2UZGA

Zf-ubp domain of vdu1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
RNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 33
publication title The Solution Structure of the Znf Ubp Domain of Usp33/Vdu1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 17
structure length 95
sequence length 95
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2uzgA00
4GNFA 2RSDA 2JMDA 4CCGX 5LKZA 1JOCA 2MUMA 4YC9A 3O35A 3T7LA 1X4IA 4ZDTA 1G25A 2BAYA 4P5OB 4B7YC 2ECWA 2OXQC 2MNYA 3RPGC 5KH3A 5H1UA 5KH9A 5B77A 3DPLR 2ZETC 2PUYA 4YADA 2K16A 5B75A 1WEMA 3KQIA 1BORA 4YBTA 3U5OA 2KYUA 2FSAA 3MHSA 2ECJA 3MHHA 3RPGB 2XB1A 1WEQA 4S3OC 2LV9A 2QJ0A 4FO9A 4I7BA 1MM3A 5FERA 4XI1A 2JRJA 2L80A 4A4BA 2KWNA 1HYJA 3QZVA 1X4UA 3HCTA 2HDPA 5LKUA 2Y1NA 3KNVA 5DINA 3U5NA 2G43A 2H0DB 4X3GA 4S3OB 1WFKA 4R7EA 2K1JA 2VPDA 3ZYQA 3ASLA 1HYIA 5C11A 5TBNA 3LRQA 4AYCA 4UI9B 1IYMA 4B86C 1VYXA 1WE9A 1WESA 3ZTGA 1WEUA 4YAXA 2LXHC 2F42A 3N9QA 2L43A 3ZPVE 3I2DA 2ECTA 5D1KB 2K4DA 1U6GB 2F6NA 5TABA 5H1VA 2YURA 3FL2A 5B8DA 2EA6A 2L0BA 3ZPV1 4Q6FA 3PUQA 2DX8A 3LQHA 1JM7A 2YU4A 2CKLA 3HCSA 1FP0A 2YHNA 5G05B 2L75A 3RTRB 1WEEA 4UP0A 2YSJA 1FBVA 2LGGA 1Z60A 2YSMA 3O36A 2ECVA 3N9NA 4FK5A 2VP7A 3L11A 3N9OA 5FB0A 2LQ6A 1N87A 3NG2A 4PTBA 1F62A 2FUUA 1LDKC 2EODA 4V3LC 2E6RA 4YBMA 4GNGA 4CA1A 2MT5A 4QF2A 3O70A 2KGGA 2ECNA 2UZGA 5AIUA 3ZNIA 4GNDA 2ECIA 1LDJB 2VJFA 4NN2A 2CSZA 2VJEB 2YQMA 4TKPB 5TDRA 4AUQB 5H9MA 2KFTA 4WZ0A 2VPGA 3KV5A 2CSYA 2KE1A 2KR4A 4LK9A 2KWKA 2G6QA 4LJNA 3O33A 5I3LA 4YATA 4I7DA 4BBQA 2LGVA 5D1LB 5D1MB 2LXPC 3O34A 5B79A 2C2VS 5KH7A 2YQLA 1WEOA 3IHPA 5FB1A 4N4FA 2E6SA 2MD7B 2CT2A 1Z2QA 2ECGA 2D8SA 4R8PK 1WIMA 3C5KA 4UP5A 5J3XA 3HTKC 4R2YA 2M85A 4WZ3B 3M62A 3KV6A 5LKTA 5LCWB 2Y43A 3EB5A 4IC3A 2H0DA 1WILA 2YREA 1K2FA 4LADB 2F6JA 5LKXA 4ZQLA 2G45A 2Y1MA 3N9MA 4WZ2A 4A49A 5B78A 2KWJA 2MNZA 2VJFB 2K17A 3L1ZB 1ZBDB 2LN0A 4YABA 5AITA 2NAAA 2KREA 5TDWA 3SOWA 1WEWA 3N9PA 2YYRA 4FIPA 2YW8A 2JMIA 5H1TA 3SOUA 5TRBA 3PURA 3ZVYA 4L7XA 4YBSA 4AP4A 4IC2A 2IDAA 1E4UA 4QF3A 1T1HA 3O7AA 4MVTA 3T6RA 1RMDA 4GB0A 2VNFA 2VPEA 2QIZA 2L5UA 1MM2A 2MIQA 2YHOA 2M3HA 4AYCB 1WEPA 1XWHA 5EYAF 2JMJA 3HCUA 3LQJA 3GV4A 4L58A 4MSXA 2C2LA 4LLBA 5G0FA 2FUIA 3V43A 4C9ZA 2KU3A 5G04B 3C6WA 1WENA 1WGMA 4PPEA 2MA6A 2LGLA 4BHWA 2M6MA 4LKAA 4FJCA 2YUCA 3U5MA 3M99A 2MD8C 2KIZA 4W4UA 2LRIC 4GNEA 4A4CA 2VJEA 2LDRA 4N3WA 1V87A 1WEVA 5B76A 3SOXA 2KGIA 5FEYA 3N9LA 2AN6A 1JM7B 2CKLB 4F52B 2I50A 5JG6A 4ZUXU 4WA6A 1X4JA 1DVPA 1CHCA 4A0CD 2MA5A 3ZVZB 2HYED 2LGKA 1VFYA 3PHDA 1VD4A 3VK6A 2VPBA 3DQVR 2XEUA 2QICA 3LQIA 2KWOA 3O37A 4V3KC 2PNXA 1Z6UA 4O64A 3M63A 3L1XA 2RI7A 3GL6A 2M1RA 4AVXA 5DKAA 4I7CA 3U5PA 2YT5A 3EB6A 3SHBA 2EGPA 5C13A
