2UZGA

Zf-ubp domain of vdu1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
RNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of the Znf Ubp Domain of Usp33/Vdu1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 33
total genus 17
structure length 95
sequence length 95
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2uzgA00
4R7EA 2UZGA 1G25A 3LRQA 3EB5A 1JM7B 5H1UA 2LGGA 2ECGA 5J3XA 2MA5A 1CHCA 3NG2A 4IC3A 4A4BA 4AP4A 4QF3A 4FIPA 2C2LA 4WZ2A 2LGVA 3N9LA 5KH3A 2ECNA 2H0DA 2KE1A 1VYXA 1T1HA 2ZETC 2LV9A 3N9QA 5D1KB 4N3WA 3O34A 4B7YC 2LGKA 2E6RA 2KIZA 4W4UA 3HCTA 4I7CA 3ZYQA 3L11A 1FP0A 2KWKA 2LDRA 2MD8C 4NN2A 4YC9A 4TKPB 2BAYA 3SOWA 2M85A 1WE9A 1N87A 4AVXA 1DVPA 2ECIA 2YSJA 1Z60A 3RTRB 4UP0A 2JMJA 3PHDA 2CKLA 2VPDA 2KU3A 2L5UA 3U5NA 4LLBA 2LRIC 2CSZA 2YQLA 4GNEA 1BORA 3VK6A 4BHWA 1HYIA 5LKXA 2OXQC 1WEPA 5G04B 5FERA 1WEVA 3LQJA 3N9NA 4YABA 2LN0A 1K2FA 2YSMA 2C2VS 4B86C 2YURA 3PUQA 2NAAA 1IYMA 2ECVA 1WFKA 4PTBA 3O70A 2QJ0A 1LDJB 3M99A 4YADA 5H1TA 4WZ3B 2EGPA 2PUYA 2K16A 2LQ6A 5G0FA 5B76A 5C13A 2XEUA 2MNYA 3PURA 2Y1NA 3N9PA 1JOCA 4ZQLA 2AN6A 4A4CA 3EB6A 4LK9A 3M62A 5FB0A 3RPGC 1X4JA 4MSXA 4GNGA 4S3OB 5AITA 1WGMA 2I50A 3FL2A 3V43A 2EA6A 1Z2QA 4GNFA 4A0CD 4X3GA 2LXPC 3M63A 4QF2A 2XB1A 3T6RA 3SHBA 1JM7A 2KGGA 3KV6A 4F52B 1Z6UA 3U5PA 2YUCA 1WEMA 2MA6A 2KWJA 5TDWA 3RPGB 2YW8A 2JMDA 5B8DA 2FUUA 3HCUA 3U5OA 5H1VA 4O64A 5LKTA 4WZ0A 3L1ZB 2MIQA 2VJEA 5B79A 2G43A 2K17A 2KFTA 2KYUA 3O7AA 1MM3A 3ASLA 4L58A 2H0DB 2YYRA 4ZUXU 2Y43A 5EYAF 2L43A 3C5KA 4AYCB 1U6GB 4V3LC 4BBQA 1WEEA 3QZVA 3C6WA 2MT5A 2CKLB 3MHSA 5LKZA 3ZNIA 2VJFB 2JMIA 2CT2A 1WESA 2DX8A 2MD7B 4C9ZA 5TBNA 1RMDA 2PNXA 4CCGX 3DQVR 4N4FA 2KGIA 3DPLR 4FJCA 5DKAA 1HYJA 3GL6A 2YU4A 1WENA 4P5OB 2YQMA 4R2YA 2VPEA 4MVTA 4Q6FA 4PPEA 5TDRA 3LQHA 4YBTA 3N9OA 1LDKC 1MM2A 2YREA 3O35A 4R8PK 4UI9B 2KREA 1E4UA 4GB0A 1X4UA 2VPGA 4CA1A 5D1LB 4YBSA 3ZVZB 2D8SA 1X4IA 3ZPVE 2QIZA 4IC2A 2M6MA 5KH7A 4AUQB 2K4DA 3O33A 2ECTA 2MNZA 4LJNA 4I7BA 2QICA 3O37A 3KV5A 5LCWB 2IDAA 5B77A 3IHPA 3KQIA 2E6SA 2RI7A 3T7LA 5B75A 5G05B 2ECJA 2YHOA 2KWOA 2HDPA 4YATA 1V87A 1WIMA 2L75A 4LADB 5TRBA 3GV4A 2JRJA 5D1MB 3ZPV1 1VD4A 4A49A 2F6NA 2L0BA 3HTKC 2HYED 5AIUA 3SOXA 1F62A 2F6JA 5C11A 5JG6A 2F42A 4S3OC 5I3LA 4ZDTA 2FSAA 4WA6A 2KR4A 2M3HA 2Y1MA 4YBMA 2G45A 5TABA 3N9MA 1WEWA 2YT5A 3KNVA 2CSYA 2L80A 3L1XA 4FO9A 5FB1A 2VNFA 4GNDA 2LGLA 4YAXA 2VPBA 5FEYA 1FBVA 2FUIA 1WEOA 2VJFA 1XWHA 1ZBDB 3O36A 2EODA 4L7XA 4I7DA 2G6QA 3ZTGA 2VJEB 2K1JA 3LQIA 4XI1A 4LKAA 3SOUA 1WEQA 2ECWA 5LKUA 3I2DA 4UP5A 2MUMA 4V3KC 2VP7A 3U5MA 4AYCA 3HCSA 3MHHA 5H9MA 2RSDA 5DINA 2M1RA 1WEUA 1VFYA 2YHNA 5KH9A 1WILA 3ZVYA 4FK5A 5B78A 2LXHC 2KWNA
