4WZ0A

Crystal structure of u-box 1 of lubx / legu2 / lpp2887 from legionella pneumophila str. paris
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
109
structure length
108
Chain Sequence
IDHKSKYLREAALEANLSHPETTPTMLTPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKDLQPFPELLIIVNRFVETQTNYEKLKNRLVQNARVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase LubX
publication title Molecular Characterization of LubX: Functional Divergence of the U-Box Fold by Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila (strain paris)
molecule tags Ligase
total genus 36
structure length 108
sequence length 109
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4wz0A00
3EB5A 5B77A 2MD7B 2C2LA 2CSZA 4TKPB 5AITA 1X4IA 4BHWA 5C13A 4L58A 2LN0A 1BORA 2YSMA 2XEUA 3O37A 4W4UA 2LV9A 3LRQA 1U6GB 5J3XA 2QJ0A 2CKLB 3SOUA 5KH7A 4AVXA 3O70A 3U5NA 2KWOA 3KQIA 3O33A 3HCUA 1V87A 2KWKA 4LJNA 5DINA 2HYED 1VFYA 1Z6UA 2YHNA 2K16A 2VJFB 4AP4A 4MSXA 3KNVA 2KWNA 2YURA 3O35A 2YUCA 4I7DA 5G04B 3KV5A 5LKUA 1WEPA 4YBSA 2OXQC 5TABA 2M6MA 3KV6A 3SHBA 4GNDA 4IC3A 2JMJA 3MHHA 3O34A 2VPDA 3O36A 4XI1A 5B75A 1WE9A 2VNFA 2D8SA 5FEYA 4GNEA 4ZUXU 2F42A 2E6SA 5LCWB 2ECJA 5D1LB 3RTRB 1JM7B 1N87A 2PNXA 2XB1A 3ZPV1 4YADA 3I2DA 1IYMA 2MA5A 2M3HA 5FERA 1WEMA 4CCGX 5DKAA 1WEOA 3U5OA 2YHOA 2H0DB 2G43A 2LDRA 5H9MA 5KH3A 2RI7A 2ECVA 3HCTA 2CT2A 5I3LA 4LK9A 2QICA 1WEVA 2QIZA 3QZVA 4WA6A 3LQIA 4S3OB 4YC9A 3PURA 5EYAF 2CKLA 2MNZA 3IHPA 4MVTA 2VP7A 2ECWA 3ZPVE 4A4CA 4FJCA 5H1UA 5D1KB 1RMDA 4I7BA 4WZ3B 4YBMA 5TRBA 1WEQA 3SOWA 2E6RA 3RPGC 2NAAA 4CA1A 5H1VA 4YATA 1F62A 3GL6A 2KYUA 5LKTA 3N9LA 2LXHC 4AYCA 5LKZA 3L11A 2AN6A 1Z2QA 3PUQA 2LGKA 1VYXA 3GV4A 3ASLA 3O7AA 2EGPA 1VD4A 3LQJA 5FB0A 2ECNA 1WIMA 2YW8A 5B76A 1HYJA 5B79A 2KU3A 1WEWA 1LDJB 5B78A 3LQHA 4PTBA 2L0BA 4LKAA 5TDWA 2KIZA 4L7XA 2L75A 3U5MA 3MHSA 2LXPC 1FBVA 1WESA 4LADB 4YAXA 4PPEA 2KREA 2K17A 2VJEA 4LLBA 1WENA 2LGGA 2Y43A 2KFTA 2VPEA 2FUIA 2K4DA 2KGIA 5KH9A 1MM3A 2YSJA 3DQVR 3M62A 3C5KA 2MNYA 3L1XA 2RSDA 1WGMA 2KE1A 1X4JA 2H0DA 1ZBDB 4WZ2A 4QF3A 5D1MB 2MD8C 4UI9B 4V3LC 1WEEA 2KGGA 4QF2A 4FK5A 2IDAA 4BBQA 2VPBA 2YREA 2YYRA 3T6RA 2ZETC 1X4UA 2JMDA 3M63A 4YBTA 3N9MA 3HTKC 3L1ZB 2L43A 2MIQA 3N9PA 3N9QA 5TDRA 1K2FA 2C2VS 2G6QA 3N9NA 2M85A 2Y1MA 2ECGA 3U5PA 5TBNA 2K1JA 4FO9A 3T7LA 2LGLA 2KR4A 3C6WA 2I50A 4GNGA 2EA6A 4A49A 3VK6A 2VJFA 3ZNIA 1G25A 4GNFA 3ZVYA 4A0CD 2YQMA 4UP0A 4IC2A 5AIUA 5B8DA 