chains in the Genus database with same CATH superfamily
4GNFA 2RSDA 2JMDA 4CCGX 5LKZA 2YVRA 1JOCA 3FJUB 2MUMA 2EXUA 3DWDA 4YC9A 3O35A 3T7LA 3FANA 3LVRE 1X4IA 4ZDTA 1G25A 2E61A 4Z0OA 2BAYA 4P5OB 5SVIB 4B7YC 2ECWA 2OXQC 2MNYA 3RPGC 5KH3A 5H1UA 5KH9A 5B77A 3T9KA 3DPLR 2ZETC 2PUYA 4YADA 2K16A 2OWAA 3SUBA 5B75A 1WEMA 3KQIA 2MKEA 1BORA 4YBTA 3U5OA 2KYUA 2FSAA 3MHSA 2ECJA 3MHHA 3RPGB 2XB1A 1WEQA 4S3OC 2LV9A 2QJ0A 2XOZA 4FO9A 4I7BA 1MM3A 5FERA 4XI1A 2EGMA 2JRJA 2L80A 2D8UA 4A4BA 2KWNA 1HYJA 2M13A 4O62A 3QZVA 1X4UA 3HCTA 2HDPA 5LKUA 2Y1NA 3KNVA 5DINA 3U5NA 2G43A 2H0DB 4X3GA 4S3OB 1WFKA 4R7EA 2K1JA 2VPDA 3ZYQA 3ASLA 1HYIA 5C11A 2P57A 5TBNA 3LRQA 4AYCA 4UI9B 1IYMA 4B86C 2L7PA 1VYXA 1WE9A 2IQJA 1WESA 3ZTGA 1WEUA 4YAXA 2LXHC 2F42A 3N9QA 2RR4A 2L43A 3E2DA 3ZPVE 3I2DA 3H7HA 2ECTA 5D1KB 2K4DA 1U6GB 2F6NA 5TABA 3FAOA 5H1VA 2YURA 3FL2A 5B8DA 2EA6A 2L0BA 3ZPV1 4Q6FA 3PUQA 2DX8A 3LQHA 1JM7A 3Q1DA 2YU4A 2CKLA 3HCSA 1FP0A 2YHNA 5G05B 2L75A 3RTRB 1WEEA 4UP0A 2YSJA 1FBVA 2LGGA 1Z60A 2YSMA 3O36A 3DDTA 2ECVA 3N9NA 4FK5A 2VP7A 3L11A 3N9OA 5FB0A 2LQ6A 1DCQA 1N87A 3NG2A 4PTBA 1F62A 2FUUA 1LDKC 2EODA 4V3LC 2E6RA 4YBMA 4GNGA 4CA1A 2MT5A 2KKXA 5SVYA 4QF2A 3O70A 2KGGA 2ECNA 2XOCA 2UZGA 5AIUA 3ZNIA 4GNDA 2ECIA 4OGEA 1LDJB 4OGCA 2VJFA 4NN2A 2CSZA 2VJEB 2YQMA 4TKPB 5TDRA 4AUQB 3M7KA 5H9MA 2KFTA 4WZ0A 2VPGA 3LJUX 3KV5A 3LDYA 2CSYA 3MDBC 4QQ4A 2KE1A 2KR4A 5SVIA 4LK9A 2KWKA 2G6QA 3FM8C 4LJNA 3O33A 5I3LA 4YATA 2CSVA 4I7DA 4BBQA 2LGVA 5D1LB 5D1MB 2LXPC 3O34A 5B79A 2C2VS 5KH7A 2YQLA 1WEOA 3IHPA 5FB1A 4N4FA 2FFWA 2E6SA 2MD7B 2CT2A 1Z2QA 2ECGA 2D8SA 4R8PK 1WIMA 3C5KA 4UP5A 5J3XA 3HTKC 4R2YA 2M85A 4WZ3B 3M62A 3KV6A 5LKTA 5LCWB 2Y43A 3EB5A 4IC3A 3FEHA 2H0DA 2JM3A 1WILA 2YREA 2JUNA 4F1PA 1K2FA 4LADB 2DSMA 2F6JA 5LKXA 4ZQLA 2G45A 2Y1MA 3N9MA 4WZ2A 4A49A 5B78A 4H9DA 2KWJA 2MNZA 2VJFB 2K17A 3L1ZB 1ZBDB 2LN0A 4YABA 5AITA 2NAAA 2KREA 5TDWA 3SOWA 1WEWA 3N9PA 2YYRA 4FIPA 2XP0A 2YW8A 2JMIA 5H1TA 3SOUA 5TRBA 3PURA 3ZVYA 4L7XA 4YBSA 4AP4A 4IC2A 2IDAA 1E4UA 4QF3A 2B0OE 1T1HA 3O7AA 4MVTA 3T6RA 1RMDA 4GB0A 2VNFA 2VPEA 2QIZA 