2UZGA

Zf-ubp domain of vdu1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
RNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of the Znf Ubp Domain of Usp33/Vdu1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 33
total genus 17
structure length 95
sequence length 95
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2uzgA00
1LDKC 3N9QA 3N9OA 2KWNA 1V87A 2YSMA 3GV4A 4IC2A 2MA6A 4MVTA 5B8DA 1WGMA 4YATA 2YQLA 3QZVA 1X4IA 4BHWA 2LGLA 5D1KB 1X4UA 4TKPB 4X3GA 3U5PA 1HYJA 2YHOA 4IC3A 5TBNA 4YAXA 2PUYA 3M63A 1Z6UA 2LGVA 1FP0A 1FBVA 1MM3A 3KV5A 5FB1A 2XEUA 2F6NA 2KFTA 2YT5A 4WA6A 5JG6A 5H1UA 5KH3A 5LKTA 3HTKC 2HDPA 4B7YC 4AYCB 2ECVA 2L80A 2JMDA 2G6QA 1WFKA 1N87A 4WZ3B 2MD8C 3N9NA 4LLBA 2CKLB 2FSAA 5G05B 3MHHA 2IDAA 2MIQA 3ZTGA 2Y1MA 3DPLR 3ZVYA 1VYXA 2KE1A 3HCSA 3LQIA 5C13A 3IHPA 3PURA 2F6JA 5C11A 5AIUA 1F62A 3ZPVE 2KWKA 2LDRA 5D1LB 2E6SA 1WESA 5LKZA 4R8PK 2YHNA 2JMJA 2ECNA 3U5MA 3C5KA 1BORA 4GNDA 1DVPA 3SOXA 2KWJA 5LKUA 4I7DA 2G43A 2KU3A 2L0BA 2CSZA 2QICA 1WE9A 2VP7A 5DINA 2ECJA 3LRQA 3DQVR 4S3OB 2M3HA 5J3XA 2MNZA 3C6WA 3L1ZB 2MUMA 2ECTA 2ZETC 2K17A 5G04B 4WZ0A 2KGGA 2M1RA 3U5OA 1CHCA 4CCGX 2JMIA 4QF3A 4B86C 1JM7B 3VK6A 4YBSA 2LXPC 2Y43A 5LKXA 2LRIC 4AVXA 3ZPV1 3HCTA 2VPBA 5H9MA 4PPEA 2D8SA 4XI1A 4L58A 1WEUA 2MNYA 4GNFA 3ASLA 2G45A 1WENA 4L7XA 2KGIA 1WEEA 5B77A 5FEYA 5B75A 4ZDTA 2VJEB 5FB0A 3FL2A 3O36A 4BBQA 1IYMA 5KH9A 1VD4A 4CA1A 2VPEA 3T7LA 2EGPA 2VJFA 3KV6A 5TABA 2KWOA 4Q6FA 4UP0A 3O34A 2M6MA 4FK5A 2LQ6A 4N3WA 5B78A 2YREA 1G25A 2VPGA 4A49A 2FUIA 2L5UA 2YSJA 1K2FA 5I3LA 2ECWA 3SHBA 4A4CA 4LADB 4MSXA 5TDRA 3N9MA 2KREA 3L1XA 2RSDA 3L11A 3HCUA 2EODA 2I50A 3RTRB 3O33A 2MT5A 3RPGB 4NN2A 2KR4A 2QJ0A 2LN0A 1XWHA 1U6GB 4P5OB 4V3KC 2MD7B 3KNVA 1WEWA 4PTBA 3V43A 1MM2A 3KQIA 2Y1NA 4R7EA 2KYUA 1E4UA 2RI7A 2YYRA 2ECGA 4I7BA 2JRJA 5LCWB 2H0DA 2VNFA 4GNEA 1WIMA 2XB1A 3T6RA 4YADA 5G0FA 5KH7A 4C9ZA 2VJFB 2C2LA 2AN6A 2F42A 5DKAA 2BAYA 5H1TA 3MHSA 4YBTA 2C2VS 4ZQLA 4FJCA 4O64A 2DX8A 2CSYA 2YURA 1X4JA 2ECIA 1Z2QA 3U5NA 4ZUXU 3EB6A 4GNGA 3ZNIA 4YC9A 3ZVZB 4A0CD 1WEMA 2L43A 2L75A 4YBMA 4AP4A 2LGGA 2LXHC 2YQMA 2CT2A 4N4FA 2M85A 3RPGC 1HYIA 4YABA 1T1HA 1WEQA 3O37A 3GL6A 5D1MB 4F52B 4FIPA 2KIZA 1JM7A 4W4UA 2YUCA 3N9PA 3O7AA 3M62A 1VFYA 3I2DA 2FUUA 2HYED 1WILA 3O70A 4AYCA 4LK9A 4QF2A 3SOUA 2UZGA 3SOWA 5EYAF 4AUQB 3LQJA 2OXQC 2K4DA 1WEVA 4V3LC 4FO9A 3NG2A 4LJNA 3LQHA 1LDJB 5FERA 1JOCA 4I7CA 4GB0A 2K16A 3M99A 4WZ2A 2E6RA 2H0DB 3N9LA 3PHDA 2K1JA 5TDWA 1RMDA 2EA6A 4UP5A 4S3OC 2NAAA 2MA5A 2YU4A 2YW8A 2VJEA 5AITA 1WEOA 4R2YA 4A4BA 2LV9A 2LGKA 3O35A 1WEPA 5B76A 2PNXA 5B79A 1ZBDB 5H1VA 3EB5A 4LKAA 3ZYQA 2CKLA 2QIZA 1Z60A 2VPDA 5TRBA 3PUQA 4UI9B
