2XOCA

C-terminal cysteine-rich domain of human chfr bound to madpr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
213
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 213
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xocA01
2XP0A 2XOYA 2XOZA 2XOCA
chains in the Genus database with same CATH superfamily
2FD4A 2JMDA 2OXQC 5B76A 3KV6A 5KH9A 2EA6A 1Z2QA 3ZTGA 2DX8A 2LV9A 2L7PA 2YUCA 2VJFB 3LQJA 2LGVA 4YATA 3N9NA 2YURA 2M13A 3T7LA 2Y1NA 2G6QA 3EB6A 3PHDA 2K4DA 3N9PA 4GNEA 1XWHA 2VJEB 4WA6A 2PUYA 5D1MB 4LKAA 3RPGC 3KQIA 5LKTA 2CRWA 2VPBA 2MIQA 3C6WA 3ZPV1 2RI7A 3HTKC 4AUQB 2LXHC 1JM7A 2KWOA 1VYXA 3VK6A 4YABA 4B86C 5H1TA 1IYMA 2FUIA 2VP7A 3O34A 4C9ZA 4LK9A 2JUNA 1WENA 2MT5A 4A4CA 2F42A 3FEHA 3MHHA 2JM3A 1DCQA 2M3HA 3L1ZB 5B78A 2G43A 2QIZA 3RTRB 2XOCA 3IHPA 3KNVA 3NG2A 4P5OB 2K16A 2JMIA 3DDTA 4LLBA 2MD8C 3I2DA 3ZVZB 3M7KA 4IC3A 2LQ6A 2CKLB 3U5PA 1MM3A 2ECIA 3M99A 2EGMA 4A4BA 2DJAA 3DPLR 2LGGA 4X3GA 2D8SA 3RPGB 5SVIA 5B77A 2YHOA 1VFYA 2L5UA 2H0DA 2ECWA 1WE9A 4OGCA 4WZ0A 5KH3A 3SOXA 2DSMA 1X4JA 2CSYA 4UP0A 3N9LA 4FO9A 5I3LA 4B7YC 2MNYA 3ASLA 3C5KA 2QICA 3MHSA 2XOZA 2KREA 4V3KC 3ZYQA 1VD4A 4AYCB 1K2FA 2JMJA 3U5OA 3PLWA 2RSDA 4W4UA 3T6RA 2QJ0A 2E6RA 5LCWB 3FL2A 1G25A 4GNDA 5TABA 2MA5A 3DWDA 3LJUX 2LDRA 4GNGA 5FB1A 4Z0OA 4S3OB 2KGIA 1JM7B 2KE1A 5LKXA 2I50A 2YQMA 4I7BA 5AITA 2L80A 1DVPA 2E61A 3SHBA 4OGEA 4BHWA 1WEQA 4FIPA 4GNFA 3U5MA 4QQ4A 3H7HA 1ZBDB 4R7EA 4ZUXU 2JRJA 5D1KB 2ECVA 3N9QA 3U5NA 5TDWA 2ECTA 3FAOA 5LKZA 4NN2A 3ZPVE 1WEOA 1JOCA 2RR4A 4F1PA 3O33A 5H9MA 2IQJA 2KWNA 2M85A 1WEVA 5G05B 2ZETC 5SVIB 3LQIA 5B75A 3O37A 2EXUA 4F52B 4Q6FA 5AIUA 2OWAA 2LN0A 3MDBC 1WESA 4LADB 2ECGA 4R2YA 1WEPA 4S3OC 4FK5A 2MUMA 4QF3A 1FBVA 4R8PK 3HCUA 2K17A 2LAUA 1HYJA 1WFKA 2FUUA 4IC2A 1WIMA 2KIZA 5FB0A 1LDJB 1RMDA 4ZDTA 2NAAA 3FANA 3FM8C 4YBTA 4XI1A 3SOWA 3N9OA 5C13A 2HYED 1LDKC 2XP0A 2BAYA 2L75A 4LJNA 2CSVA 5G04B 5G0FA 2AN6A 3Q1DA 4N3WA 3EB5A 4UP5A 2LGLA 5KH7A 3V43A 2FFWA 2LRIC 3GL6A 4YBSA 4A0CD 2XB1A 2YU4A 2YQLA 1CHCA 3LQHA 4FJCA 5DINA 1BORA 1WEMA 2B0OE 2YYRA 3LVQE 4Z0RA 4YAXA 3SOUA 1Z60A 1WEWA 2M6MA 5DKAA 2C2LA 