2UZGA

Zf-ubp domain of vdu1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'RNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 33
molecule tags Hydrolase
source organism Homo sapiens
publication title The Solution Structure of the Znf Ubp Domain of Usp33/Vdu1.
pubmed doi rcsb
total genus 17
structure length 95
sequence length 95
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2uzgA00
3N9LA 2KU3A 3O7AA 3O33A 4AYCA 4XI1A 4WZ2A 2KE1A 2CT2A 1E4UA 2G6QA 2YHNA 2LGKA 4GNEA 4UP0A 2H0DA 2Y1NA 4A49A 4ZDTA 5TBNA 2FSAA 2F6NA 3PUQA 5LKZA 2K4DA 2HYED 5FERA 2YSMA 4P5OB 3U5NA 1FP0A 2ECVA 2G45A 2MD8C 2RI7A 4WA6A 1Z2QA 1Z6UA 3LQJA 4F52B 2VJEA 1WILA 2M85A 3DQVR 3KV5A 3HCTA 4LKAA 5G0FA 3IHPA 3N9OA 4I7CA 1X4UA 1ZBDB 2K1JA 5D1MB 2Y1MA 1XWHA 2VP7A 1N87A 2G43A 4CCGX 4FJCA 3LQIA 3N9NA 5H9MA 3VK6A 2EGPA 1G25A 4YABA 3EB6A 1JM7B 5AITA 5LCWB 1RMDA 2YHOA 1X4IA 2LGLA 4W4UA 1X4JA 2I50A 2VJFA 1WEUA 1F62A 1WEWA 4S3OB 2YU4A 2MIQA 1IYMA 2XEUA 5KH7A 3NG2A 3T7LA 3U5OA 2KGGA 4AP4A 2LGGA 2K17A 3HCSA 1WIMA 3L1ZB 4GB0A 2LN0A 3KQIA 1HYIA 4ZUXU 1DVPA 3RPGB 5KH9A 2VPDA 2ECWA 5D1KB 2LQ6A 4WZ3B 2FUIA 2VPEA 4YATA 3ZVYA 4FIPA 4L58A 1WE9A 2HDPA 2JMJA 4QF3A 2E6SA 2KYUA 5B75A 5H1TA 2LGVA 3MHSA 2VJFB 1HYJA 3O37A 3N9PA 3LRQA 3ZYQA 2YURA 1VYXA 5TABA 4GNFA 1WEVA 3O36A 2M3HA 4CA1A 3V43A 2BAYA 2ECJA 5FB0A 4I7DA 4PPEA 4FO9A 3RPGC 4X3GA 2ECNA 2DX8A 2MA5A 1WGMA 1LDJB 4WZ0A 3ZTGA 2KWKA 1U6GB 5DINA 2M1RA 5B8DA 2CSZA 2KIZA 4LADB 3FL2A 2L0BA 1CHCA 4ZQLA 3U5MA 3QZVA 3SOXA 2VJEB 1FBVA 3U5PA 3LQHA 3L1XA 5B79A 4TKPB 4LLBA 2XB1A 2KWNA 2CKLB 2L5UA 3KNVA 2KWJA 1VFYA 5C13A 4MVTA 5B78A 1MM3A 2EA6A 4MSXA 4N3WA 4B7YC 4LJNA 2YSJA 4YBMA 4R2YA 2RSDA 2ZETC 3N9MA 4A4CA 2L80A 2ECIA 2OXQC 2MT5A 4S3OC 2C2LA 4YADA 4QF2A 4UP5A 2VPBA 4LK9A 4AVXA 2PUYA 4N4FA 2YYRA 2PNXA 5AIUA 4AYCB 5EYAF 4AUQB 2KFTA 2M6MA 5LKUA 3HTKC 2CSYA 3C5KA 5LKTA 3SOUA 2YQLA 2MNYA 4PTBA 2YREA 2C2VS 5TRBA 3M99A 2YUCA 1WEEA 2KWOA 4GNGA 2LDRA 2LXPC 2KGIA 3O35A 3PHDA 4UI9B 4IC2A 3KV6A 1Z60A 4FK5A 4L7XA 2IDAA 4A0CD 1WEQA 4C9ZA 3T6RA 4Q6FA 3DPLR 3I2DA 1MM2A 2ECTA 5D1LB 4BBQA 3ZNIA 3GV4A 5G05B 2AN6A 5DKAA 2ECGA 2JMIA 5G04B 1WEOA 2MUMA 2NAAA 5J3XA 3GL6A 4GNDA 1WEPA 2EODA 3L11A 2UZGA 3M63A 2H0DB 5FEYA 2Y43A 4NN2A 4YAXA 1VD4A 2MA6A 4V3KC 3ZPVE 4BHWA 1WENA 4R7EA 3O70A 4I7BA 5H1UA 2FUUA 2QICA 2F6JA 3N9QA 3PURA 5I3LA 5TDRA 3EB5A 5JG6A 2VPGA 2MNZA 5KH3A 2LV9A 3SOWA 3ZVZB 3SHBA 4O64A 2K16A 4YC9A 3ZPV1 3RTRB 2QIZA 5H1VA 5B77A 2L75A 2QJ0A 3M62A 4YBSA 2VNFA 2KR4A 2YW8A 2YT5A 2E6RA 3C6WA 2D8SA 1WEMA 2F42A 5C11A 2CKLA 1V87A 5TDWA 5B76A 1K2FA 2JRJA 2L43A 5FB1A 4IC3A 3ASLA 2KREA 2JMDA 4A4BA 4R8PK 1T1HA 4V3LC 1WESA 1WFKA 2MD7B 3MHHA 1BORA 3O34A 2LRIC 4YBTA 4B86C 1JOCA 1JM7A 5LKXA 2LXHC 3HCUA 2YQMA 1LDKC