chains in the Genus database with same CATH superfamily
1LDKC 3N9QA 3N9OA 2KWNA 1V87A 2YSMA 3GV4A 3FANA 4IC2A 2MA6A 4MVTA 5B8DA 1WGMA 4YATA 2DJAA 2YQLA 2XP0A 3QZVA 1X4IA 4BHWA 2LGLA 5D1KB 1X4UA 4TKPB 2EGMA 4X3GA 3U5PA 1HYJA 2YHOA 4IC3A 5TBNA 4QQ4A 4YAXA 2PUYA 3M63A 1Z6UA 2LGVA 3KDEC 1FP0A 1FBVA 1MM3A 3KV5A 5FB1A 4Z0RA 2XEUA 2F6NA 2KFTA 2YT5A 4OGCA 4WA6A 2FD4A 5JG6A 5H1UA 5KH3A 5LKTA 3HTKC 2HDPA 4B7YC 4AYCB 2ECVA 2L80A 2JMDA 2G6QA 1WFKA 1N87A 4WZ3B 2MD8C 2CRRA 2CSVA 3N9NA 4LLBA 2CKLB 2FSAA 5G05B 3MHHA 2CONA 2RR4A 2IDAA 2JUNA 4H9DA 2MIQA 2Y1MA 3ZTGA 3DPLR 3ZVYA 1VYXA 2KE1A 3HCSA 3LQIA 5C13A 3IHPA 3PURA 2F6JA 5C11A 5AIUA 1F62A 3ZPVE 3E2DA 2KWKA 5D1LB 2LDRA 2E6SA 3LDYA 1WESA 5LKZA 4R8PK 2YHNA 2JMJA 2ECNA 3U5MA 3C5KA 3PLWA 3JUEA 1BORA 4GNDA 3LJUX 1DVPA 3SOXA 2KWJA 2KKXA 5LKUA 4I7DA 2G43A 2KU3A 2L0BA 2CSZA 2QICA 3DWDA 1WE9A 2VP7A 5DINA 2ECJA 3LRQA 4OGEA 3DQVR 2YVRA 5SVIB 2DSMA 4S3OB 2M3HA 5J3XA 2MNZA 3SUBA 3C6WA 5K3QA 3L1ZB 2MUMA 2ECTA 5SVXA 2ZETC 3M7KA 2B0OE 2K17A 2EXUA 5G04B 4WZ0A 2KGGA 2M1RA 3U5OA 2LAUA 1CHCA 4CCGX 3MDBC 2JMIA 4QF3A 4B86C 1JM7B 3VK6A 4YBSA 2LXPC 3LVRE 2Y43A 5LKXA 2LRIC 2D8UA 3ZPV1 3HCTA 4AVXA 2VPBA 5H9MA 4PPEA 2D8SA 4XI1A 4L58A 1WEUA 2MNYA 4GNFA 3ASLA 2G45A 1WENA 4L7XA 2KGIA 1WEEA 3FJUB 5B77A 5FEYA 5B75A 2M13A 4ZDTA 2VJEB 5FB0A 3FL2A 3O36A 4BBQA 3FAOA 1IYMA 5KH9A 1VD4A 4CA1A 2VPEA 3T7LA 2EGPA 2VJFA 3KV6A 5TABA 2OWAA 2KWOA 2XOYA 4Q6FA 4UP0A 3O34A 2M6MA 4FK5A 2LQ6A 4N3WA 5B78A 2YREA 1G25A 2VPGA 4A49A 2FUIA 2L5UA 2YSJA 1K2FA 5I3LA 2ECWA 3H7HA 3SHBA 4A4CA 2CRWA 4LADB 4MSXA 5TDRA 3N9MA 1MBMA 2KREA 3L1XA 2RSDA 3L11A 1DCQA 3HCUA 2EODA 2I50A 3RTRB 3O33A 2MT5A 3RPGB 2XOCA 4NN2A 2KR4A 2L7PA 2QJ0A 2LN0A 1XWHA 1U6GB 4P5OB 4V3KC 2MD7B 3KNVA 1WEWA 4PTBA 3V43A 1MM2A 3KQIA 2Y1NA 4R7EA 2KYUA 1E4UA 2RI7A 2YYRA 3FM8C 2ECGA 4I7BA 2JRJA 5LCWB 2H0DA 2VNFA 4Z0OA 4GNEA 1WIMA 2XB1A 2KKYA 3T6RA 4YADA 5G0FA 5KH7A 4C9ZA 2VJFB 2C2LA 2AN6A 2F42A 5DKAA 2BAYA 5H1TA 3MHSA 3Q1DA 4YBTA 2C2VS 2P57A 4ZQLA 4FJCA 2MKEA 4O64A 2DX8A 2CSYA 2YURA 1X4JA 2ECIA 1Z2QA 3U5NA 4ZUXU 3EB6A 4GNGA 4O62A 3ZNIA 4YC9A 3ZVZB 