2L5UA 2CONA 1MM2A 4Z0RA 2MIQA 2YHOA 2M3HA 3KDEC 4AYCB 2DJAA 1WEPA 1XWHA 5EYAF 2JMJA 2FD4A 3HCUA 3LQJA 3GV4A 4L58A 4MSXA 2C2LA 4LLBA 5G0FA 2FUIA 3V43A 3O47A 4C9ZA 2KU3A 5G04B 3C6WA 1WENA 5K3QA 1WGMA 4PPEA 2MA6A 2LGLA 4BHWA 2M6MA 4LKAA 4FJCA 2YUCA 3U5MA 3M99A 2MD8C 2KIZA 4W4UA 2LRIC 4GNEA 4A4CA 3LVQE 2CRWA 2VJEA 2LDRA 4N3WA 1V87A 1WEVA 5B76A 3SOXA 2KGIA 5FEYA 3N9LA 2AN6A 1JM7B 2CKLB 4F52B 2I50A 5JG6A 4ZUXU 4WA6A 1X4JA 2KKYA 1DVPA 1CHCA 4A0CD 2MA5A 3ZVZB 5SVXA 2HYED 2LGKA 1VFYA 3PHDA 1VD4A 2XOYA 3VK6A 2VPBA 2LAUA 3JUEA 3DQVR 2XEUA 2QICA 3LQIA 2KWOA 3O37A 4V3KC 2PNXA 3PLWA 1MBMA 1Z6UA 4O64A 2CRRA 3M63A 3L1XA 2RI7A 3GL6A 2M1RA 4AVXA 5DKAA 4I7CA 3U5PA 2YT5A 3EB6A 3SHBA 2EGPA 5C13A
chains in the Genus database with same CATH topology
4GNFA 2RSDA 2JMDA 4CCGX 5LKZA 1JOCA 2MUMA 4YC9A 3O35A 3T7LA 1X4IA 4ZDTA 1G25A 2BAYA 4P5OB 4B7YC 2ECWA 2OXQC 2MNYA 3RPGC 5KH3A 5H1UA 5KH9A 5B77A 3DPLR 2ZETC 2PUYA 4YADA 2K16A 5B75A 1WEMA 3KQIA 1BORA 4YBTA 3U5OA 2KYUA 2FSAA 3MHSA 2ECJA 3MHHA 3RPGB 2XB1A 1WEQA 4S3OC 2LV9A 2QJ0A 4FO9A 4I7BA 1MM3A 5FERA 4XI1A 2JRJA 2L80A 4A4BA 2KWNA 1HYJA 3QZVA 1X4UA 3HCTA 2HDPA 5LKUA 2Y1NA 3KNVA 5DINA 3U5NA 2G43A 2H0DB 4X3GA 4S3OB 1WFKA 4R7EA 2K1JA 2VPDA 3ZYQA 3ASLA 1HYIA 5C11A 5TBNA 3LRQA 4AYCA 4UI9B 1IYMA 4B86C 1VYXA 1WE9A 1WESA 3ZTGA 1WEUA 4YAXA 2LXHC 2F42A 3N9QA 2L43A 3ZPVE 3I2DA 2ECTA 5D1KB 2K4DA 1U6GB 2F6NA 5TABA 5H1VA 2YURA 3FL2A 5B8DA 2EA6A 2L0BA 3ZPV1 4Q6FA 3PUQA 2DX8A 3LQHA 1JM7A 2YU4A 2CKLA 3HCSA 1FP0A 2YHNA 5G05B 2L75A 3RTRB 1WEEA 4UP0A 2YSJA 1FBVA 2LGGA 1Z60A 2YSMA 3O36A 2ECVA 3N9NA 4FK5A 2VP7A 3L11A 3N9OA 5FB0A 2LQ6A 1N87A 3NG2A 4PTBA 1F62A 2FUUA 1LDKC 2EODA 4V3LC 2E6RA 4YBMA 4GNGA 4CA1A 2MT5A 4QF2A 3O70A 2KGGA 2ECNA 2UZGA 5AIUA 3ZNIA 4GNDA 2ECIA 1LDJB 2VJFA 4NN2A 2CSZA 2VJEB 2YQMA 4TKPB 5TDRA 4AUQB 5H9MA 2KFTA 4WZ0A 2VPGA 3KV5A 2CSYA 2KE1A 2KR4A 4LK9A 2KWKA 2G6QA 4LJNA 3O33A 5I3LA 4YATA 4I7DA 4BBQA 2LGVA 5D1LB 5D1MB 2LXPC 3O34A 5B79A 2C2VS 5KH7A 2YQLA 1WEOA 3IHPA 5FB1A 4N4FA 2E6SA 2MD7B 2CT2A 1Z2QA 2ECGA 2D8SA 4R8PK 1WIMA 3C5KA 4UP5A 5J3XA 3HTKC 4R2YA 2M85A 4WZ3B 3M62A 3KV6A 5LKTA 5LCWB 2Y43A 3EB5A 4IC3A 2H0DA 1WILA 2YREA 1K2FA 4LADB 2F6JA 5LKXA 4ZQLA 2G45A 2Y1MA 3N9MA 4WZ2A 4A49A 5B78A 2KWJA 2MNZA 2VJFB 2K17A 3L1ZB 1ZBDB 2LN0A 4YABA 5AITA 2NAAA 2KREA 5TDWA 3SOWA 1WEWA 3N9PA 2YYRA 4FIPA 2YW8A 2JMIA 5H1TA 3SOUA 5TRBA 3PURA 3ZVYA 4L7XA 4YBSA 