2XOCA

C-terminal cysteine-rich domain of human chfr bound to madpr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
213
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
total genus 64
structure length 213
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xocA01
2XP0A 2XOCA 2XOZA 2XOYA
chains in the Genus database with same CATH superfamily
2CRRA 2L7PA 2LN0A 2EXUA 2CSZA 2ECVA 3KDEC 4ZDTA 4P5OB 2K1JA 5B78A 1LDJB 4XI1A 2HDPA 5LKUA 3RPGC 2G6QA 4YBSA 4ZUXU 2VPBA 3LQHA 3M99A 5B8DA 5KH7A 3C5KA 3MDBC 4PPEA 5FB0A 2UZGA 3SOUA 2M85A 2YU4A 2XEUA 1WILA 2G45A 3O37A 3M63A 3QZVA 2KWJA 3E2DA 2M13A 2LXHC 2MNZA 5AIUA 3ZPVE 4S3OB 3T9KA 2XP0A 3VK6A 2MA5A 3PLWA 1ZBDB 4OGCA 2Y43A 2LGGA 5J3XA 1HYIA 3KV5A 3U5NA 2KWKA 2CSYA 2NAAA 2ECJA 4B86C 5FERA 2CT2A 4GNFA 2D8UA 3ASLA 3ZVZB 4O62A 4YAXA 2KU3A 2DX8A 2H0DB 3I2DA 2VJFA 4R2YA 4WA6A 2MA6A 3O47A 2XOYA 1WEEA 4WZ2A 4GNDA 3FL2A 4C9ZA 2KR4A 1WEPA 2LAUA 3EB5A 2Y1NA 2K4DA 2BAYA 3O36A 1X4JA 2K16A 3KV6A 1Z6UA 1F62A 5SVXA 3ZTGA 1JOCA 2DJAA 2K17A 3RTRB 3ZNIA 1DVPA 3O70A 2OXQC 4I7DA 5SVIB 2CONA 2P57A 3LDYA 2YHNA 3FAOA 5LKZA 2KFTA 3FANA 4A4BA 4LK9A 2LRIC 4S3OC 5C13A 4QF3A 1JM7A 4F1PA 3N9OA 3DWDA 1WEWA 2JM3A 1FP0A 4YBTA 3ZPV1 5LCWB 4NN2A 4ZQLA 3H7HA 3LJUX 1U6GB 2IDAA 4WZ0A 5B79A 3Q1DA 5TRBA 3SOXA 5B76A 3HTKC 2PNXA 2YUCA 2JUNA 2E6RA 2RSDA 4Z0RA 5JG6A 5TBNA 2YW8A 4R7EA 5I3LA 1Z60A 2OWAA 3DQVR 2MD8C 4N4FA 2KYUA 3HCSA 4A49A 4AYCA 2CKLB 2L43A 3NG2A 2C2VS 2KE1A 3LQJA 1WEMA 4FK5A 4Z0OA 2M1RA 4LLBA 3O34A 2MT5A 5K3QA 3KQIA 1WEOA 2MNYA 1WE9A 1K2FA 5KH9A 3PHDA 2M3HA 2KGIA 2FUIA 3HCTA 3SUBA 3O33A 3GL6A 3M62A 2RR4A 4H9DA 2YT5A 1E4UA 5D1LB 2IQJA 2ECGA 2AN6A 1HYJA 2L80A 2I50A 1N87A 5AITA 2JMJA 4BHWA 4YATA 2VJFB 2ECTA 1CHCA 2LGKA 3U5OA 3ZVYA 1X4IA 1VD4A 5LKTA 4PTBA 4UI9B 1T1HA 1WEVA 1JM7B 1RMDA 2VJEA 3MHHA 1V87A 2YQMA 3L1ZB 3LVRE 2QIZA 2KWNA 4AVXA 4FO9A 5D1MB 4YABA 4LADB 2Y1MA 4IC3A 2ECIA 1WFKA 5DKAA 2LGLA 4CA1A 2L75A 3MHSA 1MM3A 2YHOA 3LQIA 2L5UA 4QF2A 5H1VA 2ECWA 3RPGB 1BORA 2E6SA 2EGMA 2MUMA 4AP4A 3C6WA 5TDWA 3T6RA 1VYXA 4TKPB 4V3KC 3LRQA 3N9LA 2VPDA 3M7KA 3JUEA 5EYAF 2EODA 4L7XA 2MIQA 2H0DA 3PURA 2YYRA 