4WZ0A

Crystal structure of u-box 1 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
109
structure length
108
Chain Sequence
b'IDHKSKYLREAALEANLSHPETTPTMLTPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKDLQPFPELLIIVNRFVETQTNYEKLKNRLVQNARVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase LubX
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Ligase
total genus 36
structure length 108
sequence length 109
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz0A00
1K2FA 3RPGC 2CT2A 3O36A 4CCGX 3PURA 4I7CA 3M62A 3DPLR 4IC2A 1CHCA 2L80A 2QICA 4GNFA 4YATA 4IC3A 4WZ2A 2KR4A 2F6NA 2L0BA 2H0DB 2VPGA 2KYUA 4LADB 1WENA 2ECNA 2VJEB 1E4UA 1Z60A 2ECIA 2I50A 4QF3A 4AYCA 2IDAA 2VPDA 2JMIA 3HCSA 4YBSA 4B7YC 3ZNIA 5JG6A 2MUMA 5B77A 2EODA 5G04B 4YAXA 1WEUA 4UI9B 2YSMA 3I2DA 2RSDA 5D1KB 2M1RA 2KWKA 3LQJA 2JMDA 3O37A 2QIZA 4GNEA 1JOCA 4YBTA 5C13A 4UP0A 3SOWA 1LDJB 4V3LC 4X3GA 2KWJA 1WEWA 3O7AA 2M3HA 3LQHA 4FIPA 1X4UA 4I7DA 2PNXA 5DKAA 4LK9A 5FERA 2NAAA 3U5OA 4YADA 3ZYQA 3KQIA 3N9LA 2LV9A 1DVPA 3N9OA 5H1UA 3ASLA 2M85A 4PTBA 2Y1NA 4GNGA 4R2YA 2ZETC 4R7EA 2KWNA 2KFTA 2LRIC 3ZPVE 4GB0A 3KV5A 4FJCA 1N87A 3C6WA 2EGPA 1X4IA 1Z2QA 2UZGA 5C11A 4LKAA 1MM3A 5LKZA 4R8PK 5H1VA 2YHOA 3SOXA 1X4JA 4L58A 5EYAF 2YHNA 2LXPC 2E6RA 1G25A 2VPBA 3HTKC 1WGMA 4BBQA 4LLBA 4FK5A 1Z6UA 2ECJA 2KGGA 4C9ZA 3GL6A 4AP4A 1FP0A 2KREA 5B8DA 4YBMA 1VFYA 4A0CD 5B79A 1U6GB 3U5PA 2FUUA 4A4CA 5TDWA 2LXHC 4UP5A 3N9NA 2ECWA 1HYJA 2RI7A 5TBNA 5KH3A 4WA6A 4S3OB 3SOUA 4PPEA 2L75A 1WEEA 2YU4A 2YUCA 3N9MA 5I3LA 5LKUA 2BAYA 5H9MA 3GV4A 2M6MA 2YT5A 4NN2A 3N9QA 5G05B 2KIZA 2D8SA 2LGKA 3O33A 5KH7A 1MM2A 5B76A 2VPEA 1WFKA 2JMJA 2VP7A 1ZBDB 1WEPA 1JM7A 3EB6A 1WILA 2VJFA 4A49A 3L11A 4CA1A 2MNYA 2FSAA 2AN6A 3T7LA 3ZTGA 3HCUA 5FB1A 5KH9A 3ZPV1 3M99A 5DINA 2LGLA 2YYRA 4QF2A 3PHDA 3KV6A 4W4UA 4GNDA 5FEYA 4B86C 2H0DA 4P5OB 1HYIA 4L7XA 4AYCB 3L1XA 4BHWA 1T1HA 1RMDA 2YURA 2KWOA 4LJNA 3RTRB 3EB5A 2Y1MA 5G0FA 2PUYA 2VJEA 1XWHA 4Q6FA 4F52B 2DX8A 1V87A 2Y43A 4FO9A 2XEUA 4N4FA 2YW8A 3ZVYA 5TDRA 3M63A 2YQLA 1JM7B 2G6QA 2OXQC 3O70A 2VJFB 2G45A 3FL2A 2XB1A 2HYED 2C2VS 5B75A 4N3WA 2MNZA 1LDKC 2K4DA 5D1MB 1WEOA 2LDRA 3RPGB 2L43A 4AVXA 4S3OC 3SHBA 5TRBA 1WIMA 3U5NA 3DQVR 2G43A 2K1JA 5AITA 4ZQLA 2MA6A 4O64A 3VK6A 1WEMA 2F42A 3LQIA 3ZVZB 2CKLA 3MHSA 2K16A 2YSJA 1WESA 4I7BA 3PUQA 2ECTA 2QJ0A 1WEQA 1F62A 4A4BA 1BORA 3V43A 4XI1A 3LRQA 2YQMA 3O35A 