4AP4A 4IC2A 2IDAA 1E4UA 4QF3A 1T1HA 3O7AA 4MVTA 3T6RA 1RMDA 4GB0A 2VNFA 2VPEA 2QIZA 2L5UA 1MM2A 2MIQA 2YHOA 2M3HA 4AYCB 1WEPA 1XWHA 5EYAF 2JMJA 3HCUA 3LQJA 3GV4A 4L58A 4MSXA 2C2LA 4LLBA 5G0FA 2FUIA 3V43A 4C9ZA 2KU3A 5G04B 3C6WA 1WENA 1WGMA 4PPEA 2MA6A 2LGLA 4BHWA 2M6MA 4LKAA 4FJCA 2YUCA 3U5MA 3M99A 2MD8C 2KIZA 4W4UA 2LRIC 4GNEA 4A4CA 2VJEA 2LDRA 4N3WA 1V87A 1WEVA 5B76A 3SOXA 2KGIA 5FEYA 3N9LA 2AN6A 1JM7B 2CKLB 4F52B 2I50A 5JG6A 4ZUXU 4WA6A 1X4JA 1DVPA 1CHCA 4A0CD 2MA5A 3ZVZB 2HYED 2LGKA 1VFYA 3PHDA 1VD4A 3VK6A 2VPBA 3DQVR 2XEUA 2QICA 3LQIA 2KWOA 3O37A 4V3KC 2PNXA 1Z6UA 4O64A 3M63A 3L1XA 2RI7A 3GL6A 2M1RA 4AVXA 5DKAA 4I7CA 3U5PA 2YT5A 3EB6A 3SHBA 2EGPA 5C13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNF A;  2RSD A;  2JMD A;  4CCG X;  5LKZ A;  1JOC A;  2MUM A;  4YC9 A;  3O35 A;  3T7L A;  1X4I A;  4ZDT A;  1G25 A;  2BAY A;  4P5O B;  4B7Y C;  2ECW A;  2OXQ C;  2MNY A;  3RPG C;  5KH3 A;  5H1U A;  5KH9 A;  5B77 A;  3DPL R;  2ZET C;  2PUY A;  4YAD A;  2K16 A;  5B75 A;  1WEM A;  3KQI A;  1BOR A;  4YBT A;  3U5O A;  2KYU A;  2FSA A;  3MHS A;  2ECJ A;  3MHH A;  3RPG B;  2XB1 A;  1WEQ A;  4S3O C;  2LV9 A;  2QJ0 A;  4FO9 A;  4I7B A;  1MM3 A;  5FER A;  4XI1 A;  2JRJ A;  2L80 A;  4A4B A;  2KWN A;  1HYJ A;  3QZV A;  1X4U A;  3HCT A;  2HDP A;  5LKU A;  2Y1N A;  3KNV A;  5DIN A;  3U5N A;  2G43 A;  2H0D B;  4X3G A;  4S3O B;  1WFK A;  4R7E A;  2K1J A;  2VPD A;  3ZYQ A;  3ASL A;  1HYI A;  5C11 A;  5TBN A;  3LRQ A;  4AYC A;  4UI9 B;  1IYM A;  4B86 C;  1VYX A;  1WE9 A;  1WES A;  3ZTG A;  1WEU A;  4YAX A;  2LXH C;  2F42 A;  3N9Q A;  2L43 A;  3ZPV E;  3I2D A;  2ECT A;  5D1K B;  2K4D A;  1U6G B;  2F6N A;  5TAB A;  5H1V A;  2YUR A;  3FL2 A;  5B8D A;  2EA6 A;  2L0B A;  3ZPV 1;  4Q6F A;  3PUQ A;  2DX8 A;  3LQH A;  1JM7 A;  2YU4 A;  2CKL A;  3HCS A;  1FP0 A;  2YHN A;  5G05 B;  2L75 A;  3RTR B;  1WEE A;  4UP0 A;  2YSJ A;  1FBV A;  2LGG A;  1Z60 A;  2YSM A;  3O36 A;  2ECV A;  3N9N A;  4FK5 A;  2VP7 A;  3L11 A;  3N9O A;  5FB0 A;  2LQ6 A;  1N87 A;  3NG2 A;  4PTB A;  1F62 A;  2FUU A;  1LDK C;  2EOD A;  4V3L C;  2E6R A;  4YBM A;  4GNG A;  4CA1 A;  2MT5 A;  4QF2 A;  3O70 A;  2KGG A;  2ECN A;  2UZG A;  5AIU A;  3ZNI A;  4GND A;  2ECI A;  1LDJ B;  2VJF A;  4NN2 A;  2CSZ A;  2VJE B;  2YQM A;  4TKP B;  5TDR A;  4AUQ B;  5H9M A;  2KFT A;  4WZ0 A;  2VPG A;  3KV5 A;  2CSY A;  2KE1 A;  2KR4 A;  