chains in the Genus database with same CATH superfamily
4R7EA 2UZGA 1G25A 3LRQA 3EB5A 1JM7B 5K3QA 5H1UA 2LGGA 4Z0OA 2ECGA 5J3XA 2MA5A 1CHCA 3NG2A 2XP0A 4IC3A 4A4BA 4AP4A 4QF3A 4FIPA 2C2LA 4WZ2A 2LGVA 3N9LA 5KH3A 2ECNA 3M7KA 2D8UA 2H0DA 2KE1A 1VYXA 1T1HA 2ZETC 2LV9A 3N9QA 5D1KB 4N3WA 3O34A 4B7YC 2LGKA 2E6RA 2KIZA 3E2DA 4W4UA 3HCTA 4I7CA 3ZYQA 3L11A 1FP0A 2KWKA 2LDRA 4YC9A 4NN2A 2MD8C 4TKPB 2BAYA 3SOWA 2M85A 2DJAA 2CSVA 2E61A 1WE9A 1N87A 4AVXA 1DVPA 4H9DA 2ECIA 2YSJA 1Z60A 3JUEA 3H7HA 3RTRB 4UP0A 2JMJA 3PHDA 2CKLA 2VPDA 3FAOA 2KU3A 2L5UA 3U5NA 4LLBA 2LRIC 2CSZA 2YQLA 4GNEA 2CRWA 1BORA 3VK6A 4BHWA 1HYIA 5LKXA 2OXQC 1WEPA 2EGMA 5G04B 5FERA 1WEVA 3LQJA 3N9NA 4YABA 2LN0A 1K2FA 2YSMA 2C2VS 4B86C 2YURA 2DSMA 3PUQA 2NAAA 1IYMA 2ECVA 1WFKA 4PTBA 5SVIB 3O70A 2QJ0A 2XOYA 1LDJB 3M99A 4YADA 5H1TA 4WZ3B 3FANA 2EGPA 2PUYA 2K16A 2LQ6A 5G0FA 5B76A 5C13A 2XEUA 3MDBC 2MNYA 3PURA 2Y1NA 3N9PA 1JOCA 4ZQLA 2AN6A 4A4CA 3EB6A 4LK9A 3M62A 2XOCA 5FB0A 3RPGC 1X4JA 4Z0RA 2CONA 4MSXA 4GNGA 4S3OB 5AITA 1WGMA 2I50A 3FL2A 3V43A 2EA6A 1Z2QA 2JM3A 4GNFA 4A0CD 4X3GA 2LXPC 3M63A 4QF2A 2XOZA 2XB1A 3T6RA 3SHBA 3PLWA 1JM7A 2KGGA 3KV6A 4F52B 1Z6UA 3U5PA 2YUCA 3LVRE 1WEMA 2MA6A 2KWJA 5TDWA 4O62A 3RPGB 2YW8A 2JMDA 2B0OE 5B8DA 2FUUA 3HCUA 3U5OA 5H1VA 4O64A 5LKTA 4WZ0A 3L1ZB 2MIQA 2RR4A 2VJEA 5B79A 2G43A 2K17A 2KFTA 2KYUA 3O7AA 1MM3A 3ASLA 4L58A 2H0DB 2YYRA 4ZUXU 2Y43A 5EYAF 4QQ4A 2L43A 3C5KA 4AYCB 1U6GB 4V3LC 4BBQA 1WEEA 3QZVA 3C6WA 2MT5A 2CKLB 3MHSA 3O47A 5LKZA 3ZNIA 2VJFB 2JMIA 2CT2A 1WESA 2DX8A 2MD7B 4C9ZA 5TBNA 1RMDA 2PNXA 4CCGX 2EXUA 3DQVR 4N4FA 2KGIA 3FJUB 3DPLR 2FFWA 4FJCA 5DKAA 1HYJA 3GL6A 2YU4A 1MBMA 1WENA 4P5OB 4F1PA 2YQMA 4R2YA 2VPEA 4MVTA 4Q6FA 5SVXA 4PPEA 5TDRA 3LQHA 4YBTA 3N9OA 1LDKC 1MM2A 2YREA 3O35A 4R8PK 4UI9B 2KREA 3DDTA 1E4UA 4GB0A 5SVIA 1X4UA 1DCQA 2VPGA 4CA1A 2YVRA 5D1LB 4YBSA 3ZVZB 2D8SA 1X4IA 3ZPVE 5SVYA 2QIZA 4IC2A 2M6MA 5KH7A 4AUQB 2M13A 2K4DA 3O33A 2ECTA 3FM8C 2MNZA 4LJNA 4I7BA 2QICA 3O37A 3KV5A 5LCWB 3LDYA 2IDAA 5B77A 2LAUA 3IHPA 3KQIA 2E6SA 2RI7A 3T7LA 5B75A 5G05B 2ECJA 2YHOA 4OGEA 2KWOA 2HDPA 4YATA 