3U5MA 4WZ3B 4WZ0A 2VNFA 2F6JA 3QZVA 3MHHA 3KNVA 2FUIA 2KE1A 2LGVA 2MT5A 5LCWB 2EA6A 1WEVA 5H1TA 2C2LA 4MVTA 3O34A 2ECGA 2LQ6A 5TABA 2MA5A 2CSYA 5LKXA 2ECVA 3IHPA 2L5UA 2MD8C 1VYXA 5FB0A 3N9PA 4YABA 5AIUA 2LN0A 1WE9A 2YREA 2LGGA 4V3KC 4ZUXU 2CKLB 3T6RA 4TKPB 3L1ZB 2MD7B 4YC9A 3NG2A 1VD4A 5LKTA 3C5KA 4AUQB 2KU3A 2E6SA 4ZDTA 3HCTA 2KGIA 2CSZA 2HDPA 4MSXA 2JRJA 1IYMA 2MIQA 5D1LB 5J3XA 2K17A 1FBVA 5B78A
chains in the Genus database with same CATH superfamily
1K2FA 3RPGC 3LVRE 2CT2A 2XP0A 3O36A 4CCGX 3PURA 3PLWA 4I7CA 3M62A 3DPLR 4IC2A 1CHCA 3MDBC 2L80A 2QICA 4GNFA 2DJAA 4YATA 4IC3A 4WZ2A 2KR4A 2F6NA 2L0BA 2H0DB 2VPGA 2KYUA 4LADB 1WENA 1DCQA 2ECNA 2VJEB 2KKXA 1E4UA 1Z60A 2E61A 4H9DA 2ECIA 2I50A 4QF3A 4AYCA 2IDAA 2VPDA 2RR4A 2JMIA 3HCSA 2XOYA 4YBSA 4B7YC 3LJUX 3ZNIA 5JG6A 2MUMA 5B77A 2EODA 5G04B 4YAXA 2EXUA 1WEUA 4UI9B 2YSMA 3I2DA 2RSDA 5D1KB 2M1RA 2KWKA 3LQJA 2JMDA 3O37A 2QIZA 4GNEA 3FAOA 1JOCA 4YBTA 2EGMA 5C13A 4UP0A 3SOWA 1LDJB 4V3LC 4X3GA 3H7HA 2KWJA 1WEWA 3O7AA 2M3HA 3LQHA 4FIPA 1X4UA 4I7DA 2PNXA 5DKAA 4LK9A 5FERA 2NAAA 3U5OA 4YADA 3ZYQA 3LDYA 3KQIA 3N9LA 2LV9A 1DVPA 3N9OA 5H1UA 2CONA 3ASLA 2M85A 4PTBA 2Y1NA 4GNGA 4R2YA 2ZETC 4R7EA 2KWNA 2KFTA 2LRIC 3ZPVE 4GB0A 4O62A 2YVRA 3KV5A 4FJCA 2IQJA 1N87A 3C6WA 2JUNA 2EGPA 1X4IA 1Z2QA 2UZGA 3E2DA 5C11A 4LKAA 1MM3A 5LKZA 4R8PK 5H1VA 2YHOA 2JM3A 3SOXA 2KKYA 3Q1DA 1X4JA 4L58A 5EYAF 2YHNA 2LXPC 2E6RA 4OGCA 1G25A 2VPBA 3HTKC 1WGMA 3M7KA 4BBQA 4LLBA 4FK5A 1Z6UA 2ECJA 2KGGA 4C9ZA 3GL6A 4AP4A 1FP0A 2KREA 5B8DA 4YBMA 1VFYA 4A0CD 5B79A 1U6GB 3U5PA 2FUUA 3SUBA 5TDWA 4A4CA 2LXHC 4UP5A 3FJUB 3N9NA 4Z0OA 2ECWA 1HYJA 2RI7A 5TBNA 5KH3A 4WA6A 4S3OB 3SOUA 4PPEA 2L75A 1WEEA 2YU4A 2YUCA 3N9MA 5I3LA 5LKUA 2BAYA 5H9MA 3GV4A 2M6MA 2YT5A 4NN2A 3DWDA 3N9QA 5G05B 2CSVA 2KIZA 2D8SA 2LGKA 3O33A 5KH7A 2FD4A 1MM2A 5B76A 2VPEA 2P57A 1WFKA 2JMJA 2VP7A 1ZBDB 2CRRA 1WEPA 1JM7A 2FFWA 2LAUA 3EB6A 1WILA 2VJFA 4A49A 3L11A 3KDEC 4CA1A 2MNYA 2FSAA 2AN6A 3T7LA 3ZTGA 3HCUA 5FB1A 5KH9A 3ZPV1 5SVIA 3M99A 5DINA 2XOCA 2LGLA 3FEHA 4F1PA 2YYRA 4QF2A 2OWAA 3PHDA 4Z0RA 3KV6A 4W4UA 4GNDA 5FEYA 4B86C 2D8UA 2H0DA 4P5OB 2DSMA 1HYIA 3LVQE 4L7XA 4AYCB 3L1XA 4BHWA 1T1HA 1RMDA 2YURA 2KWOA 4LJNA 3RTRB 3EB5A 2Y1MA 4OGEA 5G0FA 3DDTA 5SVYA 2PUYA 2VJEA 1XWHA 4Q6FA 4F52B 2DX8A 5K3QA 1V87A 2Y43A 4FO9A 2XEUA 4N4FA 2YW8A 3ZVYA 5TDRA 3M63A 2YQLA 1JM7B 2G6QA 2OXQC 3O70A 2VJFB 2G45A 3FL2A 2XB1A 3O47A 5SVXA 