chains in the Genus database with same CATH superfamily
4OGEA 2XOCA 3N9LA 2KU3A 3O7AA 3O33A 4AYCA 4XI1A 4WZ2A 2L7PA 2KE1A 2CT2A 1E4UA 2G6QA 2YHNA 2LGKA 2CRRA 4GNEA 4UP0A 2H0DA 2OWAA 2Y1NA 4A49A 4ZDTA 5TBNA 2FSAA 2F6NA 3PUQA 5LKZA 2K4DA 2HYED 5FERA 2YSMA 2EXUA 2RR4A 4P5OB 3U5NA 1FP0A 2ECVA 2G45A 2MD8C 2RI7A 4WA6A 1Z2QA 2FD4A 1Z6UA 3LQJA 3H7HA 4F52B 2VJEA 1WILA 2M85A 3DQVR 3KV5A 2JUNA 3HCTA 4LKAA 5G0FA 4Z0OA 3IHPA 3N9OA 4I7CA 1X4UA 1ZBDB 2K1JA 5D1MB 2Y1MA 1XWHA 2VP7A 1N87A 2G43A 4CCGX 4FJCA 3LQIA 3N9NA 5H9MA 3VK6A 2EGPA 1G25A 4YABA 3EB6A 1JM7B 5AITA 5LCWB 1RMDA 2YHOA 3O47A 1X4IA 2LGLA 4W4UA 1X4JA 2I50A 2VJFA 1WEUA 1F62A 1WEWA 3MDBC 4S3OB 2YU4A 2MIQA 1IYMA 2XEUA 5KH7A 3NG2A 3T7LA 3U5OA 2M13A 2KGGA 3Q1DA 4AP4A 2XOYA 2LGGA 2K17A 3HCSA 1WIMA 3LVRE 3L1ZB 4GB0A 2LN0A 3KQIA 1HYIA 3SUBA 4ZUXU 1DVPA 3RPGB 5KH9A 2VPDA 2ECWA 5D1KB 2LQ6A 3DDTA 4WZ3B 2FUIA 2VPEA 2YVRA 4YATA 3ZVYA 4FIPA 4L58A 2EGMA 1WE9A 2HDPA 2JMJA 4QF3A 2E6SA 2KYUA 5B75A 5H1TA 2LGVA 3FJUB 3MHSA 2VJFB 1HYJA 3O37A 3N9PA 3LRQA 3ZYQA 1DCQA 2YURA 5SVXA 1VYXA 5TABA 4GNFA 1WEVA 1MBMA 3O36A 2M3HA 3V43A 4CA1A 2BAYA 2ECJA 5FB0A 4I7DA 4PPEA 4FO9A 3RPGC 4X3GA 2ECNA 2DX8A 2MA5A 1WGMA 1LDJB 4WZ0A 3ZTGA 2KWKA 1U6GB 5DINA 2D8UA 2M1RA 5B8DA 2CSZA 2KIZA 4LADB 3FL2A 2L0BA 1CHCA 4ZQLA 3U5MA 2XP0A 3QZVA 2CONA 2VJEB 1FBVA 3SOXA 3U5PA 3LDYA 3M7KA 2E61A 3LQHA 3L1XA 5B79A 3FM8C 4TKPB 4LLBA 2XB1A 2KWNA 2CKLB 2L5UA 3KNVA 2KWJA 1VFYA 5C13A 2KKYA 4Z0RA 4MVTA 5B78A 1MM3A 4F1PA 2EA6A 4MSXA 4N3WA 4B7YC 4LJNA 2YSJA 4YBMA 4R2YA 2RSDA 2ZETC 3N9MA 4A4CA 2FFWA 2JM3A 2L80A 5K3QA 2ECIA 2OXQC 2MT5A 4S3OC 2C2LA 4YADA 4QF2A 5SVYA 5SVIB 4UP5A 3KDEC 2VPBA 4LK9A 4AVXA 2PUYA 3E2DA 4N4FA 2YYRA 2PNXA 5AIUA 4AYCB 5EYAF 4AUQB 2KFTA 2M6MA 5LKUA 3HTKC 2CSYA 3C5KA 5LKTA 3SOUA 2YQLA 2MNYA 4PTBA 2YREA 2C2VS 5TRBA 2XOZA 3M99A 2YUCA 3LJUX 3FEHA 1WEEA 2KWOA 4GNGA 2LDRA 2LXPC 2KGIA 3PLWA 3O35A 3PHDA 4UI9B 4IC2A 3KV6A 4H9DA 5SVIA 1Z60A 4FK5A 4L7XA 2IDAA 4A0CD 1WEQA 4C9ZA 3T6RA 4Q6FA 3DPLR 3I2DA 1MM2A 2ECTA 5D1LB 4BBQA 3ZNIA 2IQJA 3GV4A 5G05B 2AN6A 