2VPGA 2CSYA 4S3OC 2DX8A 1JOCA 3HCSA 5H1TA 4F52B 3NG2A 3ZTGA 4B86C 1T1HA 2ECTA 4X3GA 4B7YC 5G0FA 2L5UA 4R7EA 4C9ZA 2YQLA 2JMIA 2UZGA 3DPLR 4AYCB 3FL2A 2LGVA 1XWHA 4V3KC 2M1RA 4ZQLA 4NN2A 1DVPA 4P5OB 1JM7A 5G05B 1FP0A 2F6JA 2JRJA 2Y1NA 3EB6A 4AUQB 4O64A 1WILA 2G45A 2L80A 4UP5A 1LDKC 1CHCA 4R2YA 2FSAA 1WEUA 2MT5A 4ZDTA 3PHDA 2F6NA 4WZ0A 2YT5A 3N9OA 2ECIA 2VJEB 4YABA 2HDPA 2EODA 3SOXA 2BAYA 2LRIC 2MA6A 3ZVZB 2KWJA 1MM2A 2FUUA 5C11A 3RPGB 4Q6FA 5FB1A 3ZYQA 4N3WA 4A4BA 1E4UA 1WFKA 5LKXA 1HYIA 4FIPA 4I7CA 3V43A 4GB0A 2LQ6A 1Z60A 2MUMA 2YU4A 3M99A 2PUYA 4R8PK 5JG6A 4N4FA
chains in the Genus database with same CATH superfamily
3EB5A 5B77A 2MD7B 2C2LA 2CSZA 4TKPB 5AITA 1X4IA 4BHWA 5C13A 4L58A 2LN0A 1BORA 2YSMA 2XEUA 3O37A 2OWAA 4W4UA 2LV9A 3LRQA 1U6GB 5J3XA 2QJ0A 2CKLB 5SVIB 3SOUA 5KH7A 4AVXA 3O70A 3U5NA 2KWOA 3KQIA 4Z0OA 3O33A 3HCUA 1V87A 2KWKA 4LJNA 5DINA 2LAUA 2HYED 1VFYA 4OGEA 1Z6UA 2YHNA 2K16A 2IQJA 2VJFB 4AP4A 4MSXA 3KNVA 2KWNA 2YURA 3FEHA 3O35A 2YUCA 4I7DA 5G04B 2JM3A 2XOYA 3KV5A 3T9KA 2XOZA 5LKUA 1WEPA 4YBSA 2OXQC 5TABA 2M13A 2M6MA 3KV6A 3SHBA 4GNDA 4IC3A 2JMJA 3MHHA 4Z0RA 3O34A 2VPDA 3O36A 4XI1A 5B75A 1WE9A 2VNFA 2D8SA 3LVRE 5FEYA 4GNEA 4ZUXU 2F42A 3Q1DA 2E6SA 5LCWB 2ECJA 5D1LB 3RTRB 1JM7B 1N87A 2PNXA 2XB1A 3ZPV1 4YADA 2DSMA 3I2DA 5SVXA 1IYMA 2MA5A 2EGMA 2M3HA 5FERA 1WEMA 4CCGX 5DKAA 1WEOA 3U5OA 2YHOA 2H0DB 3DWDA 2G43A 2LDRA 5H9MA 5KH3A 2RI7A 2ECVA 3HCTA 2CT2A 5I3LA 4LK9A 2QICA 1WEVA 2QIZA 3QZVA 4WA6A 3LQIA 4S3OB 4YC9A 3PURA 5EYAF 2CKLA 2MNZA 5SVIA 2XP0A 3IHPA 4MVTA 2VP7A 2ECWA 3ZPVE 4A4CA 4FJCA 5H1UA 5D1KB 1RMDA 4I7BA 4WZ3B 4YBMA 5TRBA 1WEQA 3SOWA 2E6RA 3RPGC 2NAAA 4CA1A 5H1VA 4YATA 1F62A 3GL6A 2KYUA 4QQ4A 3N9LA 5LKTA 2LXHC 4AYCA 5LKZA 3L11A 2AN6A 2XOCA 1Z2QA 3PUQA 2LGKA 1VYXA 3GV4A 3ASLA 3O7AA 2EGPA 1VD4A 3LQJA 5FB0A 2ECNA 1WIMA 2YW8A 1MBMA 5B76A 1HYJA 5B79A 2E61A 2KU3A 1WEWA 1LDJB 5B78A 2B0OE 3LQHA 3FJUB 4PTBA 3M7KA 2L0BA 4LKAA 5TDWA 3LDYA 2KIZA 4L7XA 2L75A 3U5MA 3MDBC 3MHSA 2LXPC 1FBVA 1WESA 4LADB 4YAXA 4PPEA 2KREA 2K17A 2VJEA 4LLBA 1WENA 2LGGA 2Y43A 2KFTA 2VPEA 2D8UA 2FUIA 2K4DA 2KGIA 5KH9A 1MM3A 2CONA 2YSJA 3DQVR 3M62A 3SUBA 2KKYA 3C5KA 2MNYA 4F1PA 3L1XA 2MKEA 4OGCA 2RSDA 1WGMA 2DJAA 2KE1A 3DDTA 1X4JA 2H0DA 1ZBDB 4WZ2A 4QF3A 5D1MB 2MD8C 4UI9B 4V3LC 1WEEA 2KGGA 4QF2A 4FK5A 2IDAA 4BBQA 2VPBA 2YREA 4O62A 2YYRA 3T6RA 2ZETC 1X4UA 2JMDA 2JUNA 3E2DA 3M63A 2RR4A 3LVQE 4YBTA 3O47A 3N9MA 3HTKC 3L1ZB 