4A0CD 1WEMA 2L43A 2L75A 4YBMA 4AP4A 2LGGA 2LXHC 2YQMA 2CT2A 4N4FA 2M85A 3RPGC 1HYIA 4YABA 1T1HA 5SVYA 1WEQA 3O37A 3GL6A 5D1MB 4F52B 4FIPA 2KIZA 1JM7A 4W4UA 2YUCA 3N9PA 3O7AA 3LVQE 3M62A 1VFYA 3I2DA 2FUUA 2HYED 1WILA 3O70A 4AYCA 4LK9A 4QF2A 3SOUA 2UZGA 3SOWA 5EYAF 4AUQB 3LQJA 2OXQC 2K4DA 1WEVA 4V3LC 4FO9A 3NG2A 4LJNA 2XOZA 3LQHA 1LDJB 5FERA 1JOCA 2IQJA 2E61A 4I7CA 4F1PA 4GB0A 2K16A 3M99A 3O47A 4WZ2A 2E6RA 5SVIA 2H0DB 2FFWA 3N9LA 2JM3A 3PHDA 2K1JA 5TDWA 1RMDA 2EA6A 4S3OC 4UP5A 3DDTA 2NAAA 2MA5A 2YU4A 2YW8A 3T9KA 2VJEA 5AITA 1WEOA 4R2YA 4A4BA 2LV9A 2LGKA 3O35A 1WEPA 5B76A 2PNXA 5B79A 1ZBDB 5H1VA 3EB5A 4LKAA 3ZYQA 3FEHA 2CKLA 2QIZA 1Z60A 2VPDA 5TRBA 3PUQA 4UI9B
chains in the Genus database with same CATH topology
1LDKC 3N9QA 3N9OA 2KWNA 1V87A 2YSMA 3GV4A 4IC2A 2MA6A 4MVTA 5B8DA 1WGMA 4YATA 2YQLA 3QZVA 1X4IA 4BHWA 2LGLA 5D1KB 1X4UA 4TKPB 4X3GA 3U5PA 1HYJA 2YHOA 4IC3A 5TBNA 4YAXA 2PUYA 3M63A 1Z6UA 2LGVA 1FP0A 1FBVA 1MM3A 3KV5A 5FB1A 2XEUA 2F6NA 2KFTA 2YT5A 4WA6A 5JG6A 5H1UA 5KH3A 5LKTA 3HTKC 2HDPA 4B7YC 4AYCB 2ECVA 2L80A 2JMDA 2G6QA 1WFKA 1N87A 4WZ3B 2MD8C 3N9NA 4LLBA 2CKLB 2FSAA 5G05B 3MHHA 2IDAA 2MIQA 3ZTGA 2Y1MA 3DPLR 3ZVYA 1VYXA 2KE1A 3HCSA 3LQIA 5C13A 3IHPA 3PURA 2F6JA 5C11A 5AIUA 1F62A 3ZPVE 2KWKA 2LDRA 5D1LB 2E6SA 1WESA 5LKZA 4R8PK 2YHNA 2JMJA 2ECNA 3U5MA 3C5KA 1BORA 4GNDA 1DVPA 3SOXA 2KWJA 5LKUA 4I7DA 2G43A 2KU3A 2L0BA 2CSZA 2QICA 1WE9A 2VP7A 5DINA 2ECJA 3LRQA 3DQVR 4S3OB 2M3HA 5J3XA 2MNZA 3C6WA 3L1ZB 2MUMA 2ECTA 2ZETC 2K17A 5G04B 4WZ0A 2KGGA 2M1RA 3U5OA 1CHCA 4CCGX 2JMIA 4QF3A 4B86C 1JM7B 3VK6A 4YBSA 2LXPC 2Y43A 5LKXA 2LRIC 4AVXA 3ZPV1 3HCTA 2VPBA 5H9MA 4PPEA 2D8SA 4XI1A 4L58A 1WEUA 2MNYA 4GNFA 3ASLA 2G45A 1WENA 4L7XA 2KGIA 1WEEA 5B77A 5FEYA 5B75A 4ZDTA 2VJEB 5FB0A 3FL2A 3O36A 4BBQA 1IYMA 5KH9A 1VD4A 4CA1A 2VPEA 3T7LA 2EGPA 2VJFA 3KV6A 5TABA 2KWOA 4Q6FA 4UP0A 3O34A 2M6MA 4FK5A 2LQ6A 4N3WA 5B78A 2YREA 1G25A 2VPGA 4A49A 2FUIA 2L5UA 2YSJA 1K2FA 5I3LA 2ECWA 3SHBA 4A4CA 4LADB 4MSXA 5TDRA 3N9MA 2KREA 3L1XA 2RSDA 3L11A 3HCUA 2EODA 2I50A 3RTRB 3O33A 2MT5A 3RPGB 4NN2A 2KR4A 2QJ0A 2LN0A 1XWHA 1U6GB 4P5OB 4V3KC 2MD7B 3KNVA 1WEWA 4PTBA 3V43A 1MM2A 3KQIA 2Y1NA 4R7EA 2KYUA 1E4UA 2RI7A 2YYRA 2ECGA 4I7BA 2JRJA 5LCWB 2H0DA 2VNFA 4GNEA 1WIMA 2XB1A 3T6RA 4YADA 5G0FA 5KH7A 4C9ZA 2VJFB 2C2LA 2AN6A 2F42A 5DKAA 2BAYA 5H1TA 3MHSA 4YBTA 2C2VS 4ZQLA 4FJCA 4O64A 2DX8A 2CSYA 2YURA 