5DKAA 2ECGA 2JMIA 5G04B 1WEOA 2MUMA 2CRWA 2NAAA 5J3XA 2KKXA 4QQ4A 3GL6A 4GNDA 1WEPA 2EODA 2B0OE 3L11A 3FAOA 2UZGA 3M63A 2H0DB 5FEYA 2Y43A 4NN2A 4YAXA 2CSVA 3T9KA 1VD4A 2MA6A 4V3KC 3ZPVE 4BHWA 1WENA 4R7EA 3DWDA 3O70A 4I7BA 5H1UA 2FUUA 2QICA 2F6JA 3N9QA 3PURA 5I3LA 5TDRA 3EB5A 5JG6A 2P57A 2VPGA 2MNZA 5KH3A 2LV9A 3LVQE 3SOWA 3ZVZB 3FANA 3SHBA 4O64A 2K16A 4YC9A 3ZPV1 3RTRB 2QIZA 5H1VA 5B77A 2MKEA 2L75A 2QJ0A 3M62A 4YBSA 2LAUA 2VNFA 2KR4A 2YW8A 2YT5A 2E6RA 3C6WA 2DJAA 2D8SA 2DSMA 1WEMA 2F42A 5C11A 2CKLA 1V87A 5TDWA 5B76A 1K2FA 2JRJA 2L43A 4O62A 5FB1A 4IC3A 3ASLA 3JUEA 2KREA 2JMDA 4A4BA 4R8PK 1T1HA 4OGCA 4V3LC 1WESA 1WFKA 2MD7B 3MHHA 1BORA 3O34A 2LRIC 4YBTA 4B86C 1JOCA 1JM7A 5LKXA 2LXHC 3HCUA 2YQMA 1LDKC
chains in the Genus database with same CATH topology
3N9LA 2KU3A 3O7AA 3O33A 4AYCA 4XI1A 4WZ2A 2KE1A 2CT2A 1E4UA 2G6QA 2YHNA 2LGKA 4GNEA 4UP0A 2H0DA 2Y1NA 4A49A 4ZDTA 5TBNA 2FSAA 2F6NA 3PUQA 5LKZA 2K4DA 2HYED 5FERA 2YSMA 4P5OB 3U5NA 1FP0A 2ECVA 2G45A 2MD8C 2RI7A 4WA6A 1Z2QA 1Z6UA 3LQJA 4F52B 2VJEA 1WILA 2M85A 3DQVR 3KV5A 3HCTA 4LKAA 5G0FA 3IHPA 3N9OA 4I7CA 1X4UA 1ZBDB 2K1JA 5D1MB 2Y1MA 1XWHA 2VP7A 1N87A 2G43A 4CCGX 4FJCA 3LQIA 3N9NA 5H9MA 3VK6A 2EGPA 1G25A 4YABA 3EB6A 1JM7B 5AITA 5LCWB 1RMDA 2YHOA 1X4IA 2LGLA 4W4UA 1X4JA 2I50A 2VJFA 1WEUA 1F62A 1WEWA 4S3OB 2YU4A 2MIQA 1IYMA 2XEUA 5KH7A 3NG2A 3T7LA 3U5OA 2KGGA 4AP4A 2LGGA 2K17A 3HCSA 1WIMA 3L1ZB 4GB0A 2LN0A 3KQIA 1HYIA 4ZUXU 1DVPA 3RPGB 5KH9A 2VPDA 2ECWA 5D1KB 2LQ6A 4WZ3B 2FUIA 2VPEA 4YATA 3ZVYA 4FIPA 4L58A 1WE9A 2HDPA 2JMJA 4QF3A 2E6SA 2KYUA 5B75A 5H1TA 2LGVA 3MHSA 2VJFB 1HYJA 3O37A 3N9PA 3LRQA 3ZYQA 2YURA 1VYXA 5TABA 4GNFA 1WEVA 3O36A 2M3HA 4CA1A 3V43A 2BAYA 2ECJA 5FB0A 4I7DA 4PPEA 4FO9A 3RPGC 4X3GA 2ECNA 2DX8A 2MA5A 1WGMA 1LDJB 4WZ0A 3ZTGA 2KWKA 1U6GB 5DINA 2M1RA 5B8DA 2CSZA 2KIZA 4LADB 3FL2A 2L0BA 1CHCA 4ZQLA 3U5MA 3QZVA 3SOXA 2VJEB 1FBVA 3U5PA 3LQHA 3L1XA 5B79A 4TKPB 4LLBA 2XB1A 2KWNA 2CKLB 2L5UA 3KNVA 2KWJA 1VFYA 5C13A 4MVTA 5B78A 1MM3A 2EA6A 4MSXA 4N3WA 4B7YC 4LJNA 2YSJA 4YBMA 4R2YA 2RSDA 2ZETC 3N9MA 4A4CA 2L80A 2ECIA 2OXQC 2MT5A 4S3OC 2C2LA 4YADA 4QF2A 4UP5A 2VPBA 4LK9A 4AVXA 2PUYA 4N4FA 2YYRA 2PNXA 5AIUA 4AYCB 5EYAF 4AUQB 2KFTA 2M6MA 5LKUA 3HTKC 2CSYA 3C5KA 5LKTA 3SOUA 2YQLA 2MNYA 4PTBA 2YREA 2C2VS 5TRBA 3M99A 2YUCA 1WEEA 2KWOA 4GNGA 2LDRA 2LXPC 2KGIA 3O35A 3PHDA 4UI9B 4IC2A 3KV6A 1Z60A 4FK5A 4L7XA 2IDAA 4A0CD 