2L43A 2MIQA 3N9PA 3N9QA 5TDRA 1K2FA 2C2VS 3FM8C 2G6QA 3N9NA 2M85A 2Y1MA 2ECGA 3U5PA 5TBNA 2K1JA 4FO9A 3T7LA 2LGLA 2KR4A 3C6WA 2I50A 5SVYA 2CRWA 4GNGA 2EA6A 4A49A 3VK6A 2VJFA 3ZNIA 1G25A 4GNFA 3ZVYA 4A0CD 2FFWA 2YQMA 4UP0A 4IC2A 5AIUA 5K3QA 5B8DA 2YVRA 2KKXA 3KDEC 2EXUA 2VPGA 2CSYA 4S3OC 2DX8A 1JOCA 3HCSA 5H1TA 4F52B 3NG2A 3ZTGA 4H9DA 3FANA 4B86C 1T1HA 2ECTA 4X3GA 4B7YC 5G0FA 2L5UA 4R7EA 4C9ZA 2YQLA 2JMIA 2UZGA 3DPLR 4AYCB 3FL2A 2LGVA 1XWHA 4V3KC 2M1RA 4ZQLA 4NN2A 1DVPA 4P5OB 1JM7A 5G05B 1FP0A 2FD4A 3LJUX 2F6JA 2JRJA 2Y1NA 3EB6A 2CRRA 4AUQB 4O64A 1WILA 2G45A 1DCQA 2L80A 4UP5A 1LDKC 1CHCA 4R2YA 2FSAA 1WEUA 2MT5A 4ZDTA 3PHDA 2F6NA 4WZ0A 2YT5A 3N9OA 2ECIA 2VJEB 4YABA 2L7PA 2HDPA 2EODA 3SOXA 2BAYA 2LRIC 2MA6A 3ZVZB 2KWJA 1MM2A 2FUUA 2P57A 5C11A 3RPGB 3H7HA 4Q6FA 5FB1A 3ZYQA 4N3WA 4A4BA 1E4UA 1WFKA 5LKXA 1HYIA 2CSVA 3PLWA 3JUEA 4FIPA 4I7CA 3V43A 4GB0A 2LQ6A 1Z60A 2MUMA 2YU4A 3M99A 3FAOA 2PUYA 4R8PK 5JG6A 4N4FA
chains in the Genus database with same CATH topology
3EB5A 5B77A 2MD7B 2C2LA 2CSZA 4TKPB 5AITA 1X4IA 4BHWA 5C13A 4L58A 2LN0A 1BORA 2YSMA 2XEUA 3O37A 4W4UA 2LV9A 3LRQA 1U6GB 5J3XA 2QJ0A 2CKLB 3SOUA 5KH7A 4AVXA 3O70A 3U5NA 2KWOA 3KQIA 3O33A 3HCUA 1V87A 2KWKA 4LJNA 5DINA 2HYED 1VFYA 1Z6UA 2YHNA 2K16A 2VJFB 4AP4A 4MSXA 3KNVA 2KWNA 2YURA 3O35A 2YUCA 4I7DA 5G04B 3KV5A 5LKUA 1WEPA 4YBSA 2OXQC 5TABA 2M6MA 3KV6A 3SHBA 4GNDA 4IC3A 2JMJA 3MHHA 3O34A 2VPDA 3O36A 4XI1A 5B75A 1WE9A 2VNFA 2D8SA 5FEYA 4GNEA 4ZUXU 2F42A 2E6SA 5LCWB 2ECJA 5D1LB 3RTRB 1JM7B 1N87A 2PNXA 2XB1A 3ZPV1 4YADA 3I2DA 1IYMA 2MA5A 2M3HA 5FERA 1WEMA 4CCGX 5DKAA 1WEOA 3U5OA 2YHOA 2H0DB 2G43A 2LDRA 5H9MA 5KH3A 2RI7A 2ECVA 3HCTA 2CT2A 5I3LA 4LK9A 2QICA 1WEVA 2QIZA 3QZVA 4WA6A 3LQIA 4S3OB 4YC9A 3PURA 5EYAF 2CKLA 2MNZA 3IHPA 4MVTA 2VP7A 2ECWA 3ZPVE 4A4CA 4FJCA 5H1UA 5D1KB 1RMDA 4I7BA 4WZ3B 4YBMA 5TRBA 1WEQA 3SOWA 2E6RA 3RPGC 2NAAA 4CA1A 5H1VA 4YATA 1F62A 3GL6A 2KYUA 5LKTA 3N9LA 2LXHC 4AYCA 5LKZA 3L11A 2AN6A 1Z2QA 3PUQA 2LGKA 1VYXA 3GV4A 3ASLA 3O7AA 2EGPA 1VD4A 3LQJA 5FB0A 2ECNA 1WIMA 2YW8A 5B76A 1HYJA 5B79A 2KU3A 1WEWA 1LDJB 5B78A 3LQHA 4PTBA 2L0BA 4LKAA 5TDWA 2KIZA 4L7XA 2L75A 3U5MA 3MHSA 2LXPC 1FBVA 1WESA 4LADB 4YAXA 4PPEA 2KREA 2K17A 2VJEA 4LLBA 1WENA 2LGGA 2Y43A 2KFTA 2VPEA 2FUIA 2K4DA 2KGIA 5KH9A 1MM3A 2YSJA 3DQVR 3M62A 3C5KA 2MNYA 3L1XA 2RSDA 1WGMA 2KE1A 1X4JA 2H0DA 1ZBDB 4WZ2A 4QF3A 5D1MB 2MD8C 4UI9B 4V3LC 1WEEA 2KGGA 4QF2A 4FK5A 2IDAA 4BBQA 