1V87A 3LJUX 1WIMA 3DWDA 2L75A 4LADB 5TRBA 3GV4A 2P57A 2JRJA 5D1MB 3KDEC 3ZPV1 1VD4A 4A49A 2F6NA 2L0BA 3HTKC 2HYED 5AIUA 3SOXA 1F62A 2F6JA 5C11A 2KKYA 5JG6A 2F42A 4S3OC 5I3LA 4ZDTA 2FSAA 2IQJA 4WA6A 2KR4A 2MKEA 2M3HA 2Y1MA 4YBMA 2G45A 4OGCA 5TABA 3N9MA 1WEWA 2YT5A 3KNVA 2OWAA 2CSYA 2L80A 3L1XA 4FO9A 5FB1A 2VNFA 4GNDA 2LGLA 4YAXA 2VPBA 5FEYA 1FBVA 2FUIA 2KKXA 1WEOA 2VJFA 2CRRA 1XWHA 1ZBDB 3LVQE 3O36A 3Q1DA 2EODA 2FD4A 4L7XA 3SUBA 4I7DA 2G6QA 3ZTGA 2VJEB 2L7PA 2K1JA 3LQIA 4XI1A 4LKAA 3SOUA 1WEQA 2ECWA 5LKUA 3FEHA 3I2DA 4UP5A 2MUMA 4V3KC 2VP7A 3U5MA 4AYCA 3HCSA 3MHHA 5H9MA 2RSDA 5DINA 3T9KA 2JUNA 2M1RA 1WEUA 1VFYA 2YHNA 5KH9A 1WILA 3ZVYA 4FK5A 5B78A 2LXHC 2KWNA
chains in the Genus database with same CATH topology
4R7EA 2UZGA 1G25A 3LRQA 3EB5A 1JM7B 5H1UA 2LGGA 2ECGA 5J3XA 2MA5A 1CHCA 3NG2A 4IC3A 4A4BA 4AP4A 4QF3A 4FIPA 2C2LA 4WZ2A 2LGVA 3N9LA 5KH3A 2ECNA 2H0DA 2KE1A 1VYXA 1T1HA 2ZETC 2LV9A 3N9QA 5D1KB 4N3WA 3O34A 4B7YC 2LGKA 2E6RA 2KIZA 4W4UA 3HCTA 4I7CA 3ZYQA 3L11A 1FP0A 2KWKA 2LDRA 2MD8C 4NN2A 4YC9A 4TKPB 2BAYA 3SOWA 2M85A 1WE9A 1N87A 4AVXA 1DVPA 2ECIA 2YSJA 1Z60A 3RTRB 4UP0A 2JMJA 3PHDA 2CKLA 2VPDA 2KU3A 2L5UA 3U5NA 4LLBA 2LRIC 2CSZA 2YQLA 4GNEA 1BORA 3VK6A 4BHWA 1HYIA 5LKXA 2OXQC 1WEPA 5G04B 5FERA 1WEVA 3LQJA 3N9NA 4YABA 2LN0A 1K2FA 2YSMA 2C2VS 4B86C 2YURA 3PUQA 2NAAA 1IYMA 2ECVA 1WFKA 4PTBA 3O70A 2QJ0A 1LDJB 3M99A 4YADA 5H1TA 4WZ3B 2EGPA 2PUYA 2K16A 2LQ6A 5G0FA 5B76A 5C13A 2XEUA 2MNYA 3PURA 2Y1NA 3N9PA 1JOCA 4ZQLA 2AN6A 4A4CA 3EB6A 4LK9A 3M62A 5FB0A 3RPGC 1X4JA 4MSXA 4GNGA 4S3OB 5AITA 1WGMA 2I50A 3FL2A 3V43A 2EA6A 1Z2QA 4GNFA 4A0CD 4X3GA 2LXPC 3M63A 4QF2A 2XB1A 3T6RA 3SHBA 1JM7A 2KGGA 3KV6A 4F52B 1Z6UA 3U5PA 2YUCA 1WEMA 2MA6A 2KWJA 5TDWA 3RPGB 2YW8A 2JMDA 5B8DA 2FUUA 3HCUA 3U5OA 5H1VA 4O64A 5LKTA 4WZ0A 3L1ZB 2MIQA 2VJEA 5B79A 2G43A 2K17A 2KFTA 2KYUA 3O7AA 1MM3A 3ASLA 4L58A 2H0DB 2YYRA 4ZUXU 2Y43A 5EYAF 2L43A 3C5KA 4AYCB 1U6GB 4V3LC 4BBQA 1WEEA 3QZVA 3C6WA 2MT5A 2CKLB 3MHSA 5LKZA 3ZNIA 2VJFB 2JMIA 2CT2A 1WESA 2DX8A 2MD7B 4C9ZA 5TBNA 1RMDA 2PNXA 4CCGX 3DQVR 4N4FA 2KGIA 3DPLR 4FJCA 5DKAA 1HYJA 3GL6A 2YU4A 1WENA 4P5OB 2YQMA 4R2YA 2VPEA 4MVTA 4Q6FA 4PPEA 5TDRA 3LQHA 4YBTA 3N9OA 1LDKC 1MM2A 2YREA 3O35A 4R8PK 4UI9B 2KREA 1E4UA 4GB0A 1X4UA 2VPGA 4CA1A 5D1LB 4YBSA 3ZVZB 2D8SA 1X4IA 3ZPVE 2QIZA 4IC2A 2M6MA 5KH7A 4AUQB 2K4DA 3O33A 2ECTA 2MNZA 4LJNA 4I7BA 2QICA 3O37A 