4LK9 A;  2KWK A;  2G6Q A;  4LJN A;  3O33 A;  5I3L A;  4YAT A;  4I7D A;  4BBQ A;  2LGV A;  5D1L B;  5D1M B;  2LXP C;  3O34 A;  5B79 A;  2C2V S;  5KH7 A;  2YQL A;  1WEO A;  3IHP A;  5FB1 A;  4N4F A;  2E6S A;  2MD7 B;  2CT2 A;  1Z2Q A;  2ECG A;  2D8S A;  4R8P K;  1WIM A;  3C5K A;  4UP5 A;  5J3X A;  3HTK C;  4R2Y A;  2M85 A;  4WZ3 B;  3M62 A;  3KV6 A;  5LKT A;  5LCW B;  2Y43 A;  3EB5 A;  4IC3 A;  2H0D A;  1WIL A;  2YRE A;  1K2F A;  4LAD B;  2F6J A;  5LKX A;  4ZQL A;  2G45 A;  2Y1M A;  3N9M A;  4WZ2 A;  4A49 A;  5B78 A;  2KWJ A;  2MNZ A;  2VJF B;  2K17 A;  3L1Z B;  1ZBD B;  2LN0 A;  4YAB A;  5AIT A;  2NAA A;  2KRE A;  5TDW A;  3SOW A;  1WEW A;  3N9P A;  2YYR A;  4FIP A;  2YW8 A;  2JMI A;  5H1T A;  3SOU A;  5TRB A;  3PUR A;  3ZVY A;  4L7X A;  4YBS A;  4AP4 A;  4IC2 A;  2IDA A;  1E4U A;  4QF3 A;  1T1H A;  3O7A A;  4MVT A;  3T6R A;  1RMD A;  4GB0 A;  2VNF A;  2VPE A;  2QIZ A;  2L5U A;  1MM2 A;  2MIQ A;  2YHO A;  2M3H A;  4AYC B;  1WEP A;  1XWH A;  5EYA F;  2JMJ A;  3HCU A;  3LQJ A;  3GV4 A;  4L58 A;  4MSX A;  2C2L A;  4LLB A;  5G0F A;  2FUI A;  3V43 A;  4C9Z A;  2KU3 A;  5G04 B;  3C6W A;  1WEN A;  1WGM A;  4PPE A;  2MA6 A;  2LGL A;  4BHW A;  2M6M A;  4LKA A;  4FJC A;  2YUC A;  3U5M A;  3M99 A;  2MD8 C;  2KIZ A;  4W4U A;  2LRI C;  4GNE A;  4A4C A;  2VJE A;  2LDR A;  4N3W A;  1V87 A;  1WEV A;  5B76 A;  3SOX A;  2KGI A;  5FEY A;  3N9L A;  2AN6 A;  1JM7 B;  2CKL B;  4F52 B;  2I50 A;  5JG6 A;  4ZUX U;  4WA6 A;  1X4J A;  1DVP A;  1CHC A;  4A0C D;  2MA5 A;  3ZVZ B;  2HYE D;  2LGK A;  1VFY A;  3PHD A;  1VD4 A;  3VK6 A;  2VPB A;  3DQV R;  2XEU A;  2QIC A;  3LQI A;  2KWO A;  3O37 A;  4V3K C;  2PNX A;  1Z6U A;  4O64 A;  3M63 A;  3L1X A;  2RI7 A;  3GL6 A;  2M1R A;  4AVX A;  5DKA A;  4I7C A;  3U5P A;  2YT5 A;  3EB6 A;  3SHB A;  2EGP A;  5C13 A; 
#chains in the Genus database with same CATH topology
 4GNF A;  2RSD A;  2JMD A;  4CCG X;  5LKZ A;  2YVR A;  1JOC A;  3FJU B;  2MUM A;  2EXU A;  3DWD A;  4YC9 A;  3O35 A;  3T7L A;  3FAN A;  3LVR E;  1X4I A;  4ZDT A;  1G25 A;  2E61 A;  4Z0O A;  2BAY A;  4P5O B;  5SVI B;  4B7Y C;  2ECW A;  2OXQ C;  2MNY A;  3RPG C;  5KH3 A;  5H1U A;  5KH9 A;  5B77 A;  3T9K A;  3DPL R;  2ZET C;  2PUY A;  4YAD A;  2K16 A;  2OWA A;  3SUB A;  5B75 A;  1WEM A;  3KQI A;  2MKE A;  1BOR A;  4YBT A;  3U5O A;  2KYU A;  2FSA A;  3MHS A;  2ECJ A;  3MHH A;  3RPG B;  2XB1 