2HYED 2C2VS 3FANA 5B75A 4N3WA 2MNZA 1LDKC 2K4DA 5D1MB 1WEOA 2LDRA 3RPGB 2L43A 4AVXA 4S3OC 3SHBA 5SVIB 5TRBA 1WIMA 3U5NA 3DQVR 2G43A 2K1JA 5AITA 4ZQLA 2MA6A 2CRWA 4O64A 3VK6A 4QQ4A 1WEMA 2F42A 3LQIA 3ZVZB 2CKLA 3MHSA 2K16A 2YSJA 1WESA 4I7BA 3PUQA 2ECTA 2B0OE 2QJ0A 1WEQA 1F62A 4A4BA 1BORA 3V43A 4XI1A 2MKEA 3LRQA 2YQMA 3O35A 3U5MA 4WZ3B 3FM8C 4WZ0A 2VNFA 2F6JA 3QZVA 3MHHA 3KNVA 2FUIA 2KE1A 2LGVA 3JUEA 2MT5A 5LCWB 2EA6A 2XOZA 1WEVA 5H1TA 2C2LA 4MVTA 3O34A 2ECGA 2LQ6A 5TABA 2MA5A 2CSYA 1MBMA 5LKXA 2ECVA 3IHPA 2L5UA 2MD8C 1VYXA 5FB0A 3N9PA 4YABA 5AIUA 2LN0A 1WE9A 2YREA 2LGGA 4V3KC 4ZUXU 2CKLB 3T6RA 4TKPB 3L1ZB 2MD7B 4YC9A 3NG2A 1VD4A 5LKTA 3C5KA 4AUQB 2KU3A 2E6SA 4ZDTA 3HCTA 2KGIA 2CSZA 2HDPA 4MSXA 2JRJA 1IYMA 2L7PA 2MIQA 5D1LB 5J3XA 2K17A 1FBVA 5B78A 2M13A 3T9KA
chains in the Genus database with same CATH topology
1K2FA 3RPGC 2CT2A 3O36A 4CCGX 3PURA 4I7CA 3M62A 3DPLR 4IC2A 1CHCA 2L80A 2QICA 4GNFA 4YATA 4IC3A 4WZ2A 2KR4A 2F6NA 2L0BA 2H0DB 2VPGA 2KYUA 4LADB 1WENA 2ECNA 2VJEB 1E4UA 1Z60A 2ECIA 2I50A 4QF3A 4AYCA 2IDAA 2VPDA 2JMIA 3HCSA 4YBSA 4B7YC 3ZNIA 5JG6A 2MUMA 5B77A 2EODA 5G04B 4YAXA 1WEUA 4UI9B 2YSMA 3I2DA 2RSDA 5D1KB 2M1RA 2KWKA 3LQJA 2JMDA 3O37A 2QIZA 4GNEA 1JOCA 4YBTA 5C13A 4UP0A 3SOWA 1LDJB 4V3LC 4X3GA 2KWJA 1WEWA 3O7AA 2M3HA 3LQHA 4FIPA 1X4UA 4I7DA 2PNXA 5DKAA 4LK9A 5FERA 2NAAA 3U5OA 4YADA 3ZYQA 3KQIA 3N9LA 2LV9A 1DVPA 3N9OA 5H1UA 3ASLA 2M85A 4PTBA 2Y1NA 4GNGA 4R2YA 2ZETC 4R7EA 2KWNA 2KFTA 2LRIC 3ZPVE 4GB0A 3KV5A 4FJCA 1N87A 3C6WA 2EGPA 1X4IA 1Z2QA 2UZGA 5C11A 4LKAA 1MM3A 5LKZA 4R8PK 5H1VA 2YHOA 3SOXA 1X4JA 4L58A 5EYAF 2YHNA 2LXPC 2E6RA 1G25A 2VPBA 3HTKC 1WGMA 4BBQA 4LLBA 4FK5A 1Z6UA 2ECJA 2KGGA 4C9ZA 3GL6A 4AP4A 1FP0A 2KREA 5B8DA 4YBMA 1VFYA 4A0CD 5B79A 1U6GB 3U5PA 2FUUA 4A4CA 5TDWA 2LXHC 4UP5A 3N9NA 2ECWA 1HYJA 2RI7A 5TBNA 5KH3A 4WA6A 4S3OB 3SOUA 4PPEA 2L75A 1WEEA 2YU4A 2YUCA 3N9MA 5I3LA 5LKUA 2BAYA 5H9MA 3GV4A 2M6MA 2YT5A 4NN2A 3N9QA 5G05B 2KIZA 2D8SA 2LGKA 3O33A 5KH7A 1MM2A 5B76A 2VPEA 1WFKA 2JMJA 2VP7A 1ZBDB 1WEPA 1JM7A 3EB6A 1WILA 2VJFA 4A49A 3L11A 4CA1A 2MNYA 2FSAA 2AN6A 3T7LA 3ZTGA 3HCUA 5FB1A 5KH9A 3ZPV1 3M99A 5DINA 2LGLA 2YYRA 4QF2A 3PHDA 3KV6A 4W4UA 4GNDA 5FEYA 4B86C 2H0DA 4P5OB 1HYIA 4L7XA 4AYCB 3L1XA 4BHWA 1T1HA 1RMDA 2YURA 2KWOA 4LJNA 3RTRB 3EB5A 2Y1MA 5G0FA 2PUYA 2VJEA 1XWHA 4Q6FA 4F52B 2DX8A 1V87A 2Y43A 4FO9A 2XEUA 4N4FA 2YW8A 3ZVYA 5TDRA 3M63A 2YQLA 