3KV5A 5LCWB 2IDAA 5B77A 3IHPA 3KQIA 2E6SA 2RI7A 3T7LA 5B75A 5G05B 2ECJA 2YHOA 2KWOA 2HDPA 4YATA 1V87A 1WIMA 2L75A 4LADB 5TRBA 3GV4A 2JRJA 5D1MB 3ZPV1 1VD4A 4A49A 2F6NA 2L0BA 3HTKC 2HYED 5AIUA 3SOXA 1F62A 2F6JA 5C11A 5JG6A 2F42A 4S3OC 5I3LA 4ZDTA 2FSAA 4WA6A 2KR4A 2M3HA 2Y1MA 4YBMA 2G45A 5TABA 3N9MA 1WEWA 2YT5A 3KNVA 2CSYA 2L80A 3L1XA 4FO9A 5FB1A 2VNFA 4GNDA 2LGLA 4YAXA 2VPBA 5FEYA 1FBVA 2FUIA 1WEOA 2VJFA 1XWHA 1ZBDB 3O36A 2EODA 4L7XA 4I7DA 2G6QA 3ZTGA 2VJEB 2K1JA 3LQIA 4XI1A 4LKAA 3SOUA 1WEQA 2ECWA 5LKUA 3I2DA 4UP5A 2MUMA 4V3KC 2VP7A 3U5MA 4AYCA 3HCSA 3MHHA 5H9MA 2RSDA 5DINA 2M1RA 1WEUA 1VFYA 2YHNA 5KH9A 1WILA 3ZVYA 4FK5A 5B78A 2LXHC 2KWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7E A;  2UZG A;  1G25 A;  3LRQ A;  3EB5 A;  1JM7 B;  5H1U A;  2LGG A;  2ECG A;  5J3X A;  2MA5 A;  1CHC A;  3NG2 A;  4IC3 A;  4A4B A;  4AP4 A;  4QF3 A;  4FIP A;  2C2L A;  4WZ2 A;  2LGV A;  3N9L A;  5KH3 A;  2ECN A;  2H0D A;  2KE1 A;  1VYX A;  1T1H A;  2ZET C;  2LV9 A;  3N9Q A;  5D1K B;  4N3W A;  3O34 A;  4B7Y C;  2LGK A;  2E6R A;  2KIZ A;  4W4U A;  3HCT A;  4I7C A;  3ZYQ A;  3L11 A;  1FP0 A;  2KWK A;  2LDR A;  2MD8 C;  4NN2 A;  4YC9 A;  4TKP B;  2BAY A;  3SOW A;  2M85 A;  1WE9 A;  1N87 A;  4AVX A;  1DVP A;  2ECI A;  2YSJ A;  1Z60 A;  3RTR B;  4UP0 A;  2JMJ A;  3PHD A;  2CKL A;  2VPD A;  2KU3 A;  2L5U A;  3U5N A;  4LLB A;  2LRI C;  2CSZ A;  2YQL A;  4GNE A;  1BOR A;  3VK6 A;  4BHW A;  1HYI A;  5LKX A;  2OXQ C;  1WEP A;  5G04 B;  5FER A;  1WEV A;  3LQJ A;  3N9N A;  4YAB A;  2LN0 A;  1K2F A;  2YSM A;  2C2V S;  4B86 C;  2YUR A;  3PUQ A;  2NAA A;  1IYM A;  2ECV A;  1WFK A;  4PTB A;  3O70 A;  2QJ0 A;  1LDJ B;  3M99 A;  4YAD A;  5H1T A;  4WZ3 B;  2EGP A;  2PUY A;  2K16 A;  2LQ6 A;  5G0F A;  5B76 A;  5C13 A;  2XEU A;  2MNY A;  3PUR A;  2Y1N A;  3N9P A;  1JOC A;  4ZQL A;  2AN6 A;  4A4C A;  3EB6 A;  4LK9 A;  3M62 A;  5FB0 A;  3RPG C;  1X4J A;  4MSX A;  4GNG A;  4S3O B;  5AIT A;  1WGM A;  2I50 A;  3FL2 A;  3V43 A;  2EA6 A;  1Z2Q A;  4GNF A;  4A0C D;  4X3G A;  2LXP C;  3M63 A;  4QF2 A;  2XB1 A;  3T6R A;  3SHB A;  1JM7 A;  2KGG A;  3KV6 A;  4F52 B;  1Z6U A;  3U5P A;  2YUC A;  1WEM A;  2MA6 A;  2KWJ A;  5TDW A;  3RPG B;  2YW8 A;  2JMD A;  5B8D A;  2FUU A;  3HCU A;  3U5O A;  5H1V A;  4O64 A;  5LKT A;  4WZ0 A;  3L1Z B;  2MIQ A;  2VJE A;  5B79 A;  2G43 A;  2K17 A;  2KFT A;  2KYU A;  3O7A