1WEQA 4C9ZA 3T6RA 4Q6FA 3DPLR 3I2DA 1MM2A 2ECTA 5D1LB 4BBQA 3ZNIA 3GV4A 5G05B 2AN6A 5DKAA 2ECGA 2JMIA 5G04B 1WEOA 2MUMA 2NAAA 5J3XA 3GL6A 4GNDA 1WEPA 2EODA 3L11A 2UZGA 3M63A 2H0DB 5FEYA 2Y43A 4NN2A 4YAXA 1VD4A 2MA6A 4V3KC 3ZPVE 4BHWA 1WENA 4R7EA 3O70A 4I7BA 5H1UA 2FUUA 2QICA 2F6JA 3N9QA 3PURA 5I3LA 5TDRA 3EB5A 5JG6A 2VPGA 2MNZA 5KH3A 2LV9A 3SOWA 3ZVZB 3SHBA 4O64A 2K16A 4YC9A 3ZPV1 3RTRB 2QIZA 5H1VA 5B77A 2L75A 2QJ0A 3M62A 4YBSA 2VNFA 2KR4A 2YW8A 2YT5A 2E6RA 3C6WA 2D8SA 1WEMA 2F42A 5C11A 2CKLA 1V87A 5TDWA 5B76A 1K2FA 2JRJA 2L43A 5FB1A 4IC3A 3ASLA 2KREA 2JMDA 4A4BA 4R8PK 1T1HA 4V3LC 1WESA 1WFKA 2MD7B 3MHHA 1BORA 3O34A 2LRIC 4YBTA 4B86C 1JOCA 1JM7A 5LKXA 2LXHC 3HCUA 2YQMA 1LDKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9L A;  2KU3 A;  3O7A A;  3O33 A;  4AYC A;  4XI1 A;  4WZ2 A;  2KE1 A;  2CT2 A;  1E4U A;  2G6Q A;  2YHN A;  2LGK A;  4GNE A;  4UP0 A;  2H0D A;  2Y1N A;  4A49 A;  4ZDT A;  5TBN A;  2FSA A;  2F6N A;  3PUQ A;  5LKZ A;  2K4D A;  2HYE D;  5FER A;  2YSM A;  4P5O B;  3U5N A;  1FP0 A;  2ECV A;  2G45 A;  2MD8 C;  2RI7 A;  4WA6 A;  1Z2Q A;  1Z6U A;  3LQJ A;  4F52 B;  2VJE A;  1WIL A;  2M85 A;  3DQV R;  3KV5 A;  3HCT A;  4LKA A;  5G0F A;  3IHP A;  3N9O A;  4I7C A;  1X4U A;  1ZBD B;  2K1J A;  5D1M B;  2Y1M A;  1XWH A;  2VP7 A;  1N87 A;  2G43 A;  4CCG X;  4FJC A;  3LQI A;  3N9N A;  5H9M A;  3VK6 A;  2EGP A;  1G25 A;  4YAB A;  3EB6 A;  1JM7 B;  5AIT A;  5LCW B;  1RMD A;  2YHO A;  1X4I A;  2LGL A;  4W4U A;  1X4J A;  2I50 A;  2VJF A;  1WEU A;  1F62 A;  1WEW A;  4S3O B;  2YU4 A;  2MIQ A;  1IYM A;  2XEU A;  5KH7 A;  3NG2 A;  3T7L A;  3U5O A;  2KGG A;  4AP4 A;  2LGG A;  2K17 A;  3HCS A;  1WIM A;  3L1Z B;  4GB0 A;  2LN0 A;  3KQI A;  1HYI A;  4ZUX U;  1DVP A;  3RPG B;  5KH9 A;  2VPD A;  2ECW A;  5D1K B;  2LQ6 A;  4WZ3 B;  2FUI A;  2VPE A;  4YAT A;  3ZVY A;  4FIP A;  4L58 A;  1WE9 A;  2HDP A;  2JMJ A;  4QF3 A;  2E6S A;  2KYU A;  5B75 A;  5H1T A;  2LGV A;  3MHS A;  2VJF B;  1HYJ A;  3O37 A;  3N9P A;  3LRQ A;  3ZYQ A;  2YUR A;  1VYX A;  5TAB A;  4GNF A;  1WEV A;  3O36 A;  2M3H A;  4CA1 A;  3V43 A;  2BAY A;  2ECJ A;  5FB0 A;  4I7D A;  4PPE A;  4FO9 A;  3RPG C;  4X3G A;  2ECN A;  2DX8 A;  2MA5 A;  1WGM A;  1LDJ B;  4WZ0 A;  3ZTG A;  2KWK A;  1U6G B;  5DIN A;  2M1R A;  5B8D A;  2CSZ A;  2KIZ A;  4LAD B;  3FL2 A;  2L0B A;  1CHC A;  4ZQL A;  3U5M A;  3QZV A;  3SOX A;  2VJE