1X4JA 2ECIA 1Z2QA 3U5NA 4ZUXU 3EB6A 4GNGA 3ZNIA 4YC9A 3ZVZB 4A0CD 1WEMA 2L43A 2L75A 4YBMA 4AP4A 2LGGA 2LXHC 2YQMA 2CT2A 4N4FA 2M85A 3RPGC 1HYIA 4YABA 1T1HA 1WEQA 3O37A 3GL6A 5D1MB 4F52B 4FIPA 2KIZA 1JM7A 4W4UA 2YUCA 3N9PA 3O7AA 3M62A 1VFYA 3I2DA 2FUUA 2HYED 1WILA 3O70A 4AYCA 4LK9A 4QF2A 3SOUA 2UZGA 3SOWA 5EYAF 4AUQB 3LQJA 2OXQC 2K4DA 1WEVA 4V3LC 4FO9A 3NG2A 4LJNA 3LQHA 1LDJB 5FERA 1JOCA 4I7CA 4GB0A 2K16A 3M99A 4WZ2A 2E6RA 2H0DB 3N9LA 3PHDA 2K1JA 5TDWA 1RMDA 2EA6A 4UP5A 4S3OC 2NAAA 2MA5A 2YU4A 2YW8A 2VJEA 5AITA 1WEOA 4R2YA 4A4BA 2LV9A 2LGKA 3O35A 1WEPA 5B76A 2PNXA 5B79A 1ZBDB 5H1VA 3EB5A 4LKAA 3ZYQA 2CKLA 2QIZA 1Z60A 2VPDA 5TRBA 3PUQA 4UI9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDK C;  3N9Q A;  3N9O A;  2KWN A;  1V87 A;  2YSM A;  3GV4 A;  4IC2 A;  2MA6 A;  4MVT A;  5B8D A;  1WGM A;  4YAT A;  2YQL A;  3QZV A;  1X4I A;  4BHW A;  2LGL A;  5D1K B;  1X4U A;  4TKP B;  4X3G A;  3U5P A;  1HYJ A;  2YHO A;  4IC3 A;  5TBN A;  4YAX A;  2PUY A;  3M63 A;  1Z6U A;  2LGV A;  1FP0 A;  1FBV A;  1MM3 A;  3KV5 A;  5FB1 A;  2XEU A;  2F6N A;  2KFT A;  2YT5 A;  4WA6 A;  5JG6 A;  5H1U A;  5KH3 A;  5LKT A;  3HTK C;  2HDP A;  4B7Y C;  4AYC B;  2ECV A;  2L80 A;  2JMD A;  2G6Q A;  1WFK A;  1N87 A;  4WZ3 B;  2MD8 C;  3N9N A;  4LLB A;  2CKL B;  2FSA A;  5G05 B;  3MHH A;  2IDA A;  2MIQ A;  3ZTG A;  2Y1M A;  3DPL R;  3ZVY A;  1VYX A;  2KE1 A;  3HCS A;  3LQI A;  5C13 A;  3IHP A;  3PUR A;  2F6J A;  5C11 A;  5AIU A;  1F62 A;  3ZPV E;  2KWK A;  2LDR A;  5D1L B;  2E6S A;  1WES A;  5LKZ A;  4R8P K;  2YHN A;  2JMJ A;  2ECN A;  3U5M A;  3C5K A;  1BOR A;  4GND A;  1DVP A;  3SOX A;  2KWJ A;  5LKU A;  4I7D A;  2G43 A;  2KU3 A;  2L0B A;  2CSZ A;  2QIC A;  1WE9 A;  2VP7 A;  5DIN A;  2ECJ A;  3LRQ A;  3DQV R;  4S3O B;  2M3H A;  5J3X A;  2MNZ A;  3C6W A;  3L1Z B;  2MUM A;  2ECT A;  2ZET C;  2K17 A;  5G04 B;  4WZ0 A;  2KGG A;  2M1R A;  3U5O A;  1CHC A;  4CCG X;  2JMI A;  4QF3 A;  4B86 C;  1JM7 B;  3VK6 A;  4YBS A;  2LXP C;  2Y43 A;  5LKX A;  2LRI C;  4AVX A;  3ZPV 1;  3HCT A;  2VPB A;  5H9M A;  4PPE A;  2D8S A;  4XI1 A;  4L58 A;  1WEU A;  2MNY A;  4GNF A;  3ASL A;  2G45 A;  1WEN A;  4L7X A;  2KGI A;  1WEE A;  5B77 A;  5FEY A;  5B75 A;  4ZDT A;  2VJE B;  5FB0 A;  3FL2 A;  3O36 A;  4BBQ A;  1IYM A;  5KH9 A;  1VD4 A;  4CA1 A;  2VPE A;  3T7L A;  2EGP A;  2VJF A;  3KV6 A;  5TAB A;  2KWO A;  4Q6F