2L0BA 3SHBA 2ZETC 2F6NA 5G04B 2QICA 3ZYQA 5B77A 2YSJA 2JRJA 5LKXA 3N9MA 3IHPA 2QJ0A 2KIZA 3LVQE 2LXPC 5KH3A 2CSVA 3L1XA 3O35A 4R8PK 1VFYA 5C11A 2EA6A 4YBMA 2C2LA 5H1TA 2PUYA 4AYCB 2RI7A 2YURA 4GNEA 4GB0A 4QQ4A 4GNGA 4L58A 2MD7B 3PUQA 2VP7A 1XWHA 3FJUB 4YC9A 3V43A 2VPEA 4LKAA 3U5PA 2YQLA 3FEHA 4MVTA 4UP5A 4B7YC 2KREA 2LV9A 2XB1A 2D8SA 5H9MA 4F52B 4LJNA 4I7CA 5FEYA 2HYED 4UP0A 2F6JA 1IYMA 1WEUA 3GV4A 3N9NA 2ECNA 4X3GA 4CCGX 5DINA 3L11A 4AUQB 1Z2QA 3EB6A 5TABA 4OGEA 5TDRA 1WENA 4I7BA 1WESA 2YSMA 4IC2A 5SVIA 1X4UA 4FJCA 2LGVA 5D1KB 2KKXA 4V3LC 2FFWA 2JMIA 3HCUA 4WZ3B 5G0FA 2VPGA 4Q6FA 3N9QA 4MSXA 2KKYA 2VJEB 1MM2A 1WEQA 2XOZA 2FSAA 1FBVA 2B0OE 4A4CA 2YREA 3DDTA 3U5MA 2E61A 5H1UA 2FUUA 2KGGA 3FM8C 3DPLR 4N3WA 4YADA 1G25A 2M6MA 2LQ6A 2LDRA 3O7AA 1WIMA 1DCQA 2VNFA 2XOCA 2JMDA 2EGPA 5FB1A 1MBMA 2CRWA 5SVYA 2KWOA 3N9PA 2MKEA 2CKLA 2G43A 5B75A 4A0CD 4FIPA 2DSMA 2YVRA 3KNVA 1WGMA 4BBQA 3T7LA 2FD4A 4W4UA 2F42A 5G05B 1LDKC 3SOWA 4O64A
chains in the Genus database with same CATH topology
1DCQA 2EGMA 2CRRA 3LVRE 2JM3A 2XOCA 3O47A 3PLWA 2XOYA 3LVQE 5SVIB 2CONA 2L7PA 3FJUB 2P57A 3LDYA 2OWAA 4OGCA 2EXUA 2CRWA 5SVYA 2KKYA 2MKEA 3SUBA 3H7HA 2XOZA 3LJUX 2CSVA 2LAUA 3FEHA 3MDBC 3KDEC 2YVRA 4OGEA 2RR4A 4H9DA 2B0OE 3M7KA 3JUEA 2YREA 3DDTA 2FD4A 3Q1DA 2E61A 2M13A 3E2DA 5SVIA 2IQJA 5SVXA 3FM8C 4Z0OA 2D8UA 3T9KA 2JUNA 4O62A 2XP0A 4Z0RA 4QQ4A 2KKXA 5K3QA 4F1PA 3DWDA 2FFWA 2DJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP0 A;  2XOC A;  2XOZ A;  2XOY A; 
#chains in the Genus database with same CATH topology
 2CRR A;  2L7P A;  2LN0 A;  2EXU A;  2CSZ A;  2ECV A;  3KDE C;  4ZDT A;  4P5O B;  2K1J A;  5B78 A;  1LDJ B;  4XI1 A;  2HDP A;  5LKU A;  3RPG C;  2G6Q A;  4YBS A;  4ZUX U;  2VPB A;  3LQH A;  3M99 A;  5B8D A;  5KH7 A;  3C5K A;  3MDB C;  4PPE A;  5FB0 A;  2UZG A;  3SOU A;  2M85 A;  2YU4 A;  2XEU A;  1WIL A;  2G45 A;  3O37 A;  3M63 A;  3QZV A;  2KWJ A;  3E2D A;  2M13 A;  2LXH C;  2MNZ A;  5AIU A;  3ZPV E;  4S3O B;  3T9K A;  2XP0 A;  3VK6 A;  2MA5 A;  3PLW A;  1ZBD B;  4OGC A;  2Y43 A;  2LGG A;  5J3X A;  1HYI A;  3KV5 A;  3U5N A;  