B;  1FBV A;  3U5P A;  3LQH A;  3L1X A;  5B79 A;  4TKP B;  4LLB A;  2XB1 A;  2KWN A;  2CKL B;  2L5U A;  3KNV A;  2KWJ A;  1VFY A;  5C13 A;  4MVT A;  5B78 A;  1MM3 A;  2EA6 A;  4MSX A;  4N3W A;  4B7Y C;  4LJN A;  2YSJ A;  4YBM A;  4R2Y A;  2RSD A;  2ZET C;  3N9M A;  4A4C A;  2L80 A;  2ECI A;  2OXQ C;  2MT5 A;  4S3O C;  2C2L A;  4YAD A;  4QF2 A;  4UP5 A;  2VPB A;  4LK9 A;  4AVX A;  2PUY A;  4N4F A;  2YYR A;  2PNX A;  5AIU A;  4AYC B;  5EYA F;  4AUQ B;  2KFT A;  2M6M A;  5LKU A;  3HTK C;  2CSY A;  3C5K A;  5LKT A;  3SOU A;  2YQL A;  2MNY A;  4PTB A;  2YRE A;  2C2V S;  5TRB A;  3M99 A;  2YUC A;  1WEE A;  2KWO A;  4GNG A;  2LDR A;  2LXP C;  2KGI A;  3O35 A;  3PHD A;  4UI9 B;  4IC2 A;  3KV6 A;  1Z60 A;  4FK5 A;  4L7X A;  2IDA A;  4A0C D;  1WEQ A;  4C9Z A;  3T6R A;  4Q6F A;  3DPL R;  3I2D A;  1MM2 A;  2ECT A;  5D1L B;  4BBQ A;  3ZNI A;  3GV4 A;  5G05 B;  2AN6 A;  5DKA A;  2ECG A;  2JMI A;  5G04 B;  1WEO A;  2MUM A;  2NAA A;  5J3X A;  3GL6 A;  4GND A;  1WEP A;  2EOD A;  3L11 A;  2UZG A;  3M63 A;  2H0D B;  5FEY A;  2Y43 A;  4NN2 A;  4YAX A;  1VD4 A;  2MA6 A;  4V3K C;  3ZPV E;  4BHW A;  1WEN A;  4R7E A;  3O70 A;  4I7B A;  5H1U A;  2FUU A;  2QIC A;  2F6J A;  3N9Q A;  3PUR A;  5I3L A;  5TDR A;  3EB5 A;  5JG6 A;  2VPG A;  2MNZ A;  5KH3 A;  2LV9 A;  3SOW A;  3ZVZ B;  3SHB A;  4O64 A;  2K16 A;  4YC9 A;  3ZPV 1;  3RTR B;  2QIZ A;  5H1V A;  5B77 A;  2L75 A;  2QJ0 A;  3M62 A;  4YBS A;  2VNF A;  2KR4 A;  2YW8 A;  2YT5 A;  2E6R A;  3C6W A;  2D8S A;  1WEM A;  2F42 A;  5C11 A;  2CKL A;  1V87 A;  5TDW A;  5B76 A;  1K2F A;  2JRJ A;  2L43 A;  5FB1 A;  4IC3 A;  3ASL A;  2KRE A;  2JMD A;  4A4B A;  4R8P K;  1T1H A;  4V3L C;  1WES A;  1WFK A;  2MD7 B;  3MHH A;  1BOR A;  3O34 A;  2LRI C;  4YBT A;  4B86 C;  1JOC A;  1JM7 A;  5LKX A;  2LXH C;  3HCU A;  2YQM A;  1LDK C; 
#chains in the Genus database with same CATH topology
 4OGE A;  2XOC A;  3N9L A;  2KU3 A;  3O7A A;  3O33 A;  4AYC A;  4XI1 A;  4WZ2 A;  2L7P A;  2KE1 A;  2CT2 A;  1E4U A;  2G6Q A;  2YHN A;  2LGK A;  2CRR A;  4GNE A;  4UP0 A;  2H0D A;  2OWA A;  2Y1N A;  4A49 A;  4ZDT A;  5TBN A;  2FSA A;  2F6N A;  3PUQ A;  5LKZ A;  2K4D A;  2HYE D;  5FER A;  2YSM A;  2EXU A;  2RR4 A;  4P5O B;  3U5N A;  1FP0 A;  2ECV A;  2G45 A;  2MD8 C;  2RI7 A;  4WA6 A;  1Z2Q A;  2FD4 A;  1Z6U A;  3LQJ A;  3H7H A;  4F52 B;  2VJE A;  1WIL A;  2M85 A;  3DQV R;  