2VPBA 2YREA 2YYRA 3T6RA 2ZETC 1X4UA 2JMDA 3M63A 4YBTA 3N9MA 3HTKC 3L1ZB 2L43A 2MIQA 3N9PA 3N9QA 5TDRA 1K2FA 2C2VS 2G6QA 3N9NA 2M85A 2Y1MA 2ECGA 3U5PA 5TBNA 2K1JA 4FO9A 3T7LA 2LGLA 2KR4A 3C6WA 2I50A 4GNGA 2EA6A 4A49A 3VK6A 2VJFA 3ZNIA 1G25A 4GNFA 3ZVYA 4A0CD 2YQMA 4UP0A 4IC2A 5AIUA 5B8DA 2VPGA 2CSYA 4S3OC 2DX8A 1JOCA 3HCSA 5H1TA 4F52B 3NG2A 3ZTGA 4B86C 1T1HA 2ECTA 4X3GA 4B7YC 5G0FA 2L5UA 4R7EA 4C9ZA 2YQLA 2JMIA 2UZGA 3DPLR 4AYCB 3FL2A 2LGVA 1XWHA 4V3KC 2M1RA 4ZQLA 4NN2A 1DVPA 4P5OB 1JM7A 5G05B 1FP0A 2F6JA 2JRJA 2Y1NA 3EB6A 4AUQB 4O64A 1WILA 2G45A 2L80A 4UP5A 1LDKC 1CHCA 4R2YA 2FSAA 1WEUA 2MT5A 4ZDTA 3PHDA 2F6NA 4WZ0A 2YT5A 3N9OA 2ECIA 2VJEB 4YABA 2HDPA 2EODA 3SOXA 2BAYA 2LRIC 2MA6A 3ZVZB 2KWJA 1MM2A 2FUUA 5C11A 3RPGB 4Q6FA 5FB1A 3ZYQA 4N3WA 4A4BA 1E4UA 1WFKA 5LKXA 1HYIA 4FIPA 4I7CA 3V43A 4GB0A 2LQ6A 1Z60A 2MUMA 2YU4A 3M99A 2PUYA 4R8PK 5JG6A 4N4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EB5 A;  5B77 A;  2MD7 B;  2C2L A;  2CSZ A;  4TKP B;  5AIT A;  1X4I A;  4BHW A;  5C13 A;  4L58 A;  2LN0 A;  1BOR A;  2YSM A;  2XEU A;  3O37 A;  4W4U A;  2LV9 A;  3LRQ A;  1U6G B;  5J3X A;  2QJ0 A;  2CKL B;  3SOU A;  5KH7 A;  4AVX A;  3O70 A;  3U5N A;  2KWO A;  3KQI A;  3O33 A;  3HCU A;  1V87 A;  2KWK A;  4LJN A;  5DIN A;  2HYE D;  1VFY A;  1Z6U A;  2YHN A;  2K16 A;  2VJF B;  4AP4 A;  4MSX A;  3KNV A;  2KWN A;  2YUR A;  3O35 A;  2YUC A;  4I7D A;  5G04 B;  3KV5 A;  5LKU A;  1WEP A;  4YBS A;  2OXQ C;  5TAB A;  2M6M A;  3KV6 A;  3SHB A;  4GND A;  4IC3 A;  2JMJ A;  3MHH A;  3O34 A;  2VPD A;  3O36 A;  4XI1 A;  5B75 A;  1WE9 A;  2VNF A;  2D8S A;  5FEY A;  4GNE A;  4ZUX U;  2F42 A;  2E6S A;  5LCW B;  2ECJ A;  5D1L B;  3RTR B;  1JM7 B;  1N87 A;  2PNX A;  2XB1 A;  3ZPV 1;  4YAD A;  3I2D A;  1IYM A;  2MA5 A;  2M3H A;  5FER A;  1WEM A;  4CCG X;  5DKA A;  1WEO A;  3U5O A;  2YHO A;  2H0D B;  2G43 A;  2LDR A;  5H9M A;  5KH3 A;  2RI7 A;  2ECV A;  3HCT A;  2CT2 A;  5I3L A;  4LK9 A;  2QIC A;  1WEV A;  2QIZ A;  3QZV A;  4WA6 A;  3LQI A;  4S3O B;  4YC9 A;  3PUR A;  5EYA F;  2CKL A;  2MNZ A;  3IHP A;  4MVT A;  2VP7 A;  2ECW A;  3ZPV E;  4A4C A;  4FJC A;  5H1U A;  5D1K B;  1RMD A;  4I7B A;  4WZ3 B;  4YBM A;  5TRB A;  1WEQ A;  3SOW A;  2E6R A;  3RPG C;  2NAA A;  4CA1 A;  5H1V A;  4YAT A;  1F62 A;  3GL6 A;  2KYU A;  5LKT A;  3N9L A;  2LXH C;  4AYC A;  5LKZ A;  3L11 A;  2AN6 A;  1Z2Q A;  3PUQ A;  2LGK A;  1VYX A;  3GV4 A;  3ASL A;  