1JM7B 2G6QA 2OXQC 3O70A 2VJFB 2G45A 3FL2A 2XB1A 2HYED 2C2VS 5B75A 4N3WA 2MNZA 1LDKC 2K4DA 5D1MB 1WEOA 2LDRA 3RPGB 2L43A 4AVXA 4S3OC 3SHBA 5TRBA 1WIMA 3U5NA 3DQVR 2G43A 2K1JA 5AITA 4ZQLA 2MA6A 4O64A 3VK6A 1WEMA 2F42A 3LQIA 3ZVZB 2CKLA 3MHSA 2K16A 2YSJA 1WESA 4I7BA 3PUQA 2ECTA 2QJ0A 1WEQA 1F62A 4A4BA 1BORA 3V43A 4XI1A 3LRQA 2YQMA 3O35A 3U5MA 4WZ3B 4WZ0A 2VNFA 2F6JA 3QZVA 3MHHA 3KNVA 2FUIA 2KE1A 2LGVA 2MT5A 5LCWB 2EA6A 1WEVA 5H1TA 2C2LA 4MVTA 3O34A 2ECGA 2LQ6A 5TABA 2MA5A 2CSYA 5LKXA 2ECVA 3IHPA 2L5UA 2MD8C 1VYXA 5FB0A 3N9PA 4YABA 5AIUA 2LN0A 1WE9A 2YREA 2LGGA 4V3KC 4ZUXU 2CKLB 3T6RA 4TKPB 3L1ZB 2MD7B 4YC9A 3NG2A 1VD4A 5LKTA 3C5KA 4AUQB 2KU3A 2E6SA 4ZDTA 3HCTA 2KGIA 2CSZA 2HDPA 4MSXA 2JRJA 1IYMA 2MIQA 5D1LB 5J3XA 2K17A 1FBVA 5B78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K2F A;  3RPG C;  2CT2 A;  3O36 A;  4CCG X;  3PUR A;  4I7C A;  3M62 A;  3DPL R;  4IC2 A;  1CHC A;  2L80 A;  2QIC A;  4GNF A;  4YAT A;  4IC3 A;  4WZ2 A;  2KR4 A;  2F6N A;  2L0B A;  2H0D B;  2VPG A;  2KYU A;  4LAD B;  1WEN A;  2ECN A;  2VJE B;  1E4U A;  1Z60 A;  2ECI A;  2I50 A;  4QF3 A;  4AYC A;  2IDA A;  2VPD A;  2JMI A;  3HCS A;  4YBS A;  4B7Y C;  3ZNI A;  5JG6 A;  2MUM A;  5B77 A;  2EOD A;  5G04 B;  4YAX A;  1WEU A;  4UI9 B;  2YSM A;  3I2D A;  2RSD A;  5D1K B;  2M1R A;  2KWK A;  3LQJ A;  2JMD A;  3O37 A;  2QIZ A;  4GNE A;  1JOC A;  4YBT A;  5C13 A;  4UP0 A;  3SOW A;  1LDJ B;  4V3L C;  4X3G A;  2KWJ A;  1WEW A;  3O7A A;  2M3H A;  3LQH A;  4FIP A;  1X4U A;  4I7D A;  2PNX A;  5DKA A;  4LK9 A;  5FER A;  2NAA A;  3U5O A;  4YAD A;  3ZYQ A;  3KQI A;  3N9L A;  2LV9 A;  1DVP A;  3N9O A;  5H1U A;  3ASL A;  2M85 A;  4PTB A;  2Y1N A;  4GNG A;  4R2Y A;  2ZET C;  4R7E A;  2KWN A;  2KFT A;  2LRI C;  3ZPV E;  4GB0 A;  3KV5 A;  4FJC A;  1N87 A;  3C6W A;  2EGP A;  1X4I A;  1Z2Q A;  2UZG A;  5C11 A;  4LKA A;  1MM3 A;  5LKZ A;  4R8P K;  5H1V A;  2YHO A;  3SOX A;  1X4J A;  4L58 A;  5EYA F;  2YHN A;  2LXP C;  2E6R A;  1G25 A;  2VPB A;  3HTK C;  1WGM A;  4BBQ A;  4LLB A;  4FK5 A;  1Z6U A;  2ECJ A;  2KGG A;  4C9Z A;  3GL6 A;  4AP4 A;  1FP0 A;  2KRE A;  5B8D A;  4YBM A;  1VFY A;  4A0C D;  5B79 A;  1U6G B;  3U5P A;  2FUU A;  4A4C A;  5TDW A;  2LXH C;  4UP5 A;  3N9N A;  2ECW A;  1HYJ A;  2RI7 A;  5TBN A;  5KH3 A;  4WA6 A;  4S3O B;  3SOU A;  4PPE A;  2L75 A;  1WEE A;  2YU4 A;  2YUC A;  3N9M A;  5I3L A;  5LKU A;  2BAY A;  5H9M