3KV5 A;  2JUN A;  3HCT A;  4LKA A;  5G0F A;  4Z0O A;  3IHP A;  3N9O A;  4I7C A;  1X4U A;  1ZBD B;  2K1J A;  5D1M B;  2Y1M A;  1XWH A;  2VP7 A;  1N87 A;  2G43 A;  4CCG X;  4FJC A;  3LQI A;  3N9N A;  5H9M A;  3VK6 A;  2EGP A;  1G25 A;  4YAB A;  3EB6 A;  1JM7 B;  5AIT A;  5LCW B;  1RMD A;  2YHO A;  3O47 A;  1X4I A;  2LGL A;  4W4U A;  1X4J A;  2I50 A;  2VJF A;  1WEU A;  1F62 A;  1WEW A;  3MDB C;  4S3O B;  2YU4 A;  2MIQ A;  1IYM A;  2XEU A;  5KH7 A;  3NG2 A;  3T7L A;  3U5O A;  2M13 A;  2KGG A;  3Q1D A;  4AP4 A;  2XOY A;  2LGG A;  2K17 A;  3HCS A;  1WIM A;  3LVR E;  3L1Z B;  4GB0 A;  2LN0 A;  3KQI A;  1HYI A;  3SUB A;  4ZUX U;  1DVP A;  3RPG B;  5KH9 A;  2VPD A;  2ECW A;  5D1K B;  2LQ6 A;  3DDT A;  4WZ3 B;  2FUI A;  2VPE A;  2YVR A;  4YAT A;  3ZVY A;  4FIP A;  4L58 A;  2EGM A;  1WE9 A;  2HDP A;  2JMJ A;  4QF3 A;  2E6S A;  2KYU A;  5B75 A;  5H1T A;  2LGV A;  3FJU B;  3MHS A;  2VJF B;  1HYJ A;  3O37 A;  3N9P A;  3LRQ A;  3ZYQ A;  1DCQ A;  2YUR A;  5SVX A;  1VYX A;  5TAB A;  4GNF A;  1WEV A;  1MBM A;  3O36 A;  2M3H A;  3V43 A;  4CA1 A;  2BAY A;  2ECJ A;  5FB0 A;  4I7D A;  4PPE A;  4FO9 A;  3RPG C;  4X3G A;  2ECN A;  2DX8 A;  2MA5 A;  1WGM A;  1LDJ B;  4WZ0 A;  3ZTG A;  2KWK A;  1U6G B;  5DIN A;  2D8U A;  2M1R A;  5B8D A;  2CSZ A;  2KIZ A;  4LAD B;  3FL2 A;  2L0B A;  1CHC A;  4ZQL A;  3U5M A;  2XP0 A;  3QZV A;  2CON A;  2VJE B;  1FBV A;  3SOX A;  3U5P A;  3LDY A;  3M7K A;  2E61 A;  3LQH A;  3L1X A;  5B79 A;  3FM8 C;  4TKP B;  4LLB A;  2XB1 A;  2KWN A;  2CKL B;  2L5U A;  3KNV A;  2KWJ A;  1VFY A;  5C13 A;  2KKY A;  4Z0R A;  4MVT A;  5B78 A;  1MM3 A;  4F1P A;  2EA6 A;  4MSX A;  4N3W A;  4B7Y C;  4LJN A;  2YSJ A;  4YBM A;  4R2Y A;  2RSD A;  2ZET C;  3N9M A;  4A4C A;  2FFW A;  2JM3 A;  2L80 A;  5K3Q A;  2ECI A;  2OXQ C;  2MT5 A;  4S3O C;  2C2L A;  4YAD A;  4QF2 A;  5SVY A;  5SVI B;  4UP5 A;  3KDE C;  2VPB A;  4LK9 A;  4AVX A;  2PUY A;  3E2D A;  4N4F A;  2YYR A;  2PNX A;  5AIU A;  4AYC B;  5EYA F;  4AUQ B;  2KFT A;  2M6M A;  5LKU A;  3HTK C;  2CSY A;  3C5K A;  5LKT A;  3SOU A;  2YQL A;  2MNY A;  4PTB A;  2YRE A;  2C2V S;  5TRB A;  2XOZ A;  3M99 A;  2YUC A;  3LJU X;  3FEH A;  1WEE A;  2KWO A;  4GNG A;  2LDR A;  2LXP C;  2KGI A;  3PLW A;  3O35 A;  3PHD A;  4UI9 B;  4IC2 A;  3KV6 A;  4H9D A;  5SVI A;  1Z60 A;  4FK5 A;  4L7X A;  2IDA A;  4A0C D;  1WEQ A;  4C9Z A;  3T6R A;  4Q6F A;  