2KWK A;  2CSY A;  2NAA A;  2ECJ A;  4B86 C;  5FER A;  2CT2 A;  4GNF A;  2D8U A;  3ASL A;  3ZVZ B;  4O62 A;  4YAX A;  2KU3 A;  2DX8 A;  2H0D B;  3I2D A;  2VJF A;  4R2Y A;  4WA6 A;  2MA6 A;  3O47 A;  2XOY A;  1WEE A;  4WZ2 A;  4GND A;  3FL2 A;  4C9Z A;  2KR4 A;  1WEP A;  2LAU A;  3EB5 A;  2Y1N A;  2K4D A;  2BAY A;  3O36 A;  1X4J A;  2K16 A;  3KV6 A;  1Z6U A;  1F62 A;  5SVX A;  3ZTG A;  1JOC A;  2DJA A;  2K17 A;  3RTR B;  3ZNI A;  1DVP A;  3O70 A;  2OXQ C;  4I7D A;  5SVI B;  2CON A;  2P57 A;  3LDY A;  2YHN A;  3FAO A;  5LKZ A;  2KFT A;  3FAN A;  4A4B A;  4LK9 A;  2LRI C;  4S3O C;  5C13 A;  4QF3 A;  1JM7 A;  4F1P A;  3N9O A;  3DWD A;  1WEW A;  2JM3 A;  1FP0 A;  4YBT A;  3ZPV 1;  5LCW B;  4NN2 A;  4ZQL A;  3H7H A;  3LJU X;  1U6G B;  2IDA A;  4WZ0 A;  5B79 A;  3Q1D A;  5TRB A;  3SOX A;  5B76 A;  3HTK C;  2PNX A;  2YUC A;  2JUN A;  2E6R A;  2RSD A;  4Z0R A;  5JG6 A;  5TBN A;  2YW8 A;  4R7E A;  5I3L A;  1Z60 A;  2OWA A;  3DQV R;  2MD8 C;  4N4F A;  2KYU A;  3HCS A;  4A49 A;  4AYC A;  2CKL B;  2L43 A;  3NG2 A;  2C2V S;  2KE1 A;  3LQJ A;  1WEM A;  4FK5 A;  4Z0O A;  2M1R A;  4LLB A;  3O34 A;  2MT5 A;  5K3Q A;  3KQI A;  1WEO A;  2MNY A;  1WE9 A;  1K2F A;  5KH9 A;  3PHD A;  2M3H A;  2KGI A;  2FUI A;  3HCT A;  3SUB A;  3O33 A;  3GL6 A;  3M62 A;  2RR4 A;  4H9D A;  2YT5 A;  1E4U A;  5D1L B;  2IQJ A;  2ECG A;  2AN6 A;  1HYJ A;  2L80 A;  2I50 A;  1N87 A;  5AIT A;  2JMJ A;  4BHW A;  4YAT A;  2VJF B;  2ECT A;  1CHC A;  2LGK A;  3U5O A;  3ZVY A;  1X4I A;  1VD4 A;  5LKT A;  4PTB A;  4UI9 B;  1T1H A;  1WEV A;  1JM7 B;  1RMD A;  2VJE A;  3MHH A;  1V87 A;  2YQM A;  3L1Z B;  3LVR E;  2QIZ A;  2KWN A;  4AVX A;  4FO9 A;  5D1M B;  4YAB A;  4LAD B;  2Y1M A;  4IC3 A;  2ECI A;  1WFK A;  5DKA A;  2LGL A;  4CA1 A;  2L75 A;  3MHS A;  1MM3 A;  2YHO A;  3LQI A;  2L5U A;  4QF2 A;  5H1V A;  2ECW A;  3RPG B;  1BOR A;  2E6S A;  2EGM A;  2MUM A;  4AP4 A;  3C6W A;  5TDW A;  3T6R A;  1VYX A;  4TKP B;  4V3K C;  3LRQ A;  3N9L A;  2VPD A;  3M7K A;  3JUE A;  5EYA F;  2EOD A;  4L7X A;  2MIQ A;  2H0D A;  3PUR A;  2YYR A;  2L0B A;  3SHB A;  2ZET C;  2F6N A;  5G04 