A;  3GV4 A;  2M6M A;  2YT5 A;  4NN2 A;  3N9Q A;  5G05 B;  2KIZ A;  2D8S A;  2LGK A;  3O33 A;  5KH7 A;  1MM2 A;  5B76 A;  2VPE A;  1WFK A;  2JMJ A;  2VP7 A;  1ZBD B;  1WEP A;  1JM7 A;  3EB6 A;  1WIL A;  2VJF A;  4A49 A;  3L11 A;  4CA1 A;  2MNY A;  2FSA A;  2AN6 A;  3T7L A;  3ZTG A;  3HCU A;  5FB1 A;  5KH9 A;  3ZPV 1;  3M99 A;  5DIN A;  2LGL A;  2YYR A;  4QF2 A;  3PHD A;  3KV6 A;  4W4U A;  4GND A;  5FEY A;  4B86 C;  2H0D A;  4P5O B;  1HYI A;  4L7X A;  4AYC B;  3L1X A;  4BHW A;  1T1H A;  1RMD A;  2YUR A;  2KWO A;  4LJN A;  3RTR B;  3EB5 A;  2Y1M A;  5G0F A;  2PUY A;  2VJE A;  1XWH A;  4Q6F A;  4F52 B;  2DX8 A;  1V87 A;  2Y43 A;  4FO9 A;  2XEU A;  4N4F A;  2YW8 A;  3ZVY A;  5TDR A;  3M63 A;  2YQL A;  1JM7 B;  2G6Q A;  2OXQ C;  3O70 A;  2VJF B;  2G45 A;  3FL2 A;  2XB1 A;  2HYE D;  2C2V S;  5B75 A;  4N3W A;  2MNZ A;  1LDK C;  2K4D A;  5D1M B;  1WEO A;  2LDR A;  3RPG B;  2L43 A;  4AVX A;  4S3O C;  3SHB A;  5TRB A;  1WIM A;  3U5N A;  3DQV R;  2G43 A;  2K1J A;  5AIT A;  4ZQL A;  2MA6 A;  4O64 A;  3VK6 A;  1WEM A;  2F42 A;  3LQI A;  3ZVZ B;  2CKL A;  3MHS A;  2K16 A;  2YSJ A;  1WES A;  4I7B A;  3PUQ A;  2ECT A;  2QJ0 A;  1WEQ A;  1F62 A;  4A4B A;  1BOR A;  3V43 A;  4XI1 A;  3LRQ A;  2YQM A;  3O35 A;  3U5M A;  4WZ3 B;  4WZ0 A;  2VNF A;  2F6J A;  3QZV A;  3MHH A;  3KNV A;  2FUI A;  2KE1 A;  2LGV A;  2MT5 A;  5LCW B;  2EA6 A;  1WEV A;  5H1T A;  2C2L A;  4MVT A;  3O34 A;  2ECG A;  2LQ6 A;  5TAB A;  2MA5 A;  2CSY A;  5LKX A;  2ECV A;  3IHP A;  2L5U A;  2MD8 C;  1VYX A;  5FB0 A;  3N9P A;  4YAB A;  5AIU A;  2LN0 A;  1WE9 A;  2YRE A;  2LGG A;  4V3K C;  4ZUX U;  2CKL B;  3T6R A;  4TKP B;  3L1Z B;  2MD7 B;  4YC9 A;  3NG2 A;  1VD4 A;  5LKT A;  3C5K A;  4AUQ B;  2KU3 A;  2E6S A;  4ZDT A;  3HCT A;  2KGI A;  2CSZ A;  2HDP A;  4MSX A;  2JRJ A;  1IYM A;  2MIQ A;  5D1L B;  5J3X A;  2K17 A;  1FBV A;  5B78 A; 
#chains in the Genus database with same CATH topology
 1K2F A;  3RPG C;  3LVR E;  2CT2 A;  2XP0 A;  3O36 A;  4CCG X;  3PUR A;  3PLW A;  4I7C A;  3M62 A;  3DPL R;  4IC2 A;  1CHC A;  3MDB C;  2L80 A;  2QIC A;  4GNF A;  2DJA A;  4YAT A;  4IC3 A;  4WZ2 A;  2KR4 A;  2F6N A;  2L0B A;  2H0D B;  2VPG A;  2KYU A;  4LAD B;  1WEN A;  1DCQ A;  2ECN A;  2VJE B;  2KKX A;  1E4U A;  1Z60 A;  2E61 A;  4H9D A;  2ECI A;  2I50 A;  4QF3 A;  4AYC A;  2IDA A;  2VPD A;  2RR4 A;  2JMI A;  3HCS A;  2XOY A;  4YBS A;  4B7Y