3DPL R;  3I2D A;  1MM2 A;  2ECT A;  5D1L B;  4BBQ A;  3ZNI A;  2IQJ A;  3GV4 A;  5G05 B;  2AN6 A;  5DKA A;  2ECG A;  2JMI A;  5G04 B;  1WEO A;  2MUM A;  2CRW A;  2NAA A;  5J3X A;  2KKX A;  4QQ4 A;  3GL6 A;  4GND A;  1WEP A;  2EOD A;  2B0O E;  3L11 A;  3FAO A;  2UZG A;  3M63 A;  2H0D B;  5FEY A;  2Y43 A;  4NN2 A;  4YAX A;  2CSV A;  3T9K A;  1VD4 A;  2MA6 A;  4V3K C;  3ZPV E;  4BHW A;  1WEN A;  4R7E A;  3DWD A;  3O70 A;  4I7B A;  5H1U A;  2FUU A;  2QIC A;  2F6J A;  3N9Q A;  3PUR A;  5I3L A;  5TDR A;  3EB5 A;  5JG6 A;  2P57 A;  2VPG A;  2MNZ A;  5KH3 A;  2LV9 A;  3LVQ E;  3SOW A;  3ZVZ B;  3FAN A;  3SHB A;  4O64 A;  2K16 A;  4YC9 A;  3ZPV 1;  3RTR B;  2QIZ A;  5H1V A;  5B77 A;  2MKE A;  2L75 A;  2QJ0 A;  3M62 A;  4YBS A;  2LAU A;  2VNF A;  2KR4 A;  2YW8 A;  2YT5 A;  2E6R A;  3C6W A;  2DJA A;  2D8S A;  2DSM A;  1WEM A;  2F42 A;  5C11 A;  2CKL A;  1V87 A;  5TDW A;  5B76 A;  1K2F A;  2JRJ A;  2L43 A;  4O62 A;  5FB1 A;  4IC3 A;  3ASL A;  3JUE A;  2KRE A;  2JMD A;  4A4B A;  4R8P K;  1T1H A;  4OGC A;  4V3L C;  1WES A;  1WFK A;  2MD7 B;  3MHH A;  1BOR A;  3O34 A;  2LRI C;  4YBT A;  4B86 C;  1JOC A;  1JM7 A;  5LKX A;  2LXH C;  3HCU A;  2YQM A;  1LDK C; 
#chains in the Genus database with same CATH homology
 3N9L A;  2KU3 A;  3O7A A;  3O33 A;  4AYC A;  4XI1 A;  4WZ2 A;  2KE1 A;  2CT2 A;  1E4U A;  2G6Q A;  2YHN A;  2LGK A;  4GNE A;  4UP0 A;  2H0D A;  2Y1N A;  4A49 A;  4ZDT A;  5TBN A;  2FSA A;  2F6N A;  3PUQ A;  5LKZ A;  2K4D A;  2HYE D;  5FER A;  2YSM A;  4P5O B;  3U5N A;  1FP0 A;  2ECV A;  2G45 A;  2MD8 C;  2RI7 A;  4WA6 A;  1Z2Q A;  1Z6U A;  3LQJ A;  4F52 B;  2VJE A;  1WIL A;  2M85 A;  3DQV R;  3KV5 A;  3HCT A;  4LKA A;  5G0F A;  3IHP A;  3N9O A;  4I7C A;  1X4U A;  1ZBD B;  2K1J A;  5D1M B;  2Y1M A;  1XWH A;  2VP7 A;  1N87 A;  2G43 A;  4CCG X;  4FJC A;  3LQI A;  3N9N A;  5H9M A;  3VK6 A;  2EGP A;  1G25 A;  4YAB A;  3EB6 A;  1JM7 B;  5AIT A;  5LCW B;  1RMD A;  2YHO A;  1X4I A;  2LGL A;  4W4U A;  1X4J A;  2I50 A;  2VJF A;  1WEU A;  1F62 A;  1WEW A;  4S3O B;  2YU4 A;  2MIQ A;  1IYM A;  2XEU A;  5KH7 A;  3NG2 A;  3T7L A;  3U5O A;  2KGG A;  4AP4 A;  2LGG A;  2K17 A;  3HCS A;  1WIM A;  3L1Z B;  4GB0 A;  2LN0 A;  3KQI A;  1HYI A;  4ZUX U;  1DVP A;  3RPG B;  5KH9 A;  2VPD A;  2ECW A;  5D1K B;  2LQ6 A;  4WZ3 B;  2FUI A;  2VPE A;  4YAT A;  3ZVY A;  4FIP A;  4L58 A;  1WE9 A;  2HDP A;  