A;  1WEQ A;  4S3O C;  2LV9 A;  2QJ0 A;  2XOZ A;  4FO9 A;  4I7B A;  1MM3 A;  5FER A;  4XI1 A;  2EGM A;  2JRJ A;  2L80 A;  2D8U A;  4A4B A;  2KWN A;  1HYJ A;  2M13 A;  4O62 A;  3QZV A;  1X4U A;  3HCT A;  2HDP A;  5LKU A;  2Y1N A;  3KNV A;  5DIN A;  3U5N A;  2G43 A;  2H0D B;  4X3G A;  4S3O B;  1WFK A;  4R7E A;  2K1J A;  2VPD A;  3ZYQ A;  3ASL A;  1HYI A;  5C11 A;  2P57 A;  5TBN A;  3LRQ A;  4AYC A;  4UI9 B;  1IYM A;  4B86 C;  2L7P A;  1VYX A;  1WE9 A;  2IQJ A;  1WES A;  3ZTG A;  1WEU A;  4YAX A;  2LXH C;  2F42 A;  3N9Q A;  2RR4 A;  2L43 A;  3E2D A;  3ZPV E;  3I2D A;  3H7H A;  2ECT A;  5D1K B;  2K4D A;  1U6G B;  2F6N A;  5TAB A;  3FAO A;  5H1V A;  2YUR A;  3FL2 A;  5B8D A;  2EA6 A;  2L0B A;  3ZPV 1;  4Q6F A;  3PUQ A;  2DX8 A;  3LQH A;  1JM7 A;  3Q1D A;  2YU4 A;  2CKL A;  3HCS A;  1FP0 A;  2YHN A;  5G05 B;  2L75 A;  3RTR B;  1WEE A;  4UP0 A;  2YSJ A;  1FBV A;  2LGG A;  1Z60 A;  2YSM A;  3O36 A;  3DDT A;  2ECV A;  3N9N A;  4FK5 A;  2VP7 A;  3L11 A;  3N9O A;  5FB0 A;  2LQ6 A;  1DCQ A;  1N87 A;  3NG2 A;  4PTB A;  1F62 A;  2FUU A;  1LDK C;  2EOD A;  4V3L C;  2E6R A;  4YBM A;  4GNG A;  4CA1 A;  2MT5 A;  2KKX A;  5SVY A;  4QF2 A;  3O70 A;  2KGG A;  2ECN A;  2XOC A;  2UZG A;  5AIU A;  3ZNI A;  4GND A;  2ECI A;  4OGE A;  1LDJ B;  4OGC A;  2VJF A;  4NN2 A;  2CSZ A;  2VJE B;  2YQM A;  4TKP B;  5TDR A;  4AUQ B;  3M7K A;  5H9M A;  2KFT A;  4WZ0 A;  2VPG A;  3LJU X;  3KV5 A;  3LDY A;  2CSY A;  3MDB C;  4QQ4 A;  2KE1 A;  2KR4 A;  5SVI A;  4LK9 A;  2KWK A;  2G6Q A;  3FM8 C;  4LJN A;  3O33 A;  5I3L A;  4YAT A;  2CSV A;  4I7D A;  4BBQ A;  2LGV A;  5D1L B;  5D1M B;  2LXP C;  3O34 A;  5B79 A;  2C2V S;  5KH7 A;  2YQL A;  1WEO A;  3IHP A;  5FB1 A;  4N4F A;  2FFW A;  2E6S A;  2MD7 B;  2CT2 A;  1Z2Q A;  2ECG A;  2D8S A;  4R8P K;  1WIM A;  3C5K A;  4UP5 A;  5J3X A;  3HTK C;  4R2Y A;  2M85 A;  4WZ3 B;  3M62 A;  3KV6 A;  5LKT A;  5LCW B;  2Y43 A;  3EB5 A;  4IC3 A;  3FEH A;  2H0D A;  2JM3 A;  1WIL A;  2YRE A;  2JUN A;  4F1P A;  1K2F A;  4LAD B;  2DSM A;  2F6J A;  5LKX A;  4ZQL A;  2G45 A;  2Y1M A;  3N9M A;  4WZ2 A;  4A49 A;  5B78 A;  4H9D A;  2KWJ A;  2MNZ A;  2VJF B;  2K17 A;  3L1Z B;  1ZBD B;  2LN0 A;  4YAB A;  5AIT A;  2NAA A;  2KRE A;  5TDW A;  3SOW A;  1WEW A;  3N9P A;  2YYR A;  4FIP A;  2XP0 A;  2YW8 A;  2JMI A;  5H1T A;  3SOU A;  5TRB A;  3PUR A;  3ZVY A;  4L7X A;  4YBS A;  4AP4 A;  