3FJUB 4O64A 1F62A 2KYUA 1N87A 2MD7B 4H9DA 5C11A 5FERA 1MM2A 3E2DA 4V3LC 2CONA 2KU3A 4WZ3B 4PPEA 2ECNA 2YW8A 1T1HA 4I7DA 1FP0A 3LVRE 3KDEC 4TKPB 2IDAA 2EGPA 2HDPA 5H1VA 2E6SA 3JUEA 4PTBA 1MBMA 2VNFA 3N9MA 2YHNA 2YVRA 3O36A 3O47A 2CT2A 1X4IA 2VJFA 2KKXA 5D1LB 4MSXA 2D8UA 4QF2A 4N4FA 2LXPC 2PNXA 4L7XA 2G45A 2VJEA 2YT5A 2F6NA 4L58A 4UI9B 4YADA 4YC9A 3LRQA 4O62A 1WEUA 2YSMA 2Y1MA 4BBQA 5B79A 4WZ2A 5SVXA 2KWJA 5J3XA 5SVYA 2H0DB 2XOYA 2MNZA 3SUBA 1WILA 2ECJA 1U6GB 3O35A 2KR4A 2M1RA 2UZGA 3KV5A 2L43A 2Y43A 5B8DA 4CCGX 2CRRA 4ZQLA 5LKUA 1WEEA 5JG6A 3HCTA 2CSZA 4MVTA 5EYAF 3HCSA 3ZVYA 5H1UA 3O70A 3ZNIA 2CKLA 2KKYA 2MKEA 2VPDA 3M63A 3O7AA 3PUQA 4AP4A 2K1JA 3T9KA 4CA1A 5K3QA 2YSJA 2KFTA 4I7CA 4A49A 3L1XA 1HYIA 4GB0A 2EODA 1E4UA 2YREA 2LGKA 1WGMA 1Z6UA 3L11A 5FEYA 3LDYA 2MA6A 2P57A 2F6JA 3PURA 3QZVA 1V87A 2C2VS 2VPEA 3DQVR 2XEUA 3M62A 2VPGA 2L0BA 2KGGA 2KWKA 4AVXA 3GV4A 5TDRA 5TRBA 1X4UA 4AYCA 2FSAA 5TBNA 4YBMA
chains in the Genus database with same CATH topology
2FD4A 2OWAA 2JM3A 3MDBC 1DCQA 2B0OE 2D8UA 3LVQE 2XOZA 4Z0RA 2XP0A 2YREA 3DWDA 2XOCA 3LJUX 3LDYA 2CSVA 3LVRE 2KKYA 2MKEA 2L7PA 2P57A 3PLWA 2E61A 2RR4A 5SVIA 4F1PA 3KDEC 3DDTA 4OGEA 4Z0OA 2M13A 2LAUA 2IQJA 3FJUB 3H7HA 3JUEA 3Q1DA 2CRRA 4O62A 4OGCA 4QQ4A 3T9KA 3M7KA 4H9DA 5SVIB 5K3QA 3E2DA 2FFWA 5SVXA 5SVYA 2JUNA 2YVRA 2EXUA 2CONA 2XOYA 2EGMA 3O47A 3FEHA 2DJAA 3FM8C 3SUBA 2KKXA 2CRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP0 A;  2XOY A;  2XOZ A;  2XOC A; 
#chains in the Genus database with same CATH topology
 2FD4 A;  2JMD A;  2OXQ C;  5B76 A;  3KV6 A;  5KH9 A;  2EA6 A;  1Z2Q A;  3ZTG A;  2DX8 A;  2LV9 A;  2L7P A;  2YUC A;  2VJF B;  3LQJ A;  2LGV A;  4YAT A;  3N9N A;  2YUR A;  2M13 A;  3T7L A;  2Y1N A;  2G6Q A;  3EB6 A;  3PHD A;  2K4D A;  3N9P A;  4GNE A;  1XWH A;  2VJE B;  4WA6 A;  2PUY A;  5D1M B;  4LKA A;  3RPG C;  3KQI A;  5LKT A;  2CRW A;  2VPB A;  2MIQ A;  3C6W A;  3ZPV 1;  2RI7 A;  3HTK C;  4AUQ B;  2LXH C;  1JM7 A;  2KWO A;  1VYX A;  3VK6 A;  4YAB A;  4B86 C;  5H1T A;  1IYM A;  2FUI A;  2VP7 A;  3O34 A;  4C9Z A;  4LK9 A;  2JUN A;  1WEN A;  