A;  2FSA A;  3T7L A;  1WEU A;  5J3X A;  2CKL A;  4QF2 A;  3N9N A;  3GV4 A;  2D8S A;  4Q6F A;  2VPB A;  4GNG A;  2E6S A;  2LN0 A;  2K17 A;  3DQV R;  2VPD A;  1LDK C;  2G6Q A;  3ZVZ B;  3PUQ A;  1E4U A;  2L80 A;  4WZ0 A;  1WEV A;  4TKP B;  4MVT A;  2CKL B;  1VYX A;  1VD4 A;  2PNX A;  2ECV A;  3L11 A;  2JMI A;  5B77 A;  3O70 A;  4I7C A;  3EB6 A;  3VK6 A;  2VPG A;  2KWK A;  2MA5 A;  2ECG A;  1DVP A;  4UI9 B;  5B8D A;  2ECT A;  3RTR B;  4O64 A;  3HCS A;  2CSZ A;  5H1T A;  4QF3 A;  2YUR A;  4GNE A;  1ZBD B;  2YYR A;  2M85 A;  1JOC A;  4BHW A;  4R8P K;  2YW8 A;  3V43 A;  1U6G B;  2L43 A;  4YAT A;  3O36 A;  1FP0 A;  2YSM A;  2ECJ A;  2L5U A;  4LAD B;  2Y1N A;  3L1X A;  1X4U A;  2YHN A;  2M3H A;  5FEY A;  4CCG X;  5KH9 A;  1Z6U A;  1WFK A;  2LGL A;  1N87 A;  5B76 A;  1HYJ A;  2LGG A;  2QJ0 A;  4GB0 A;  5G05 B;  2XB1 A;  3MHH A;  4WZ2 A;  5LKZ A;  4R7E A;  1BOR A;  2QIC A;  5H1V A;  2ECW A;  3GL6 A;  5TDW A;  2KWJ A;  4S3O B;  3M99 A;  2ECN A;  5B79 A;  1WIL A;  4UP5 A;  2FUI A;  3C5K A;  3N9M A;  1WE9 A;  2KRE A;  3ZTG A;  4PPE A;  1F62 A;  3ZYQ A;  2M6M A;  4A4C A;  3RPG C;  3ASL A;  1LDJ B;  3MHS A;  4YAD A;  2MNZ A;  3ZPV 1;  1HYI A;  4CA1 A;  2L0B A;  3KV6 A;  4BBQ A;  2HDP A;  3SOU A;  4S3O C;  3NG2 A;  1VFY A;  5DIN A;  4XI1 A;  2K4D A;  3O33 A;  2MNY A;  4NN2 A;  4FJC A;  2LQ6 A;  5FB1 A;  2L75 A;  2G43 A;  1RMD A;  3QZV A;  5G04 B;  3SHB A;  4FK5 A;  2MD8 C;  4F52 B;  4YBS A;  5FER A;  3HCU A;  2LRI C;  2VNF A;  2KYU A;  3T6R A;  4YAX A;  2MA6 A;  4L7X A;  4MSX A;  2H0D B;  3ZNI A;  2LXP C;  4V3L C;  5DKA A;  2EOD A;  2QIZ A;  2BAY A;  2KFT A;  3LRQ A;  4YBT A;  5EYA F;  2MT5 A;  3N9L A;  3M62 A;  3O34 A;  4A49 A;  3HTK C;  4A4B A;  3O37 A;  3PUR A;  3FL2 A;  3I2D A;  5TAB A;  4AVX A;  3N9O A;  2C2L A;  2YU4 A;  2YRE A;  5D1M B;  2LGV A;  2KIZ A;  2G45 A;  2LGK A;  2ZET C;  5KH7 A;  4WZ3 B;  4X3G A;  1JM7 A;  3RPG B;  1WGM A;  5C13 A;  4N4F A;  5D1K B;  2Y1M A;  4WA6 A;  5AIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...