A;  1MM3 A;  3ASL A;  4L58 A;  2H0D B;  2YYR A;  4ZUX U;  2Y43 A;  5EYA F;  2L43 A;  3C5K A;  4AYC B;  1U6G B;  4V3L C;  4BBQ A;  1WEE A;  3QZV A;  3C6W A;  2MT5 A;  2CKL B;  3MHS A;  5LKZ A;  3ZNI A;  2VJF B;  2JMI A;  2CT2 A;  1WES A;  2DX8 A;  2MD7 B;  4C9Z A;  5TBN A;  1RMD A;  2PNX A;  4CCG X;  3DQV R;  4N4F A;  2KGI A;  3DPL R;  4FJC A;  5DKA A;  1HYJ A;  3GL6 A;  2YU4 A;  1WEN A;  4P5O B;  2YQM A;  4R2Y A;  2VPE A;  4MVT A;  4Q6F A;  4PPE A;  5TDR A;  3LQH A;  4YBT A;  3N9O A;  1LDK C;  1MM2 A;  2YRE A;  3O35 A;  4R8P K;  4UI9 B;  2KRE A;  1E4U A;  4GB0 A;  1X4U A;  2VPG A;  4CA1 A;  5D1L B;  4YBS A;  3ZVZ B;  2D8S A;  1X4I A;  3ZPV E;  2QIZ A;  4IC2 A;  2M6M A;  5KH7 A;  4AUQ B;  2K4D A;  3O33 A;  2ECT A;  2MNZ A;  4LJN A;  4I7B A;  2QIC A;  3O37 A;  3KV5 A;  5LCW B;  2IDA A;  5B77 A;  3IHP A;  3KQI A;  2E6S A;  2RI7 A;  3T7L A;  5B75 A;  5G05 B;  2ECJ A;  2YHO A;  2KWO A;  2HDP A;  4YAT A;  1V87 A;  1WIM A;  2L75 A;  4LAD B;  5TRB A;  3GV4 A;  2JRJ A;  5D1M B;  3ZPV 1;  1VD4 A;  4A49 A;  2F6N A;  2L0B A;  3HTK C;  2HYE D;  5AIU A;  3SOX A;  1F62 A;  2F6J A;  5C11 A;  5JG6 A;  2F42 A;  4S3O C;  5I3L A;  4ZDT A;  2FSA A;  4WA6 A;  2KR4 A;  2M3H A;  2Y1M A;  4YBM A;  2G45 A;  5TAB A;  3N9M A;  1WEW A;  2YT5 A;  3KNV A;  2CSY A;  2L80 A;  3L1X A;  4FO9 A;  5FB1 A;  2VNF A;  4GND A;  2LGL A;  4YAX A;  2VPB A;  5FEY A;  1FBV A;  2FUI A;  1WEO A;  2VJF A;  1XWH A;  1ZBD B;  3O36 A;  2EOD A;  4L7X A;  4I7D A;  2G6Q A;  3ZTG A;  2VJE B;  2K1J A;  3LQI A;  4XI1 A;  4LKA A;  3SOU A;  1WEQ A;  2ECW A;  5LKU A;  3I2D A;  4UP5 A;  2MUM A;  4V3K C;  2VP7 A;  3U5M A;  4AYC A;  3HCS A;  3MHH A;  5H9M A;  2RSD A;  5DIN A;  2M1R A;  1WEU A;  1VFY A;  2YHN A;  5KH9 A;  1WIL A;  3ZVY A;  4FK5 A;  5B78 A;  2LXH C;  2KWN A; 
#chains in the Genus database with same CATH topology
 4R7E A;  2UZG A;  1G25 A;  3LRQ A;  3EB5 A;  1JM7 B;  5K3Q A;  5H1U A;  2LGG A;  4Z0O A;  2ECG A;  5J3X A;  2MA5 A;  1CHC A;  3NG2 A;  2XP0 A;  4IC3 A;  4A4B A;  4AP4 A;  4QF3 A;  4FIP A;  2C2L A;  4WZ2 A;  2LGV A;  3N9L A;  5KH3 A;  2ECN A;  3M7K A;  2D8U A;  2H0D A;  2KE1 A;  1VYX A;  1T1H A;  2ZET C;  2LV9 A;  3N9Q A;  5D1K B;  4N3W A;  3O34 A;  4B7Y C;  2LGK A;  2E6R A;  2KIZ A;  3E2D A;  4W4U A;  3HCT A;  4I7C A;  3ZYQ A;  3L11 A;  1FP0 A;  2KWK A;  2LDR A;  4YC9 A;  4NN2 A;  2MD8 C;  4TKP