3O7A A;  2EGP A;  1VD4 A;  3LQJ A;  5FB0 A;  2ECN A;  1WIM A;  2YW8 A;  5B76 A;  1HYJ A;  5B79 A;  2KU3 A;  1WEW A;  1LDJ B;  5B78 A;  3LQH A;  4PTB A;  2L0B A;  4LKA A;  5TDW A;  2KIZ A;  4L7X A;  2L75 A;  3U5M A;  3MHS A;  2LXP C;  1FBV A;  1WES A;  4LAD B;  4YAX A;  4PPE A;  2KRE A;  2K17 A;  2VJE A;  4LLB A;  1WEN A;  2LGG A;  2Y43 A;  2KFT A;  2VPE A;  2FUI A;  2K4D A;  2KGI A;  5KH9 A;  1MM3 A;  2YSJ A;  3DQV R;  3M62 A;  3C5K A;  2MNY A;  3L1X A;  2RSD A;  1WGM A;  2KE1 A;  1X4J A;  2H0D A;  1ZBD B;  4WZ2 A;  4QF3 A;  5D1M B;  2MD8 C;  4UI9 B;  4V3L C;  1WEE A;  2KGG A;  4QF2 A;  4FK5 A;  2IDA A;  4BBQ A;  2VPB A;  2YRE A;  2YYR A;  3T6R A;  2ZET C;  1X4U A;  2JMD A;  3M63 A;  4YBT A;  3N9M A;  3HTK C;  3L1Z B;  2L43 A;  2MIQ A;  3N9P A;  3N9Q A;  5TDR A;  1K2F A;  2C2V S;  2G6Q A;  3N9N A;  2M85 A;  2Y1M A;  2ECG A;  3U5P A;  5TBN A;  2K1J A;  4FO9 A;  3T7L A;  2LGL A;  2KR4 A;  3C6W A;  2I50 A;  4GNG A;  2EA6 A;  4A49 A;  3VK6 A;  2VJF A;  3ZNI A;  1G25 A;  4GNF A;  3ZVY A;  4A0C D;  2YQM A;  4UP0 A;  4IC2 A;  5AIU A;  5B8D A;  2VPG A;  2CSY A;  4S3O C;  2DX8 A;  1JOC A;  3HCS A;  5H1T A;  4F52 B;  3NG2 A;  3ZTG A;  4B86 C;  1T1H A;  2ECT A;  4X3G A;  4B7Y C;  5G0F A;  2L5U A;  4R7E A;  4C9Z A;  2YQL A;  2JMI A;  2UZG A;  3DPL R;  4AYC B;  3FL2 A;  2LGV A;  1XWH A;  4V3K C;  2M1R A;  4ZQL A;  4NN2 A;  1DVP A;  4P5O B;  1JM7 A;  5G05 B;  1FP0 A;  2F6J A;  2JRJ A;  2Y1N A;  3EB6 A;  4AUQ B;  4O64 A;  1WIL A;  2G45 A;  2L80 A;  4UP5 A;  1LDK C;  1CHC A;  4R2Y A;  2FSA A;  1WEU A;  2MT5 A;  4ZDT A;  3PHD A;  2F6N A;  4WZ0 A;  2YT5 A;  3N9O A;  2ECI A;  2VJE B;  4YAB A;  2HDP A;  2EOD A;  3SOX A;  2BAY A;  2LRI C;  2MA6 A;  3ZVZ B;  2KWJ A;  1MM2 A;  2FUU A;  5C11 A;  3RPG B;  4Q6F A;  5FB1 A;  3ZYQ A;  4N3W A;  4A4B A;  1E4U A;  1WFK A;  5LKX A;  1HYI A;  4FIP A;  4I7C A;  3V43 A;  4GB0 A;  2LQ6 A;  1Z60 A;  2MUM A;  2YU4 A;  3M99 A;  2PUY A;  4R8P K;  5JG6 A;  4N4F A; 
#chains in the Genus database with same CATH topology
 3EB5 A;  5B77 A;  2MD7 B;  2C2L A;  2CSZ A;  4TKP B;  5AIT A;  1X4I A;  4BHW A;  5C13 A;  4L58 A;  2LN0 A;  1BOR A;  2YSM A;  2XEU A;  3O37 A;  2OWA A;  4W4U A;  2LV9 A;  3LRQ A;  1U6G B;  5J3X A;  2QJ0 A;  2CKL B;  5SVI B;  3SOU A;  5KH7 A;  4AVX A;  3O70 A;  3U5N A;  2KWO A;  3KQI A;  4Z0O A;  3O33 A;  3HCU A;  1V87 A;  2KWK A;  4LJN A;  5DIN A;  2LAU A;  2HYE D;  1VFY