4IC2 A;  2IDA A;  1E4U A;  4QF3 A;  2B0O E;  1T1H A;  3O7A A;  4MVT A;  3T6R A;  1RMD A;  4GB0 A;  2VNF A;  2VPE A;  2QIZ A;  2L5U A;  2CON A;  1MM2 A;  4Z0R A;  2MIQ A;  2YHO A;  2M3H A;  3KDE C;  4AYC B;  2DJA A;  1WEP A;  1XWH A;  5EYA F;  2JMJ A;  2FD4 A;  3HCU A;  3LQJ A;  3GV4 A;  4L58 A;  4MSX A;  2C2L A;  4LLB A;  5G0F A;  2FUI A;  3V43 A;  3O47 A;  4C9Z A;  2KU3 A;  5G04 B;  3C6W A;  1WEN A;  5K3Q A;  1WGM A;  4PPE A;  2MA6 A;  2LGL A;  4BHW A;  2M6M A;  4LKA A;  4FJC A;  2YUC A;  3U5M A;  3M99 A;  2MD8 C;  2KIZ A;  4W4U A;  2LRI C;  4GNE A;  4A4C A;  3LVQ E;  2CRW A;  2VJE A;  2LDR A;  4N3W A;  1V87 A;  1WEV A;  5B76 A;  3SOX A;  2KGI A;  5FEY A;  3N9L A;  2AN6 A;  1JM7 B;  2CKL B;  4F52 B;  2I50 A;  5JG6 A;  4ZUX U;  4WA6 A;  1X4J A;  2KKY A;  1DVP A;  1CHC A;  4A0C D;  2MA5 A;  3ZVZ B;  5SVX A;  2HYE D;  2LGK A;  1VFY A;  3PHD A;  1VD4 A;  2XOY A;  3VK6 A;  2VPB A;  2LAU A;  3JUE A;  3DQV R;  2XEU A;  2QIC A;  3LQI A;  2KWO A;  3O37 A;  4V3K C;  2PNX A;  3PLW A;  1MBM A;  1Z6U A;  4O64 A;  2CRR A;  3M63 A;  3L1X A;  2RI7 A;  3GL6 A;  2M1R A;  4AVX A;  5DKA A;  4I7C A;  3U5P A;  2YT5 A;  3EB6 A;  3SHB A;  2EGP A;  5C13 A; 
#chains in the Genus database with same CATH homology
 4GNF A;  2RSD A;  2JMD A;  4CCG X;  5LKZ A;  1JOC A;  2MUM A;  4YC9 A;  3O35 A;  3T7L A;  1X4I A;  4ZDT A;  1G25 A;  2BAY A;  4P5O B;  4B7Y C;  2ECW A;  2OXQ C;  2MNY A;  3RPG C;  5KH3 A;  5H1U A;  5KH9 A;  5B77 A;  3DPL R;  2ZET C;  2PUY A;  4YAD A;  2K16 A;  5B75 A;  1WEM A;  3KQI A;  1BOR A;  4YBT A;  3U5O A;  2KYU A;  2FSA A;  3MHS A;  2ECJ A;  3MHH A;  3RPG B;  2XB1 A;  1WEQ A;  4S3O C;  2LV9 A;  2QJ0 A;  4FO9 A;  4I7B A;  1MM3 A;  5FER A;  4XI1 A;  2JRJ A;  2L80 A;  4A4B A;  2KWN A;  1HYJ A;  3QZV A;  1X4U A;  3HCT A;  2HDP A;  5LKU A;  2Y1N A;  3KNV A;  5DIN A;  3U5N A;  2G43 A;  2H0D B;  4X3G A;  4S3O B;  1WFK A;  4R7E A;  2K1J A;  2VPD A;  3ZYQ A;  3ASL A;  1HYI A;  5C11 A;  5TBN A;  3LRQ A;  4AYC A;  4UI9 B;  1IYM A;  4B86 C;  1VYX A;  1WE9 A;  1WES A;  3ZTG A;  1WEU A;  4YAX A;  2LXH C;  2F42 A;  3N9Q A;  2L43 A;  3ZPV E;  3I2D A;  2ECT A;  5D1K B;  2K4D A;  1U6G B;  2F6N A;  5TAB A;  5H1V A;  2YUR A;  3FL2 A;  5B8D A;  2EA6 A;  2L0B A;  3ZPV 1;  4Q6F A;  3PUQ A;  2DX8 A;  3LQH A;  1JM7 A;  2YU4 A;  2CKL A;  3HCS A;  1FP0 A;  2YHN A;  5G05 B;  2L75 A;  3RTR B;  