B;  2BAY A;  3SOW A;  2M85 A;  2DJA A;  2CSV A;  2E61 A;  1WE9 A;  1N87 A;  4AVX A;  1DVP A;  4H9D A;  2ECI A;  2YSJ A;  1Z60 A;  3JUE A;  3H7H A;  3RTR B;  4UP0 A;  2JMJ A;  3PHD A;  2CKL A;  2VPD A;  3FAO A;  2KU3 A;  2L5U A;  3U5N A;  4LLB A;  2LRI C;  2CSZ A;  2YQL A;  4GNE A;  2CRW A;  1BOR A;  3VK6 A;  4BHW A;  1HYI A;  5LKX A;  2OXQ C;  1WEP A;  2EGM A;  5G04 B;  5FER A;  1WEV A;  3LQJ A;  3N9N A;  4YAB A;  2LN0 A;  1K2F A;  2YSM A;  2C2V S;  4B86 C;  2YUR A;  2DSM A;  3PUQ A;  2NAA A;  1IYM A;  2ECV A;  1WFK A;  4PTB A;  5SVI B;  3O70 A;  2QJ0 A;  2XOY A;  1LDJ B;  3M99 A;  4YAD A;  5H1T A;  4WZ3 B;  3FAN A;  2EGP A;  2PUY A;  2K16 A;  2LQ6 A;  5G0F A;  5B76 A;  5C13 A;  2XEU A;  3MDB C;  2MNY A;  3PUR A;  2Y1N A;  3N9P A;  1JOC A;  4ZQL A;  2AN6 A;  4A4C A;  3EB6 A;  4LK9 A;  3M62 A;  2XOC A;  5FB0 A;  3RPG C;  1X4J A;  4Z0R A;  2CON A;  4MSX A;  4GNG A;  4S3O B;  5AIT A;  1WGM A;  2I50 A;  3FL2 A;  3V43 A;  2EA6 A;  1Z2Q A;  2JM3 A;  4GNF A;  4A0C D;  4X3G A;  2LXP C;  3M63 A;  4QF2 A;  2XOZ A;  2XB1 A;  3T6R A;  3SHB A;  3PLW A;  1JM7 A;  2KGG A;  3KV6 A;  4F52 B;  1Z6U A;  3U5P A;  2YUC A;  3LVR E;  1WEM A;  2MA6 A;  2KWJ A;  5TDW A;  4O62 A;  3RPG B;  2YW8 A;  2JMD A;  2B0O E;  5B8D A;  2FUU A;  3HCU A;  3U5O A;  5H1V A;  4O64 A;  5LKT A;  4WZ0 A;  3L1Z B;  2MIQ A;  2RR4 A;  2VJE A;  5B79 A;  2G43 A;  2K17 A;  2KFT A;  2KYU A;  3O7A A;  1MM3 A;  3ASL A;  4L58 A;  2H0D B;  2YYR A;  4ZUX U;  2Y43 A;  5EYA F;  4QQ4 A;  2L43 A;  3C5K A;  4AYC B;  1U6G B;  4V3L C;  4BBQ A;  1WEE A;  3QZV A;  3C6W A;  2MT5 A;  2CKL B;  3MHS A;  3O47 A;  5LKZ A;  3ZNI A;  2VJF B;  2JMI A;  2CT2 A;  1WES A;  2DX8 A;  2MD7 B;  4C9Z A;  5TBN A;  1RMD A;  2PNX A;  4CCG X;  2EXU A;  3DQV R;  4N4F A;  2KGI A;  3FJU B;  3DPL R;  2FFW A;  4FJC A;  5DKA A;  1HYJ A;  3GL6 A;  2YU4 A;  1MBM A;  1WEN A;  4P5O B;  4F1P A;  2YQM A;  4R2Y A;  2VPE A;  4MVT A;  4Q6F A;  5SVX A;  4PPE A;  5TDR A;  3LQH A;  4YBT A;  3N9O A;  1LDK C;  1MM2 A;  2YRE A;  3O35 A;  4R8P K;  4UI9 B;  2KRE A;  3DDT A;  1E4U A;  4GB0 A;  5SVI A;  1X4U A;  1DCQ A;  2VPG A;  4CA1 A;  2YVR A;  5D1L B;  4YBS A;  3ZVZ B;  2D8S A;  1X4I A;  3ZPV E;  5SVY A;  2QIZ A;  4IC2 A;  2M6M A;  5KH7 A;  4AUQ B;  2M13 A;  2K4D A;  3O33 A;  2ECT A;  3FM8 C;  2MNZ A;  4LJN A;  4I7B A;  2QIC A;  3O37 A;  3KV5 A;  5LCW B;  3LDY