A;  4OGE A;  1Z6U A;  2YHN A;  2K16 A;  2IQJ A;  2VJF B;  4AP4 A;  4MSX A;  3KNV A;  2KWN A;  2YUR A;  3FEH A;  3O35 A;  2YUC A;  4I7D A;  5G04 B;  2JM3 A;  2XOY A;  3KV5 A;  3T9K A;  2XOZ A;  5LKU A;  1WEP A;  4YBS A;  2OXQ C;  5TAB A;  2M13 A;  2M6M A;  3KV6 A;  3SHB A;  4GND A;  4IC3 A;  2JMJ A;  3MHH A;  4Z0R A;  3O34 A;  2VPD A;  3O36 A;  4XI1 A;  5B75 A;  1WE9 A;  2VNF A;  2D8S A;  3LVR E;  5FEY A;  4GNE A;  4ZUX U;  2F42 A;  3Q1D A;  2E6S A;  5LCW B;  2ECJ A;  5D1L B;  3RTR B;  1JM7 B;  1N87 A;  2PNX A;  2XB1 A;  3ZPV 1;  4YAD A;  2DSM A;  3I2D A;  5SVX A;  1IYM A;  2MA5 A;  2EGM A;  2M3H A;  5FER A;  1WEM A;  4CCG X;  5DKA A;  1WEO A;  3U5O A;  2YHO A;  2H0D B;  3DWD A;  2G43 A;  2LDR A;  5H9M A;  5KH3 A;  2RI7 A;  2ECV A;  3HCT A;  2CT2 A;  5I3L A;  4LK9 A;  2QIC A;  1WEV A;  2QIZ A;  3QZV A;  4WA6 A;  3LQI A;  4S3O B;  4YC9 A;  3PUR A;  5EYA F;  2CKL A;  2MNZ A;  5SVI A;  2XP0 A;  3IHP A;  4MVT A;  2VP7 A;  2ECW A;  3ZPV E;  4A4C A;  4FJC A;  5H1U A;  5D1K B;  1RMD A;  4I7B A;  4WZ3 B;  4YBM A;  5TRB A;  1WEQ A;  3SOW A;  2E6R A;  3RPG C;  2NAA A;  4CA1 A;  5H1V A;  4YAT A;  1F62 A;  3GL6 A;  2KYU A;  4QQ4 A;  3N9L A;  5LKT A;  2LXH C;  4AYC A;  5LKZ A;  3L11 A;  2AN6 A;  2XOC A;  1Z2Q A;  3PUQ A;  2LGK A;  1VYX A;  3GV4 A;  3ASL A;  3O7A A;  2EGP A;  1VD4 A;  3LQJ A;  5FB0 A;  2ECN A;  1WIM A;  2YW8 A;  1MBM A;  5B76 A;  1HYJ A;  5B79 A;  2E61 A;  2KU3 A;  1WEW A;  1LDJ B;  5B78 A;  2B0O E;  3LQH A;  3FJU B;  4PTB A;  3M7K A;  2L0B A;  4LKA A;  5TDW A;  3LDY A;  2KIZ A;  4L7X A;  2L75 A;  3U5M A;  3MDB C;  3MHS A;  2LXP C;  1FBV A;  1WES A;  4LAD B;  4YAX A;  4PPE A;  2KRE A;  2K17 A;  2VJE A;  4LLB A;  1WEN A;  2LGG A;  2Y43 A;  2KFT A;  2VPE A;  2D8U A;  2FUI A;  2K4D A;  2KGI A;  5KH9 A;  1MM3 A;  2CON A;  2YSJ A;  3DQV R;  3M62 A;  3SUB A;  2KKY A;  3C5K A;  2MNY A;  4F1P A;  3L1X A;  2MKE A;  4OGC A;  2RSD A;  1WGM A;  2DJA A;  2KE1 A;  3DDT A;  1X4J A;  2H0D A;  1ZBD B;  4WZ2 A;  4QF3 A;  5D1M B;  2MD8 C;  4UI9 B;  4V3L C;  1WEE A;  2KGG A;  4QF2 A;  4FK5 A;  2IDA A;  4BBQ A;  2VPB A;  2YRE A;  4O62 A;  2YYR A;  3T6R A;  2ZET C;  1X4U A;  2JMD A;  2JUN A;  3E2D A;  3M63 A;  2RR4 A;  3LVQ E;  4YBT A;  3O47 A;  3N9M A;  3HTK C;  3L1Z B;  2L43 A;  2MIQ A;  3N9P A;  3N9Q A;  5TDR A;  1K2F A;  2C2V S;  3FM8 C;  2G6Q A;  3N9N A;  2M85 A;  2Y1M A;  2ECG A;  3U5P A;  5TBN A;  2K1J A;  