C;  3LJU X;  3ZNI A;  5JG6 A;  2MUM A;  5B77 A;  2EOD A;  5G04 B;  4YAX A;  2EXU A;  1WEU A;  4UI9 B;  2YSM A;  3I2D A;  2RSD A;  5D1K B;  2M1R A;  2KWK A;  3LQJ A;  2JMD A;  3O37 A;  2QIZ A;  4GNE A;  3FAO A;  1JOC A;  4YBT A;  2EGM A;  5C13 A;  4UP0 A;  3SOW A;  1LDJ B;  4V3L C;  4X3G A;  3H7H A;  2KWJ A;  1WEW A;  3O7A A;  2M3H A;  3LQH A;  4FIP A;  1X4U A;  4I7D A;  2PNX A;  5DKA A;  4LK9 A;  5FER A;  2NAA A;  3U5O A;  4YAD A;  3ZYQ A;  3LDY A;  3KQI A;  3N9L A;  2LV9 A;  1DVP A;  3N9O A;  5H1U A;  2CON A;  3ASL A;  2M85 A;  4PTB A;  2Y1N A;  4GNG A;  4R2Y A;  2ZET C;  4R7E A;  2KWN A;  2KFT A;  2LRI C;  3ZPV E;  4GB0 A;  4O62 A;  2YVR A;  3KV5 A;  4FJC A;  2IQJ A;  1N87 A;  3C6W A;  2JUN A;  2EGP A;  1X4I A;  1Z2Q A;  2UZG A;  3E2D A;  5C11 A;  4LKA A;  1MM3 A;  5LKZ A;  4R8P K;  5H1V A;  2YHO A;  2JM3 A;  3SOX A;  2KKY A;  3Q1D A;  1X4J A;  4L58 A;  5EYA F;  2YHN A;  2LXP C;  2E6R A;  4OGC A;  1G25 A;  2VPB A;  3HTK C;  1WGM A;  3M7K A;  4BBQ A;  4LLB A;  4FK5 A;  1Z6U A;  2ECJ A;  2KGG A;  4C9Z A;  3GL6 A;  4AP4 A;  1FP0 A;  2KRE A;  5B8D A;  4YBM A;  1VFY A;  4A0C D;  5B79 A;  1U6G B;  3U5P A;  2FUU A;  3SUB A;  5TDW A;  4A4C A;  2LXH C;  4UP5 A;  3FJU B;  3N9N A;  4Z0O A;  2ECW A;  1HYJ A;  2RI7 A;  5TBN A;  5KH3 A;  4WA6 A;  4S3O B;  3SOU A;  4PPE A;  2L75 A;  1WEE A;  2YU4 A;  2YUC A;  3N9M A;  5I3L A;  5LKU A;  2BAY A;  5H9M A;  3GV4 A;  2M6M A;  2YT5 A;  4NN2 A;  3DWD A;  3N9Q A;  5G05 B;  2CSV A;  2KIZ A;  2D8S A;  2LGK A;  3O33 A;  5KH7 A;  2FD4 A;  1MM2 A;  5B76 A;  2VPE A;  2P57 A;  1WFK A;  2JMJ A;  2VP7 A;  1ZBD B;  2CRR A;  1WEP A;  1JM7 A;  2FFW A;  2LAU A;  3EB6 A;  1WIL A;  2VJF A;  4A49 A;  3L11 A;  3KDE C;  4CA1 A;  2MNY A;  2FSA A;  2AN6 A;  3T7L A;  3ZTG A;  3HCU A;  5FB1 A;  5KH9 A;  3ZPV 1;  5SVI A;  3M99 A;  5DIN A;  2XOC A;  2LGL A;  3FEH A;  4F1P A;  2YYR A;  4QF2 A;  2OWA A;  3PHD A;  4Z0R A;  3KV6 A;  4W4U A;  4GND A;  5FEY A;  4B86 C;  2D8U A;  2H0D A;  4P5O B;  2DSM A;  1HYI A;  3LVQ E;  4L7X A;  4AYC B;  3L1X A;  4BHW A;  1T1H A;  1RMD A;  2YUR A;  2KWO A;  4LJN A;  3RTR B;  3EB5 A;  2Y1M A;  4OGE A;  5G0F A;  3DDT A;  5SVY A;  2PUY A;  2VJE A;  1XWH A;  4Q6F A;  4F52 B;  2DX8 A;  5K3Q A;  1V87 A;  2Y43 A;  4FO9 A;  2XEU A;  4N4F A;  2YW8 A;  3ZVY A;  5TDR A;  3M63 A;  2YQL A;  1JM7 B;  2G6Q A;  2OXQ C;  3O70 A;  2VJF B;  2G45 A;  3FL2 