A;  4UP0 A;  3O34 A;  2M6M A;  4FK5 A;  2LQ6 A;  4N3W A;  5B78 A;  2YRE A;  1G25 A;  2VPG A;  4A49 A;  2FUI A;  2L5U A;  2YSJ A;  1K2F A;  5I3L A;  2ECW A;  3SHB A;  4A4C A;  4LAD B;  4MSX A;  5TDR A;  3N9M A;  2KRE A;  3L1X A;  2RSD A;  3L11 A;  3HCU A;  2EOD A;  2I50 A;  3RTR B;  3O33 A;  2MT5 A;  3RPG B;  4NN2 A;  2KR4 A;  2QJ0 A;  2LN0 A;  1XWH A;  1U6G B;  4P5O B;  4V3K C;  2MD7 B;  3KNV A;  1WEW A;  4PTB A;  3V43 A;  1MM2 A;  3KQI A;  2Y1N A;  4R7E A;  2KYU A;  1E4U A;  2RI7 A;  2YYR A;  2ECG A;  4I7B A;  2JRJ A;  5LCW B;  2H0D A;  2VNF A;  4GNE A;  1WIM A;  2XB1 A;  3T6R A;  4YAD A;  5G0F A;  5KH7 A;  4C9Z A;  2VJF B;  2C2L A;  2AN6 A;  2F42 A;  5DKA A;  2BAY A;  5H1T A;  3MHS A;  4YBT A;  2C2V S;  4ZQL A;  4FJC A;  4O64 A;  2DX8 A;  2CSY A;  2YUR A;  1X4J A;  2ECI A;  1Z2Q A;  3U5N A;  4ZUX U;  3EB6 A;  4GNG A;  3ZNI A;  4YC9 A;  3ZVZ B;  4A0C D;  1WEM A;  2L43 A;  2L75 A;  4YBM A;  4AP4 A;  2LGG A;  2LXH C;  2YQM A;  2CT2 A;  4N4F A;  2M85 A;  3RPG C;  1HYI A;  4YAB A;  1T1H A;  1WEQ A;  3O37 A;  3GL6 A;  5D1M B;  4F52 B;  4FIP A;  2KIZ A;  1JM7 A;  4W4U A;  2YUC A;  3N9P A;  3O7A A;  3M62 A;  1VFY A;  3I2D A;  2FUU A;  2HYE D;  1WIL A;  3O70 A;  4AYC A;  4LK9 A;  4QF2 A;  3SOU A;  2UZG A;  3SOW A;  5EYA F;  4AUQ B;  3LQJ A;  2OXQ C;  2K4D A;  1WEV A;  4V3L C;  4FO9 A;  3NG2 A;  4LJN A;  3LQH A;  1LDJ B;  5FER A;  1JOC A;  4I7C A;  4GB0 A;  2K16 A;  3M99 A;  4WZ2 A;  2E6R A;  2H0D B;  3N9L A;  3PHD A;  2K1J A;  5TDW A;  1RMD A;  2EA6 A;  4UP5 A;  4S3O C;  2NAA A;  2MA5 A;  2YU4 A;  2YW8 A;  2VJE A;  5AIT A;  1WEO A;  4R2Y A;  4A4B A;  2LV9 A;  2LGK A;  3O35 A;  1WEP A;  5B76 A;  2PNX A;  5B79 A;  1ZBD B;  5H1V A;  3EB5 A;  4LKA A;  3ZYQ A;  2CKL A;  2QIZ A;  1Z60 A;  2VPD A;  5TRB A;  3PUQ A;  4UI9 B; 
#chains in the Genus database with same CATH topology
 1LDK C;  3N9Q A;  3N9O A;  2KWN A;  1V87 A;  2YSM A;  3GV4 A;  3FAN A;  4IC2 A;  2MA6 A;  4MVT A;  5B8D A;  1WGM A;  4YAT A;  2DJA A;  2YQL A;  2XP0 A;  3QZV A;  1X4I A;  4BHW A;  2LGL A;  5D1K B;  1X4U A;  4TKP B;  2EGM A;  4X3G A;  3U5P A;  1HYJ A;  2YHO A;  4IC3 A;  5TBN A;  4QQ4 A;  4YAX A;  2PUY A;  3M63 A;  1Z6U A;  2LGV A;  3KDE C;  1FP0 A;  1FBV A;  1MM3 A;  3KV5 A;  5FB1 A;  4Z0R A;  2XEU A;  2F6N A;  2KFT A;  2YT5 A;  4OGC A;  4WA6 A;  2FD4 A;  5JG6 A;  5H1U A;  5KH3 A;  5LKT A;  3HTK