4FO9 A;  3T7L A;  2LGL A;  2KR4 A;  3C6W A;  2I50 A;  5SVY A;  2CRW A;  4GNG A;  2EA6 A;  4A49 A;  3VK6 A;  2VJF A;  3ZNI A;  1G25 A;  4GNF A;  3ZVY A;  4A0C D;  2FFW A;  2YQM A;  4UP0 A;  4IC2 A;  5AIU A;  5K3Q A;  5B8D A;  2YVR A;  2KKX A;  3KDE C;  2EXU A;  2VPG A;  2CSY A;  4S3O C;  2DX8 A;  1JOC A;  3HCS A;  5H1T A;  4F52 B;  3NG2 A;  3ZTG A;  4H9D A;  3FAN A;  4B86 C;  1T1H A;  2ECT A;  4X3G A;  4B7Y C;  5G0F A;  2L5U A;  4R7E A;  4C9Z A;  2YQL A;  2JMI A;  2UZG A;  3DPL R;  4AYC B;  3FL2 A;  2LGV A;  1XWH A;  4V3K C;  2M1R A;  4ZQL A;  4NN2 A;  1DVP A;  4P5O B;  1JM7 A;  5G05 B;  1FP0 A;  2FD4 A;  3LJU X;  2F6J A;  2JRJ A;  2Y1N A;  3EB6 A;  2CRR A;  4AUQ B;  4O64 A;  1WIL A;  2G45 A;  1DCQ A;  2L80 A;  4UP5 A;  1LDK C;  1CHC A;  4R2Y A;  2FSA A;  1WEU A;  2MT5 A;  4ZDT A;  3PHD A;  2F6N A;  4WZ0 A;  2YT5 A;  3N9O A;  2ECI A;  2VJE B;  4YAB A;  2L7P A;  2HDP A;  2EOD A;  3SOX A;  2BAY A;  2LRI C;  2MA6 A;  3ZVZ B;  2KWJ A;  1MM2 A;  2FUU A;  2P57 A;  5C11 A;  3RPG B;  3H7H A;  4Q6F A;  5FB1 A;  3ZYQ A;  4N3W A;  4A4B A;  1E4U A;  1WFK A;  5LKX A;  1HYI A;  2CSV A;  3PLW A;  3JUE A;  4FIP A;  4I7C A;  3V43 A;  4GB0 A;  2LQ6 A;  1Z60 A;  2MUM A;  2YU4 A;  3M99 A;  3FAO A;  2PUY A;  4R8P K;  5JG6 A;  4N4F A; 
#chains in the Genus database with same CATH homology
 3EB5 A;  5B77 A;  2MD7 B;  2C2L A;  2CSZ A;  4TKP B;  5AIT A;  1X4I A;  4BHW A;  5C13 A;  4L58 A;  2LN0 A;  1BOR A;  2YSM A;  2XEU A;  3O37 A;  4W4U A;  2LV9 A;  3LRQ A;  1U6G B;  5J3X A;  2QJ0 A;  2CKL B;  3SOU A;  5KH7 A;  4AVX A;  3O70 A;  3U5N A;  2KWO A;  3KQI A;  3O33 A;  3HCU A;  1V87 A;  2KWK A;  4LJN A;  5DIN A;  2HYE D;  1VFY A;  1Z6U A;  2YHN A;  2K16 A;  2VJF B;  4AP4 A;  4MSX A;  3KNV A;  2KWN A;  2YUR A;  3O35 A;  2YUC A;  4I7D A;  5G04 B;  3KV5 A;  5LKU A;  1WEP A;  4YBS A;  2OXQ C;  5TAB A;  2M6M A;  3KV6 A;  3SHB A;  4GND A;  4IC3 A;  2JMJ A;  3MHH A;  3O34 A;  2VPD A;  3O36 A;  4XI1 A;  5B75 A;  1WE9 A;  2VNF A;  2D8S A;  5FEY A;  4GNE A;  4ZUX U;  2F42 A;  2E6S A;  5LCW B;  2ECJ A;  5D1L B;  3RTR B;  1JM7 B;  1N87 A;  2PNX A;  2XB1 A;  3ZPV 1;  4YAD A;  3I2D A;  1IYM A;  2MA5 A;  2M3H A;  5FER A;  1WEM A;  4CCG X;  5DKA A;  1WEO A;  3U5O A;  2YHO A;  2H0D B;  2G43 A;  2LDR A;  5H9M A;  5KH3 A;  2RI7 A;  2ECV A;  3HCT A;  2CT2 A;  5I3L A;  4LK9 A;  2QIC A;  1WEV A;  2QIZ A;  3QZV A;  4WA6 A;  3LQI A;  4S3O B;  4YC9 A;  