1WEE A;  4UP0 A;  2YSJ A;  1FBV A;  2LGG A;  1Z60 A;  2YSM A;  3O36 A;  2ECV A;  3N9N A;  4FK5 A;  2VP7 A;  3L11 A;  3N9O A;  5FB0 A;  2LQ6 A;  1N87 A;  3NG2 A;  4PTB A;  1F62 A;  2FUU A;  1LDK C;  2EOD A;  4V3L C;  2E6R A;  4YBM A;  4GNG A;  4CA1 A;  2MT5 A;  4QF2 A;  3O70 A;  2KGG A;  2ECN A;  2UZG A;  5AIU A;  3ZNI A;  4GND A;  2ECI A;  1LDJ B;  2VJF A;  4NN2 A;  2CSZ A;  2VJE B;  2YQM A;  4TKP B;  5TDR A;  4AUQ B;  5H9M A;  2KFT A;  4WZ0 A;  2VPG A;  3KV5 A;  2CSY A;  2KE1 A;  2KR4 A;  4LK9 A;  2KWK A;  2G6Q A;  4LJN A;  3O33 A;  5I3L A;  4YAT A;  4I7D A;  4BBQ A;  2LGV A;  5D1L B;  5D1M B;  2LXP C;  3O34 A;  5B79 A;  2C2V S;  5KH7 A;  2YQL A;  1WEO A;  3IHP A;  5FB1 A;  4N4F A;  2E6S A;  2MD7 B;  2CT2 A;  1Z2Q A;  2ECG A;  2D8S A;  4R8P K;  1WIM A;  3C5K A;  4UP5 A;  5J3X A;  3HTK C;  4R2Y A;  2M85 A;  4WZ3 B;  3M62 A;  3KV6 A;  5LKT A;  5LCW B;  2Y43 A;  3EB5 A;  4IC3 A;  2H0D A;  1WIL A;  2YRE A;  1K2F A;  4LAD B;  2F6J A;  5LKX A;  4ZQL A;  2G45 A;  2Y1M A;  3N9M A;  4WZ2 A;  4A49 A;  5B78 A;  2KWJ A;  2MNZ A;  2VJF B;  2K17 A;  3L1Z B;  1ZBD B;  2LN0 A;  4YAB A;  5AIT A;  2NAA A;  2KRE A;  5TDW A;  3SOW A;  1WEW A;  3N9P A;  2YYR A;  4FIP A;  2YW8 A;  2JMI A;  5H1T A;  3SOU A;  5TRB A;  3PUR A;  3ZVY A;  4L7X A;  4YBS A;  4AP4 A;  4IC2 A;  2IDA A;  1E4U A;  4QF3 A;  1T1H A;  3O7A A;  4MVT A;  3T6R A;  1RMD A;  4GB0 A;  2VNF A;  2VPE A;  2QIZ A;  2L5U A;  1MM2 A;  2MIQ A;  2YHO A;  2M3H A;  4AYC B;  1WEP A;  1XWH A;  5EYA F;  2JMJ A;  3HCU A;  3LQJ A;  3GV4 A;  4L58 A;  4MSX A;  2C2L A;  4LLB A;  5G0F A;  2FUI A;  3V43 A;  4C9Z A;  2KU3 A;  5G04 B;  3C6W A;  1WEN A;  1WGM A;  4PPE A;  2MA6 A;  2LGL A;  4BHW A;  2M6M A;  4LKA A;  4FJC A;  2YUC A;  3U5M A;  3M99 A;  2MD8 C;  2KIZ A;  4W4U A;  2LRI C;  4GNE A;  4A4C A;  2VJE A;  2LDR A;  4N3W A;  1V87 A;  1WEV A;  5B76 A;  3SOX A;  2KGI A;  5FEY A;  3N9L A;  2AN6 A;  1JM7 B;  2CKL B;  4F52 B;  2I50 A;  5JG6 A;  4ZUX U;  4WA6 A;  1X4J A;  1DVP A;  1CHC A;  4A0C D;  2MA5 A;  3ZVZ B;  2HYE D;  2LGK A;  1VFY A;  3PHD A;  1VD4 A;  3VK6 A;  2VPB A;  3DQV R;  2XEU A;  2QIC A;  3LQI A;  2KWO A;  3O37 A;  4V3K C;  2PNX A;  1Z6U A;  4O64 A;  3M63 A;  3L1X A;  2RI7 A;  3GL6 A;  2M1R A;  4AVX A;  5DKA A;  4I7C A;  3U5P A;  2YT5 A;  3EB6 A;  3SHB A;  2EGP A;  5C13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...