C;  2HDP A;  4B7Y C;  4AYC B;  2ECV A;  2L80 A;  2JMD A;  2G6Q A;  1WFK A;  1N87 A;  4WZ3 B;  2MD8 C;  2CRR A;  2CSV A;  3N9N A;  4LLB A;  2CKL B;  2FSA A;  5G05 B;  3MHH A;  2CON A;  2RR4 A;  2IDA A;  2JUN A;  4H9D A;  2MIQ A;  2Y1M A;  3ZTG A;  3DPL R;  3ZVY A;  1VYX A;  2KE1 A;  3HCS A;  3LQI A;  5C13 A;  3IHP A;  3PUR A;  2F6J A;  5C11 A;  5AIU A;  1F62 A;  3ZPV E;  3E2D A;  2KWK A;  5D1L B;  2LDR A;  2E6S A;  3LDY A;  1WES A;  5LKZ A;  4R8P K;  2YHN A;  2JMJ A;  2ECN A;  3U5M A;  3C5K A;  3PLW A;  3JUE A;  1BOR A;  4GND A;  3LJU X;  1DVP A;  3SOX A;  2KWJ A;  2KKX A;  5LKU A;  4I7D A;  2G43 A;  2KU3 A;  2L0B A;  2CSZ A;  2QIC A;  3DWD A;  1WE9 A;  2VP7 A;  5DIN A;  2ECJ A;  3LRQ A;  4OGE A;  3DQV R;  2YVR A;  5SVI B;  2DSM A;  4S3O B;  2M3H A;  5J3X A;  2MNZ A;  3SUB A;  3C6W A;  5K3Q A;  3L1Z B;  2MUM A;  2ECT A;  5SVX A;  2ZET C;  3M7K A;  2B0O E;  2K17 A;  2EXU A;  5G04 B;  4WZ0 A;  2KGG A;  2M1R A;  3U5O A;  2LAU A;  1CHC A;  4CCG X;  3MDB C;  2JMI A;  4QF3 A;  4B86 C;  1JM7 B;  3VK6 A;  4YBS A;  2LXP C;  3LVR E;  2Y43 A;  5LKX A;  2LRI C;  2D8U A;  3ZPV 1;  3HCT A;  4AVX A;  2VPB A;  5H9M A;  4PPE A;  2D8S A;  4XI1 A;  4L58 A;  1WEU A;  2MNY A;  4GNF A;  3ASL A;  2G45 A;  1WEN A;  4L7X A;  2KGI A;  1WEE A;  3FJU B;  5B77 A;  5FEY A;  5B75 A;  2M13 A;  4ZDT A;  2VJE B;  5FB0 A;  3FL2 A;  3O36 A;  4BBQ A;  3FAO A;  1IYM A;  5KH9 A;  1VD4 A;  4CA1 A;  2VPE A;  3T7L A;  2EGP A;  2VJF A;  3KV6 A;  5TAB A;  2OWA A;  2KWO A;  2XOY A;  4Q6F A;  4UP0 A;  3O34 A;  2M6M A;  4FK5 A;  2LQ6 A;  4N3W A;  5B78 A;  2YRE A;  1G25 A;  2VPG A;  4A49 A;  2FUI A;  2L5U A;  2YSJ A;  1K2F A;  5I3L A;  2ECW A;  3H7H A;  3SHB A;  4A4C A;  2CRW A;  4LAD B;  4MSX A;  5TDR A;  3N9M A;  1MBM A;  2KRE A;  3L1X A;  2RSD A;  3L11 A;  1DCQ A;  3HCU A;  2EOD A;  2I50 A;  3RTR B;  3O33 A;  2MT5 A;  3RPG B;  2XOC A;  4NN2 A;  2KR4 A;  2L7P A;  2QJ0 A;  2LN0 A;  1XWH A;  1U6G B;  4P5O B;  4V3K C;  2MD7 B;  3KNV A;  1WEW A;  4PTB A;  3V43 A;  1MM2 A;  3KQI A;  2Y1N A;  4R7E A;  2KYU A;  1E4U A;  2RI7 A;  2YYR A;  3FM8 C;  2ECG A;  4I7B A;  2JRJ A;  5LCW B;  2H0D A;  2VNF A;  4Z0O A;  4GNE A;  1WIM A;  2XB1 A;  2KKY A;  3T6R A;  4YAD A;  5G0F A;  5KH7 A;  4C9Z A;  2VJF B;  2C2L A;  2AN6 A;  2F42 A;  5DKA A;  2BAY A;  5H1T A;  3MHS A;  3Q1D A;  4YBT A;  2C2V S;  2P57 A;  4ZQL A;  4FJC