3PUR A;  5EYA F;  2CKL A;  2MNZ A;  3IHP A;  4MVT A;  2VP7 A;  2ECW A;  3ZPV E;  4A4C A;  4FJC A;  5H1U A;  5D1K B;  1RMD A;  4I7B A;  4WZ3 B;  4YBM A;  5TRB A;  1WEQ A;  3SOW A;  2E6R A;  3RPG C;  2NAA A;  4CA1 A;  5H1V A;  4YAT A;  1F62 A;  3GL6 A;  2KYU A;  5LKT A;  3N9L A;  2LXH C;  4AYC A;  5LKZ A;  3L11 A;  2AN6 A;  1Z2Q A;  3PUQ A;  2LGK A;  1VYX A;  3GV4 A;  3ASL A;  3O7A A;  2EGP A;  1VD4 A;  3LQJ A;  5FB0 A;  2ECN A;  1WIM A;  2YW8 A;  5B76 A;  1HYJ A;  5B79 A;  2KU3 A;  1WEW A;  1LDJ B;  5B78 A;  3LQH A;  4PTB A;  2L0B A;  4LKA A;  5TDW A;  2KIZ A;  4L7X A;  2L75 A;  3U5M A;  3MHS A;  2LXP C;  1FBV A;  1WES A;  4LAD B;  4YAX A;  4PPE A;  2KRE A;  2K17 A;  2VJE A;  4LLB A;  1WEN A;  2LGG A;  2Y43 A;  2KFT A;  2VPE A;  2FUI A;  2K4D A;  2KGI A;  5KH9 A;  1MM3 A;  2YSJ A;  3DQV R;  3M62 A;  3C5K A;  2MNY A;  3L1X A;  2RSD A;  1WGM A;  2KE1 A;  1X4J A;  2H0D A;  1ZBD B;  4WZ2 A;  4QF3 A;  5D1M B;  2MD8 C;  4UI9 B;  4V3L C;  1WEE A;  2KGG A;  4QF2 A;  4FK5 A;  2IDA A;  4BBQ A;  2VPB A;  2YRE A;  2YYR A;  3T6R A;  2ZET C;  1X4U A;  2JMD A;  3M63 A;  4YBT A;  3N9M A;  3HTK C;  3L1Z B;  2L43 A;  2MIQ A;  3N9P A;  3N9Q A;  5TDR A;  1K2F A;  2C2V S;  2G6Q A;  3N9N A;  2M85 A;  2Y1M A;  2ECG A;  3U5P A;  5TBN A;  2K1J A;  4FO9 A;  3T7L A;  2LGL A;  2KR4 A;  3C6W A;  2I50 A;  4GNG A;  2EA6 A;  4A49 A;  3VK6 A;  2VJF A;  3ZNI A;  1G25 A;  4GNF A;  3ZVY A;  4A0C D;  2YQM A;  4UP0 A;  4IC2 A;  5AIU A;  5B8D A;  2VPG A;  2CSY A;  4S3O C;  2DX8 A;  1JOC A;  3HCS A;  5H1T A;  4F52 B;  3NG2 A;  3ZTG A;  4B86 C;  1T1H A;  2ECT A;  4X3G A;  4B7Y C;  5G0F A;  2L5U A;  4R7E A;  4C9Z A;  2YQL A;  2JMI A;  2UZG A;  3DPL R;  4AYC B;  3FL2 A;  2LGV A;  1XWH A;  4V3K C;  2M1R A;  4ZQL A;  4NN2 A;  1DVP A;  4P5O B;  1JM7 A;  5G05 B;  1FP0 A;  2F6J A;  2JRJ A;  2Y1N A;  3EB6 A;  4AUQ B;  4O64 A;  1WIL A;  2G45 A;  2L80 A;  4UP5 A;  1LDK C;  1CHC A;  4R2Y A;  2FSA A;  1WEU A;  2MT5 A;  4ZDT A;  3PHD A;  2F6N A;  4WZ0 A;  2YT5 A;  3N9O A;  2ECI A;  2VJE B;  4YAB A;  2HDP A;  2EOD A;  3SOX A;  2BAY A;  2LRI C;  2MA6 A;  3ZVZ B;  2KWJ A;  1MM2 A;  2FUU A;  5C11 A;  3RPG B;  4Q6F A;  5FB1 A;  3ZYQ A;  4N3W A;  4A4B A;  1E4U A;  1WFK A;  5LKX A;  1HYI A;  4FIP A;  4I7C A;  3V43 A;  4GB0 A;  2LQ6 A;  1Z60 A;  2MUM A;  2YU4 A;  3M99 A;  2PUY A;  4R8P K;  5JG6 A;  4N4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...