2MT5 A;  4A4C A;  2F42 A;  3FEH A;  3MHH A;  2JM3 A;  1DCQ A;  2M3H A;  3L1Z B;  5B78 A;  2G43 A;  2QIZ A;  3RTR B;  2XOC A;  3IHP A;  3KNV A;  3NG2 A;  4P5O B;  2K16 A;  2JMI A;  3DDT A;  4LLB A;  2MD8 C;  3I2D A;  3ZVZ B;  3M7K A;  4IC3 A;  2LQ6 A;  2CKL B;  3U5P A;  1MM3 A;  2ECI A;  3M99 A;  2EGM A;  4A4B A;  2DJA A;  3DPL R;  2LGG A;  4X3G A;  2D8S A;  3RPG B;  5SVI A;  5B77 A;  2YHO A;  1VFY A;  2L5U A;  2H0D A;  2ECW A;  1WE9 A;  4OGC A;  4WZ0 A;  5KH3 A;  3SOX A;  2DSM A;  1X4J A;  2CSY A;  4UP0 A;  3N9L A;  4FO9 A;  5I3L A;  4B7Y C;  2MNY A;  3ASL A;  3C5K A;  2QIC A;  3MHS A;  2XOZ A;  2KRE A;  4V3K C;  3ZYQ A;  1VD4 A;  4AYC B;  1K2F A;  2JMJ A;  3U5O A;  3PLW A;  2RSD A;  4W4U A;  3T6R A;  2QJ0 A;  2E6R A;  5LCW B;  3FL2 A;  1G25 A;  4GND A;  5TAB A;  2MA5 A;  3DWD A;  3LJU X;  2LDR A;  4GNG A;  5FB1 A;  4Z0O A;  4S3O B;  2KGI A;  1JM7 B;  2KE1 A;  5LKX A;  2I50 A;  2YQM A;  4I7B A;  5AIT A;  2L80 A;  1DVP A;  2E61 A;  3SHB A;  4OGE A;  4BHW A;  1WEQ A;  4FIP A;  4GNF A;  3U5M A;  4QQ4 A;  3H7H A;  1ZBD B;  4R7E A;  4ZUX U;  2JRJ A;  5D1K B;  2ECV A;  3N9Q A;  3U5N A;  5TDW A;  2ECT A;  3FAO A;  5LKZ A;  4NN2 A;  3ZPV E;  1WEO A;  1JOC A;  2RR4 A;  4F1P A;  3O33 A;  5H9M A;  2IQJ A;  2KWN A;  2M85 A;  1WEV A;  5G05 B;  2ZET C;  5SVI B;  3LQI A;  5B75 A;  3O37 A;  2EXU A;  4F52 B;  4Q6F A;  5AIU A;  2OWA A;  2LN0 A;  3MDB C;  1WES A;  4LAD B;  2ECG A;  4R2Y A;  1WEP A;  4S3O C;  4FK5 A;  2MUM A;  4QF3 A;  1FBV A;  4R8P K;  3HCU A;  2K17 A;  2LAU A;  1HYJ A;  1WFK A;  2FUU A;  4IC2 A;  1WIM A;  2KIZ A;  5FB0 A;  1LDJ B;  1RMD A;  4ZDT A;  2NAA A;  3FAN A;  3FM8 C;  4YBT A;  4XI1 A;  3SOW A;  3N9O A;  5C13 A;  2HYE D;  1LDK C;  2XP0 A;  2BAY A;  2L75 A;  4LJN A;  2CSV A;  5G04 B;  5G0F A;  2AN6 A;  3Q1D A;  4N3W A;  3EB5 A;  4UP5 A;  2LGL A;  5KH7 A;  3V43 A;  2FFW A;  2LRI C;  3GL6 A;  4YBS A;  4A0C D;  2XB1 A;  2YU4 A;  2YQL A;  1CHC A;  3LQH A;  4FJC A;  5DIN A;  1BOR A;  1WEM A;  2B0O E;  2YYR A;  3LVQ E;  4Z0R A;  4YAX A;  3SOU A;  1Z60 A;  1WEW A;  2M6M A;  5DKA A;  2C2L A;  3FJU B;  