A;  2XB1 A;  3O47 A;  5SVX A;  2HYE D;  2C2V S;  3FAN A;  5B75 A;  4N3W A;  2MNZ A;  1LDK C;  2K4D A;  5D1M B;  1WEO A;  2LDR A;  3RPG B;  2L43 A;  4AVX A;  4S3O C;  3SHB A;  5SVI B;  5TRB A;  1WIM A;  3U5N A;  3DQV R;  2G43 A;  2K1J A;  5AIT A;  4ZQL A;  2MA6 A;  2CRW A;  4O64 A;  3VK6 A;  4QQ4 A;  1WEM A;  2F42 A;  3LQI A;  3ZVZ B;  2CKL A;  3MHS A;  2K16 A;  2YSJ A;  1WES A;  4I7B A;  3PUQ A;  2ECT A;  2B0O E;  2QJ0 A;  1WEQ A;  1F62 A;  4A4B A;  1BOR A;  3V43 A;  4XI1 A;  2MKE A;  3LRQ A;  2YQM A;  3O35 A;  3U5M A;  4WZ3 B;  3FM8 C;  4WZ0 A;  2VNF A;  2F6J A;  3QZV A;  3MHH A;  3KNV A;  2FUI A;  2KE1 A;  2LGV A;  3JUE A;  2MT5 A;  5LCW B;  2EA6 A;  2XOZ A;  1WEV A;  5H1T A;  2C2L A;  4MVT A;  3O34 A;  2ECG A;  2LQ6 A;  5TAB A;  2MA5 A;  2CSY A;  1MBM A;  5LKX A;  2ECV A;  3IHP A;  2L5U A;  2MD8 C;  1VYX A;  5FB0 A;  3N9P A;  4YAB A;  5AIU A;  2LN0 A;  1WE9 A;  2YRE A;  2LGG A;  4V3K C;  4ZUX U;  2CKL B;  3T6R A;  4TKP B;  3L1Z B;  2MD7 B;  4YC9 A;  3NG2 A;  1VD4 A;  5LKT A;  3C5K A;  4AUQ B;  2KU3 A;  2E6S A;  4ZDT A;  3HCT A;  2KGI A;  2CSZ A;  2HDP A;  4MSX A;  2JRJ A;  1IYM A;  2L7P A;  2MIQ A;  5D1L B;  5J3X A;  2K17 A;  1FBV A;  5B78 A;  2M13 A;  3T9K A; 
#chains in the Genus database with same CATH homology
 1K2F A;  3RPG C;  2CT2 A;  3O36 A;  4CCG X;  3PUR A;  4I7C A;  3M62 A;  3DPL R;  4IC2 A;  1CHC A;  2L80 A;  2QIC A;  4GNF A;  4YAT A;  4IC3 A;  4WZ2 A;  2KR4 A;  2F6N A;  2L0B A;  2H0D B;  2VPG A;  2KYU A;  4LAD B;  1WEN A;  2ECN A;  2VJE B;  1E4U A;  1Z60 A;  2ECI A;  2I50 A;  4QF3 A;  4AYC A;  2IDA A;  2VPD A;  2JMI A;  3HCS A;  4YBS A;  4B7Y C;  3ZNI A;  5JG6 A;  2MUM A;  5B77 A;  2EOD A;  5G04 B;  4YAX A;  1WEU A;  4UI9 B;  2YSM A;  3I2D A;  2RSD A;  5D1K B;  2M1R A;  2KWK A;  3LQJ A;  2JMD A;  3O37 A;  2QIZ A;  4GNE A;  1JOC A;  4YBT A;  5C13 A;  4UP0 A;  3SOW A;  1LDJ B;  4V3L C;  4X3G A;  2KWJ A;  1WEW A;  3O7A A;  2M3H A;  3LQH A;  4FIP A;  1X4U A;  4I7D A;  2PNX A;  5DKA A;  4LK9 A;  5FER A;  2NAA A;  3U5O A;  4YAD A;  3ZYQ A;  3KQI A;  3N9L A;  2LV9 A;  1DVP A;  3N9O A;  5H1U A;  3ASL A;  2M85 A;  4PTB A;  2Y1N A;  4GNG A;  4R2Y A;  2ZET C;  4R7E A;  2KWN A;  2KFT A;  2LRI C;  3ZPV E;  4GB0 A;  3KV5 A;  4FJC A;  1N87 A;  3C6W A;  2EGP A;  1X4I A;  1Z2Q A;  2UZG A;  5C11 A;  4LKA A;  1MM3 A;  5LKZ A;  4R8P K;  5H1V A;  2YHO A;  3SOX A;  1X4J A;  4L58 