B;  2QIC A;  3ZYQ A;  5B77 A;  2YSJ A;  2JRJ A;  5LKX A;  3N9M A;  3IHP A;  2QJ0 A;  2KIZ A;  3LVQ E;  2LXP C;  5KH3 A;  2CSV A;  3L1X A;  3O35 A;  4R8P K;  1VFY A;  5C11 A;  2EA6 A;  4YBM A;  2C2L A;  5H1T A;  2PUY A;  4AYC B;  2RI7 A;  2YUR A;  4GNE A;  4GB0 A;  4QQ4 A;  4GNG A;  4L58 A;  2MD7 B;  3PUQ A;  2VP7 A;  1XWH A;  3FJU B;  4YC9 A;  3V43 A;  2VPE A;  4LKA A;  3U5P A;  2YQL A;  3FEH A;  4MVT A;  4UP5 A;  4B7Y C;  2KRE A;  2LV9 A;  2XB1 A;  2D8S A;  5H9M A;  4F52 B;  4LJN A;  4I7C A;  5FEY A;  2HYE D;  4UP0 A;  2F6J A;  1IYM A;  1WEU A;  3GV4 A;  3N9N A;  2ECN A;  4X3G A;  4CCG X;  5DIN A;  3L11 A;  4AUQ B;  1Z2Q A;  3EB6 A;  5TAB A;  4OGE A;  5TDR A;  1WEN A;  4I7B A;  1WES A;  2YSM A;  4IC2 A;  5SVI A;  1X4U A;  4FJC A;  2LGV A;  5D1K B;  2KKX A;  4V3L C;  2FFW A;  2JMI A;  3HCU A;  4WZ3 B;  5G0F A;  2VPG A;  4Q6F A;  3N9Q A;  4MSX A;  2KKY A;  2VJE B;  1MM2 A;  1WEQ A;  2XOZ A;  2FSA A;  1FBV A;  2B0O E;  4A4C A;  2YRE A;  3DDT A;  3U5M A;  2E61 A;  5H1U A;  2FUU A;  2KGG A;  3FM8 C;  3DPL R;  4N3W A;  4YAD A;  1G25 A;  2M6M A;  2LQ6 A;  2LDR A;  3O7A A;  1WIM A;  1DCQ A;  2VNF A;  2XOC A;  2JMD A;  2EGP A;  5FB1 A;  1MBM A;  2CRW A;  5SVY A;  2KWO A;  3N9P A;  2MKE A;  2CKL A;  2G43 A;  5B75 A;  4A0C D;  4FIP A;  2DSM A;  2YVR A;  3KNV A;  1WGM A;  4BBQ A;  3T7L A;  2FD4 A;  4W4U A;  2F42 A;  5G05 B;  1LDK C;  3SOW A;  4O64 A; 
#chains in the Genus database with same CATH homology
 1DCQ A;  2EGM A;  2CRR A;  3LVR E;  2JM3 A;  2XOC A;  3O47 A;  3PLW A;  2XOY A;  3LVQ E;  5SVI B;  2CON A;  2L7P A;  3FJU B;  2P57 A;  3LDY A;  2OWA A;  4OGC A;  2EXU A;  2CRW A;  5SVY A;  2KKY A;  2MKE A;  3SUB A;  3H7H A;  2XOZ A;  3LJU X;  2CSV A;  2LAU A;  3FEH A;  3MDB C;  3KDE C;  2YVR A;  4OGE A;  2RR4 A;  4H9D A;  2B0O E;  3M7K A;  3JUE A;  2YRE A;  3DDT A;  2FD4 A;  3Q1D A;  2E61 A;  2M13 A;  3E2D A;  5SVI A;  2IQJ A;  5SVX A;  3FM8 C;  4Z0O A;  2D8U A;  3T9K A;  2JUN A;  4O62 A;  2XP0 A;  4Z0R A;  4QQ4 A;  2KKX A;  5K3Q A;  4F1P A;  3DWD A;  2FFW A;  2DJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...