A;  2IDA A;  5B77 A;  2LAU A;  3IHP A;  3KQI A;  2E6S A;  2RI7 A;  3T7L A;  5B75 A;  5G05 B;  2ECJ A;  2YHO A;  4OGE A;  2KWO A;  2HDP A;  4YAT A;  1V87 A;  3LJU X;  1WIM A;  3DWD A;  2L75 A;  4LAD B;  5TRB A;  3GV4 A;  2P57 A;  2JRJ A;  5D1M B;  3KDE C;  3ZPV 1;  1VD4 A;  4A49 A;  2F6N A;  2L0B A;  3HTK C;  2HYE D;  5AIU A;  3SOX A;  1F62 A;  2F6J A;  5C11 A;  2KKY A;  5JG6 A;  2F42 A;  4S3O C;  5I3L A;  4ZDT A;  2FSA A;  2IQJ A;  4WA6 A;  2KR4 A;  2MKE A;  2M3H A;  2Y1M A;  4YBM A;  2G45 A;  4OGC A;  5TAB A;  3N9M A;  1WEW A;  2YT5 A;  3KNV A;  2OWA A;  2CSY A;  2L80 A;  3L1X A;  4FO9 A;  5FB1 A;  2VNF A;  4GND A;  2LGL A;  4YAX A;  2VPB A;  5FEY A;  1FBV A;  2FUI A;  2KKX A;  1WEO A;  2VJF A;  2CRR A;  1XWH A;  1ZBD B;  3LVQ E;  3O36 A;  3Q1D A;  2EOD A;  2FD4 A;  4L7X A;  3SUB A;  4I7D A;  2G6Q A;  3ZTG A;  2VJE B;  2L7P A;  2K1J A;  3LQI A;  4XI1 A;  4LKA A;  3SOU A;  1WEQ A;  2ECW A;  5LKU A;  3FEH A;  3I2D A;  4UP5 A;  2MUM A;  4V3K C;  2VP7 A;  3U5M A;  4AYC A;  3HCS A;  3MHH A;  5H9M A;  2RSD A;  5DIN A;  3T9K A;  2JUN A;  2M1R A;  1WEU A;  1VFY A;  2YHN A;  5KH9 A;  1WIL A;  3ZVY A;  4FK5 A;  5B78 A;  2LXH C;  2KWN A; 
#chains in the Genus database with same CATH homology
 4R7E A;  2UZG A;  1G25 A;  3LRQ A;  3EB5 A;  1JM7 B;  5H1U A;  2LGG A;  2ECG A;  5J3X A;  2MA5 A;  1CHC A;  3NG2 A;  4IC3 A;  4A4B A;  4AP4 A;  4QF3 A;  4FIP A;  2C2L A;  4WZ2 A;  2LGV A;  3N9L A;  5KH3 A;  2ECN A;  2H0D A;  2KE1 A;  1VYX A;  1T1H A;  2ZET C;  2LV9 A;  3N9Q A;  5D1K B;  4N3W A;  3O34 A;  4B7Y C;  2LGK A;  2E6R A;  2KIZ A;  4W4U A;  3HCT A;  4I7C A;  3ZYQ A;  3L11 A;  1FP0 A;  2KWK A;  2LDR A;  2MD8 C;  4NN2 A;  4YC9 A;  4TKP B;  2BAY A;  3SOW A;  2M85 A;  1WE9 A;  1N87 A;  4AVX A;  1DVP A;  2ECI A;  2YSJ A;  1Z60 A;  3RTR B;  4UP0 A;  2JMJ A;  3PHD A;  2CKL A;  2VPD A;  2KU3 A;  2L5U A;  3U5N A;  4LLB A;  2LRI C;  2CSZ A;  2YQL A;  4GNE A;  1BOR A;  3VK6 A;  4BHW A;  1HYI A;  5LKX A;  2OXQ C;  1WEP A;  5G04 B;  5FER A;  1WEV A;  3LQJ A;  3N9N A;  4YAB A;  2LN0 A;  1K2F A;  2YSM A;  2C2V S;  4B86 C;  2YUR A;  3PUQ A;  2NAA A;  1IYM A;  2ECV A;  1WFK A;  4PTB A;  3O70 A;  2QJ0 A;  1LDJ B;  3M99 A;  4YAD A;  5H1T A;  4WZ3 B;  2EGP A;  2PUY A;  2K16 A;  2LQ6 A;  5G0F A;  5B76 A;  5C13 A;  2XEU A;  2MNY A;  3PUR A;  2Y1N A;  3N9P A;  1JOC A;  4ZQL A;  2AN6 A;  4A4C