A;  2MKE A;  4O64 A;  2DX8 A;  2CSY A;  2YUR A;  1X4J A;  2ECI A;  1Z2Q A;  3U5N A;  4ZUX U;  3EB6 A;  4GNG A;  4O62 A;  3ZNI A;  4YC9 A;  3ZVZ B;  4A0C D;  1WEM A;  2L43 A;  2L75 A;  4YBM A;  4AP4 A;  2LGG A;  2LXH C;  2YQM A;  2CT2 A;  4N4F A;  2M85 A;  3RPG C;  1HYI A;  4YAB A;  1T1H A;  5SVY A;  1WEQ A;  3O37 A;  3GL6 A;  5D1M B;  4F52 B;  4FIP A;  2KIZ A;  1JM7 A;  4W4U A;  2YUC A;  3N9P A;  3O7A A;  3LVQ E;  3M62 A;  1VFY A;  3I2D A;  2FUU A;  2HYE D;  1WIL A;  3O70 A;  4AYC A;  4LK9 A;  4QF2 A;  3SOU A;  2UZG A;  3SOW A;  5EYA F;  4AUQ B;  3LQJ A;  2OXQ C;  2K4D A;  1WEV A;  4V3L C;  4FO9 A;  3NG2 A;  4LJN A;  2XOZ A;  3LQH A;  1LDJ B;  5FER A;  1JOC A;  2IQJ A;  2E61 A;  4I7C A;  4F1P A;  4GB0 A;  2K16 A;  3M99 A;  3O47 A;  4WZ2 A;  2E6R A;  5SVI A;  2H0D B;  2FFW A;  3N9L A;  2JM3 A;  3PHD A;  2K1J A;  5TDW A;  1RMD A;  2EA6 A;  4S3O C;  4UP5 A;  3DDT A;  2NAA A;  2MA5 A;  2YU4 A;  2YW8 A;  3T9K A;  2VJE A;  5AIT A;  1WEO A;  4R2Y A;  4A4B A;  2LV9 A;  2LGK A;  3O35 A;  1WEP A;  5B76 A;  2PNX A;  5B79 A;  1ZBD B;  5H1V A;  3EB5 A;  4LKA A;  3ZYQ A;  3FEH A;  2CKL A;  2QIZ A;  1Z60 A;  2VPD A;  5TRB A;  3PUQ A;  4UI9 B; 
#chains in the Genus database with same CATH homology
 1LDK C;  3N9Q A;  3N9O A;  2KWN A;  1V87 A;  2YSM A;  3GV4 A;  4IC2 A;  2MA6 A;  4MVT A;  5B8D A;  1WGM A;  4YAT A;  2YQL A;  3QZV A;  1X4I A;  4BHW A;  2LGL A;  5D1K B;  1X4U A;  4TKP B;  4X3G A;  3U5P A;  1HYJ A;  2YHO A;  4IC3 A;  5TBN A;  4YAX A;  2PUY A;  3M63 A;  1Z6U A;  2LGV A;  1FP0 A;  1FBV A;  1MM3 A;  3KV5 A;  5FB1 A;  2XEU A;  2F6N A;  2KFT A;  2YT5 A;  4WA6 A;  5JG6 A;  5H1U A;  5KH3 A;  5LKT A;  3HTK C;  2HDP A;  4B7Y C;  4AYC B;  2ECV A;  2L80 A;  2JMD A;  2G6Q A;  1WFK A;  1N87 A;  4WZ3 B;  2MD8 C;  3N9N A;  4LLB A;  2CKL B;  2FSA A;  5G05 B;  3MHH A;  2IDA A;  2MIQ A;  3ZTG A;  2Y1M A;  3DPL R;  3ZVY A;  1VYX A;  2KE1 A;  3HCS A;  3LQI A;  5C13 A;  3IHP A;  3PUR A;  2F6J A;  5C11 A;  5AIU A;  1F62 A;  3ZPV E;  2KWK A;  2LDR A;  5D1L B;  2E6S A;  1WES A;  5LKZ A;  4R8P K;  2YHN A;  2JMJ A;  2ECN A;  3U5M A;  3C5K A;  1BOR A;  4GND A;  1DVP A;  3SOX A;  2KWJ A;  5LKU A;  4I7D A;  2G43 A;  2KU3 A;  2L0B A;  2CSZ A;  2QIC A;  1WE9 A;  2VP7 A;  5DIN A;  2ECJ A;  3LRQ A;  3DQV R;  4S3O B;  2M3H A;  5J3X A;  2MNZ A;  3C6W A;  3L1Z B;  2MUM A;  2ECT A;  2ZET C;  2K17 