A;  5EYA F;  2YHN A;  2LXP C;  2E6R A;  1G25 A;  2VPB A;  3HTK C;  1WGM A;  4BBQ A;  4LLB A;  4FK5 A;  1Z6U A;  2ECJ A;  2KGG A;  4C9Z A;  3GL6 A;  4AP4 A;  1FP0 A;  2KRE A;  5B8D A;  4YBM A;  1VFY A;  4A0C D;  5B79 A;  1U6G B;  3U5P A;  2FUU A;  4A4C A;  5TDW A;  2LXH C;  4UP5 A;  3N9N A;  2ECW A;  1HYJ A;  2RI7 A;  5TBN A;  5KH3 A;  4WA6 A;  4S3O B;  3SOU A;  4PPE A;  2L75 A;  1WEE A;  2YU4 A;  2YUC A;  3N9M A;  5I3L A;  5LKU A;  2BAY A;  5H9M A;  3GV4 A;  2M6M A;  2YT5 A;  4NN2 A;  3N9Q A;  5G05 B;  2KIZ A;  2D8S A;  2LGK A;  3O33 A;  5KH7 A;  1MM2 A;  5B76 A;  2VPE A;  1WFK A;  2JMJ A;  2VP7 A;  1ZBD B;  1WEP A;  1JM7 A;  3EB6 A;  1WIL A;  2VJF A;  4A49 A;  3L11 A;  4CA1 A;  2MNY A;  2FSA A;  2AN6 A;  3T7L A;  3ZTG A;  3HCU A;  5FB1 A;  5KH9 A;  3ZPV 1;  3M99 A;  5DIN A;  2LGL A;  2YYR A;  4QF2 A;  3PHD A;  3KV6 A;  4W4U A;  4GND A;  5FEY A;  4B86 C;  2H0D A;  4P5O B;  1HYI A;  4L7X A;  4AYC B;  3L1X A;  4BHW A;  1T1H A;  1RMD A;  2YUR A;  2KWO A;  4LJN A;  3RTR B;  3EB5 A;  2Y1M A;  5G0F A;  2PUY A;  2VJE A;  1XWH A;  4Q6F A;  4F52 B;  2DX8 A;  1V87 A;  2Y43 A;  4FO9 A;  2XEU A;  4N4F A;  2YW8 A;  3ZVY A;  5TDR A;  3M63 A;  2YQL A;  1JM7 B;  2G6Q A;  2OXQ C;  3O70 A;  2VJF B;  2G45 A;  3FL2 A;  2XB1 A;  2HYE D;  2C2V S;  5B75 A;  4N3W A;  2MNZ A;  1LDK C;  2K4D A;  5D1M B;  1WEO A;  2LDR A;  3RPG B;  2L43 A;  4AVX A;  4S3O C;  3SHB A;  5TRB A;  1WIM A;  3U5N A;  3DQV R;  2G43 A;  2K1J A;  5AIT A;  4ZQL A;  2MA6 A;  4O64 A;  3VK6 A;  1WEM A;  2F42 A;  3LQI A;  3ZVZ B;  2CKL A;  3MHS A;  2K16 A;  2YSJ A;  1WES A;  4I7B A;  3PUQ A;  2ECT A;  2QJ0 A;  1WEQ A;  1F62 A;  4A4B A;  1BOR A;  3V43 A;  4XI1 A;  3LRQ A;  2YQM A;  3O35 A;  3U5M A;  4WZ3 B;  4WZ0 A;  2VNF A;  2F6J A;  3QZV A;  3MHH A;  3KNV A;  2FUI A;  2KE1 A;  2LGV A;  2MT5 A;  5LCW B;  2EA6 A;  1WEV A;  5H1T A;  2C2L A;  4MVT A;  3O34 A;  2ECG A;  2LQ6 A;  5TAB A;  2MA5 A;  2CSY A;  5LKX A;  2ECV A;  3IHP A;  2L5U A;  2MD8 C;  1VYX A;  5FB0 A;  3N9P A;  4YAB A;  5AIU A;  2LN0 A;  1WE9 A;  2YRE A;  2LGG A;  4V3K C;  4ZUX U;  2CKL B;  3T6R A;  4TKP B;  3L1Z B;  2MD7 B;  4YC9 A;  3NG2 A;  1VD4 A;  5LKT A;  3C5K A;  4AUQ B;  2KU3 A;  2E6S A;  4ZDT A;  3HCT A;  2KGI A;  2CSZ A;  2HDP A;  4MSX A;  2JRJ A;  1IYM A;  2MIQ A;  5D1L B;  5J3X A;  2K17 A;  1FBV A;  5B78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...