2JMJ A;  4QF3 A;  2E6S A;  2KYU A;  5B75 A;  5H1T A;  2LGV A;  3MHS A;  2VJF B;  1HYJ A;  3O37 A;  3N9P A;  3LRQ A;  3ZYQ A;  2YUR A;  1VYX A;  5TAB A;  4GNF A;  1WEV A;  3O36 A;  2M3H A;  4CA1 A;  3V43 A;  2BAY A;  2ECJ A;  5FB0 A;  4I7D A;  4PPE A;  4FO9 A;  3RPG C;  4X3G A;  2ECN A;  2DX8 A;  2MA5 A;  1WGM A;  1LDJ B;  4WZ0 A;  3ZTG A;  2KWK A;  1U6G B;  5DIN A;  2M1R A;  5B8D A;  2CSZ A;  2KIZ A;  4LAD B;  3FL2 A;  2L0B A;  1CHC A;  4ZQL A;  3U5M A;  3QZV A;  3SOX A;  2VJE B;  1FBV A;  3U5P A;  3LQH A;  3L1X A;  5B79 A;  4TKP B;  4LLB A;  2XB1 A;  2KWN A;  2CKL B;  2L5U A;  3KNV A;  2KWJ A;  1VFY A;  5C13 A;  4MVT A;  5B78 A;  1MM3 A;  2EA6 A;  4MSX A;  4N3W A;  4B7Y C;  4LJN A;  2YSJ A;  4YBM A;  4R2Y A;  2RSD A;  2ZET C;  3N9M A;  4A4C A;  2L80 A;  2ECI A;  2OXQ C;  2MT5 A;  4S3O C;  2C2L A;  4YAD A;  4QF2 A;  4UP5 A;  2VPB A;  4LK9 A;  4AVX A;  2PUY A;  4N4F A;  2YYR A;  2PNX A;  5AIU A;  4AYC B;  5EYA F;  4AUQ B;  2KFT A;  2M6M A;  5LKU A;  3HTK C;  2CSY A;  3C5K A;  5LKT A;  3SOU A;  2YQL A;  2MNY A;  4PTB A;  2YRE A;  2C2V S;  5TRB A;  3M99 A;  2YUC A;  1WEE A;  2KWO A;  4GNG A;  2LDR A;  2LXP C;  2KGI A;  3O35 A;  3PHD A;  4UI9 B;  4IC2 A;  3KV6 A;  1Z60 A;  4FK5 A;  4L7X A;  2IDA A;  4A0C D;  1WEQ A;  4C9Z A;  3T6R A;  4Q6F A;  3DPL R;  3I2D A;  1MM2 A;  2ECT A;  5D1L B;  4BBQ A;  3ZNI A;  3GV4 A;  5G05 B;  2AN6 A;  5DKA A;  2ECG A;  2JMI A;  5G04 B;  1WEO A;  2MUM A;  2NAA A;  5J3X A;  3GL6 A;  4GND A;  1WEP A;  2EOD A;  3L11 A;  2UZG A;  3M63 A;  2H0D B;  5FEY A;  2Y43 A;  4NN2 A;  4YAX A;  1VD4 A;  2MA6 A;  4V3K C;  3ZPV E;  4BHW A;  1WEN A;  4R7E A;  3O70 A;  4I7B A;  5H1U A;  2FUU A;  2QIC A;  2F6J A;  3N9Q A;  3PUR A;  5I3L A;  5TDR A;  3EB5 A;  5JG6 A;  2VPG A;  2MNZ A;  5KH3 A;  2LV9 A;  3SOW A;  3ZVZ B;  3SHB A;  4O64 A;  2K16 A;  4YC9 A;  3ZPV 1;  3RTR B;  2QIZ A;  5H1V A;  5B77 A;  2L75 A;  2QJ0 A;  3M62 A;  4YBS A;  2VNF A;  2KR4 A;  2YW8 A;  2YT5 A;  2E6R A;  3C6W A;  2D8S A;  1WEM A;  2F42 A;  5C11 A;  2CKL A;  1V87 A;  5TDW A;  5B76 A;  1K2F A;  2JRJ A;  2L43 A;  5FB1 A;  4IC3 A;  3ASL A;  2KRE A;  2JMD A;  4A4B A;  4R8P K;  1T1H A;  4V3L C;  1WES A;  1WFK A;  2MD7 B;  3MHH A;  1BOR A;  3O34 A;  2LRI C;  4YBT A;  4B86 C;  1JOC A;  1JM7 A;  5LKX A;  2LXH C;  3HCU A;  2YQM A;  1LDK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...