A;  5G04 B;  4WZ0 A;  2KGG A;  2M1R A;  3U5O A;  1CHC A;  4CCG X;  2JMI A;  4QF3 A;  4B86 C;  1JM7 B;  3VK6 A;  4YBS A;  2LXP C;  2Y43 A;  5LKX A;  2LRI C;  4AVX A;  3ZPV 1;  3HCT A;  2VPB A;  5H9M A;  4PPE A;  2D8S A;  4XI1 A;  4L58 A;  1WEU A;  2MNY A;  4GNF A;  3ASL A;  2G45 A;  1WEN A;  4L7X A;  2KGI A;  1WEE A;  5B77 A;  5FEY A;  5B75 A;  4ZDT A;  2VJE B;  5FB0 A;  3FL2 A;  3O36 A;  4BBQ A;  1IYM A;  5KH9 A;  1VD4 A;  4CA1 A;  2VPE A;  3T7L A;  2EGP A;  2VJF A;  3KV6 A;  5TAB A;  2KWO A;  4Q6F A;  4UP0 A;  3O34 A;  2M6M A;  4FK5 A;  2LQ6 A;  4N3W A;  5B78 A;  2YRE A;  1G25 A;  2VPG A;  4A49 A;  2FUI A;  2L5U A;  2YSJ A;  1K2F A;  5I3L A;  2ECW A;  3SHB A;  4A4C A;  4LAD B;  4MSX A;  5TDR A;  3N9M A;  2KRE A;  3L1X A;  2RSD A;  3L11 A;  3HCU A;  2EOD A;  2I50 A;  3RTR B;  3O33 A;  2MT5 A;  3RPG B;  4NN2 A;  2KR4 A;  2QJ0 A;  2LN0 A;  1XWH A;  1U6G B;  4P5O B;  4V3K C;  2MD7 B;  3KNV A;  1WEW A;  4PTB A;  3V43 A;  1MM2 A;  3KQI A;  2Y1N A;  4R7E A;  2KYU A;  1E4U A;  2RI7 A;  2YYR A;  2ECG A;  4I7B A;  2JRJ A;  5LCW B;  2H0D A;  2VNF A;  4GNE A;  1WIM A;  2XB1 A;  3T6R A;  4YAD A;  5G0F A;  5KH7 A;  4C9Z A;  2VJF B;  2C2L A;  2AN6 A;  2F42 A;  5DKA A;  2BAY A;  5H1T A;  3MHS A;  4YBT A;  2C2V S;  4ZQL A;  4FJC A;  4O64 A;  2DX8 A;  2CSY A;  2YUR A;  1X4J A;  2ECI A;  1Z2Q A;  3U5N A;  4ZUX U;  3EB6 A;  4GNG A;  3ZNI A;  4YC9 A;  3ZVZ B;  4A0C D;  1WEM A;  2L43 A;  2L75 A;  4YBM A;  4AP4 A;  2LGG A;  2LXH C;  2YQM A;  2CT2 A;  4N4F A;  2M85 A;  3RPG C;  1HYI A;  4YAB A;  1T1H A;  1WEQ A;  3O37 A;  3GL6 A;  5D1M B;  4F52 B;  4FIP A;  2KIZ A;  1JM7 A;  4W4U A;  2YUC A;  3N9P A;  3O7A A;  3M62 A;  1VFY A;  3I2D A;  2FUU A;  2HYE D;  1WIL A;  3O70 A;  4AYC A;  4LK9 A;  4QF2 A;  3SOU A;  2UZG A;  3SOW A;  5EYA F;  4AUQ B;  3LQJ A;  2OXQ C;  2K4D A;  1WEV A;  4V3L C;  4FO9 A;  3NG2 A;  4LJN A;  3LQH A;  1LDJ B;  5FER A;  1JOC A;  4I7C A;  4GB0 A;  2K16 A;  3M99 A;  4WZ2 A;  2E6R A;  2H0D B;  3N9L A;  3PHD A;  2K1J A;  5TDW A;  1RMD A;  2EA6 A;  4UP5 A;  4S3O C;  2NAA A;  2MA5 A;  2YU4 A;  2YW8 A;  2VJE A;  5AIT A;  1WEO A;  4R2Y A;  4A4B A;  2LV9 A;  2LGK A;  3O35 A;  1WEP A;  5B76 A;  2PNX A;  5B79 A;  1ZBD B;  5H1V A;  3EB5 A;  4LKA A;  3ZYQ A;  2CKL A;  2QIZ A;  1Z60 A;  2VPD A;  5TRB A;  3PUQ A;  4UI9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...