4O64 A;  1F62 A;  2KYU A;  1N87 A;  2MD7 B;  4H9D A;  5C11 A;  5FER A;  1MM2 A;  3E2D A;  4V3L C;  2CON A;  2KU3 A;  4WZ3 B;  4PPE A;  2ECN A;  2YW8 A;  1T1H A;  4I7D A;  1FP0 A;  3LVR E;  3KDE C;  4TKP B;  2IDA A;  2EGP A;  2HDP A;  5H1V A;  2E6S A;  3JUE A;  4PTB A;  1MBM A;  2VNF A;  3N9M A;  2YHN A;  2YVR A;  3O36 A;  3O47 A;  2CT2 A;  1X4I A;  2VJF A;  2KKX A;  5D1L B;  4MSX A;  2D8U A;  4QF2 A;  4N4F A;  2LXP C;  2PNX A;  4L7X A;  2G45 A;  2VJE A;  2YT5 A;  2F6N A;  4L58 A;  4UI9 B;  4YAD A;  4YC9 A;  3LRQ A;  4O62 A;  1WEU A;  2YSM A;  2Y1M A;  4BBQ A;  5B79 A;  4WZ2 A;  5SVX A;  2KWJ A;  5J3X A;  5SVY A;  2H0D B;  2XOY A;  2MNZ A;  3SUB A;  1WIL A;  2ECJ A;  1U6G B;  3O35 A;  2KR4 A;  2M1R A;  2UZG A;  3KV5 A;  2L43 A;  2Y43 A;  5B8D A;  4CCG X;  2CRR A;  4ZQL A;  5LKU A;  1WEE A;  5JG6 A;  3HCT A;  2CSZ A;  4MVT A;  5EYA F;  3HCS A;  3ZVY A;  5H1U A;  3O70 A;  3ZNI A;  2CKL A;  2KKY A;  2MKE A;  2VPD A;  3M63 A;  3O7A A;  3PUQ A;  4AP4 A;  2K1J A;  3T9K A;  4CA1 A;  5K3Q A;  2YSJ A;  2KFT A;  4I7C A;  4A49 A;  3L1X A;  1HYI A;  4GB0 A;  2EOD A;  1E4U A;  2YRE A;  2LGK A;  1WGM A;  1Z6U A;  3L11 A;  5FEY A;  3LDY A;  2MA6 A;  2P57 A;  2F6J A;  3PUR A;  3QZV A;  1V87 A;  2C2V S;  2VPE A;  3DQV R;  2XEU A;  3M62 A;  2VPG A;  2L0B A;  2KGG A;  2KWK A;  4AVX A;  3GV4 A;  5TDR A;  5TRB A;  1X4U A;  4AYC A;  2FSA A;  5TBN A;  4YBM A; 
#chains in the Genus database with same CATH homology
 2FD4 A;  2OWA A;  2JM3 A;  3MDB C;  1DCQ A;  2B0O E;  2D8U A;  3LVQ E;  2XOZ A;  4Z0R A;  2XP0 A;  2YRE A;  3DWD A;  2XOC A;  3LJU X;  3LDY A;  2CSV A;  3LVR E;  2KKY A;  2MKE A;  2L7P A;  2P57 A;  3PLW A;  2E61 A;  2RR4 A;  5SVI A;  4F1P A;  3KDE C;  3DDT A;  4OGE A;  4Z0O A;  2M13 A;  2LAU A;  2IQJ A;  3FJU B;  3H7H A;  3JUE A;  3Q1D A;  2CRR A;  4O62 A;  4OGC A;  4QQ4 A;  3T9K A;  3M7K A;  4H9D A;  5SVI B;  5K3Q A;  3E2D A;  2FFW A;  5SVX A;  5SVY A;  2JUN A;  2YVR A;  2EXU A;  2CON A;  2XOY A;  2EGM A;  3O47 A;  3FEH A;  2DJA A;  3FM8 C;  3SUB A;  2KKX A;  2CRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...