A;  3EB6 A;  4LK9 A;  3M62 A;  5FB0 A;  3RPG C;  1X4J A;  4MSX A;  4GNG A;  4S3O B;  5AIT A;  1WGM A;  2I50 A;  3FL2 A;  3V43 A;  2EA6 A;  1Z2Q A;  4GNF A;  4A0C D;  4X3G A;  2LXP C;  3M63 A;  4QF2 A;  2XB1 A;  3T6R A;  3SHB A;  1JM7 A;  2KGG A;  3KV6 A;  4F52 B;  1Z6U A;  3U5P A;  2YUC A;  1WEM A;  2MA6 A;  2KWJ A;  5TDW A;  3RPG B;  2YW8 A;  2JMD A;  5B8D A;  2FUU A;  3HCU A;  3U5O A;  5H1V A;  4O64 A;  5LKT A;  4WZ0 A;  3L1Z B;  2MIQ A;  2VJE A;  5B79 A;  2G43 A;  2K17 A;  2KFT A;  2KYU A;  3O7A A;  1MM3 A;  3ASL A;  4L58 A;  2H0D B;  2YYR A;  4ZUX U;  2Y43 A;  5EYA F;  2L43 A;  3C5K A;  4AYC B;  1U6G B;  4V3L C;  4BBQ A;  1WEE A;  3QZV A;  3C6W A;  2MT5 A;  2CKL B;  3MHS A;  5LKZ A;  3ZNI A;  2VJF B;  2JMI A;  2CT2 A;  1WES A;  2DX8 A;  2MD7 B;  4C9Z A;  5TBN A;  1RMD A;  2PNX A;  4CCG X;  3DQV R;  4N4F A;  2KGI A;  3DPL R;  4FJC A;  5DKA A;  1HYJ A;  3GL6 A;  2YU4 A;  1WEN A;  4P5O B;  2YQM A;  4R2Y A;  2VPE A;  4MVT A;  4Q6F A;  4PPE A;  5TDR A;  3LQH A;  4YBT A;  3N9O A;  1LDK C;  1MM2 A;  2YRE A;  3O35 A;  4R8P K;  4UI9 B;  2KRE A;  1E4U A;  4GB0 A;  1X4U A;  2VPG A;  4CA1 A;  5D1L B;  4YBS A;  3ZVZ B;  2D8S A;  1X4I A;  3ZPV E;  2QIZ A;  4IC2 A;  2M6M A;  5KH7 A;  4AUQ B;  2K4D A;  3O33 A;  2ECT A;  2MNZ A;  4LJN A;  4I7B A;  2QIC A;  3O37 A;  3KV5 A;  5LCW B;  2IDA A;  5B77 A;  3IHP A;  3KQI A;  2E6S A;  2RI7 A;  3T7L A;  5B75 A;  5G05 B;  2ECJ A;  2YHO A;  2KWO A;  2HDP A;  4YAT A;  1V87 A;  1WIM A;  2L75 A;  4LAD B;  5TRB A;  3GV4 A;  2JRJ A;  5D1M B;  3ZPV 1;  1VD4 A;  4A49 A;  2F6N A;  2L0B A;  3HTK C;  2HYE D;  5AIU A;  3SOX A;  1F62 A;  2F6J A;  5C11 A;  5JG6 A;  2F42 A;  4S3O C;  5I3L A;  4ZDT A;  2FSA A;  4WA6 A;  2KR4 A;  2M3H A;  2Y1M A;  4YBM A;  2G45 A;  5TAB A;  3N9M A;  1WEW A;  2YT5 A;  3KNV A;  2CSY A;  2L80 A;  3L1X A;  4FO9 A;  5FB1 A;  2VNF A;  4GND A;  2LGL A;  4YAX A;  2VPB A;  5FEY A;  1FBV A;  2FUI A;  1WEO A;  2VJF A;  1XWH A;  1ZBD B;  3O36 A;  2EOD A;  4L7X A;  4I7D A;  2G6Q A;  3ZTG A;  2VJE B;  2K1J A;  3LQI A;  4XI1 A;  4LKA A;  3SOU A;  1WEQ A;  2ECW A;  5LKU A;  3I2D A;  4UP5 A;  2MUM A;  4V3K C;  2VP7 A;  3U5M A;  4AYC A;  3HCS A;  3MHH A;  5H9M A;  2RSD A;  5DIN A;  2M1R A;  1WEU A;  1VFY A;  2YHN A;  5KH9 A;  1WIL A;  3ZVY A;  4FK5 A;  5B78 A;  2LXH C;  2KWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...