2XOCA

C-terminal cysteine-rich domain of human chfr bound to madpr
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
240
structure length
213
Chain Sequence
PYVVCRQCPEYRRQAAQPPHCPDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE CHFR
publication title Structural Basis of Poly(Adp-Ribose) Recognition by the Multizinc Binding Domain of Checkpoint with Forkhead-Associated and Ring Domains (Chfr).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 64
structure length 213
sequence length 240
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10283 zf-CCHH PBZ domain
A PF17979 zf-CRD Cysteine rich domain with multizinc binding regions
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.140 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2xocA01
2XOYA 2XOZA 2XP0A 2XOCA
chains in the Genus database with same CATH superfamily
3SOUA 3FJUB 1DVPA 2KIZA 1WGMA 1VD4A 2VPEA 3DWDA 1X4IA 2YU4A 4C9ZA 1K2FA 2D8UA 4H9DA 4AP4A 2YHOA 5B8DA 2BAYA 2KWJA 2HDPA 2MUMA 2UZGA 1BORA 1WESA 2VJEA 2FUIA 2KGGA 1Z60A 1RMDA 3PUQA 2CT2A 2LXHC 2YURA 5LKTA 3N9PA 3O47A 3N9MA 2JMDA 4WZ3B 1WEVA 1IYMA 1V87A 5D1MB 2M1RA 5DKAA 3EB5A 5KH7A 4O64A 1WEOA 5J3XA 3O33A 1X4JA 2FSAA 5TDWA 3FL2A 2DSMA 3O36A 3LVQE 3PURA 4IC3A 1JM7B 2XOCA 2YHNA 4L58A 2ECGA 3M7KA 4YC9A 3RPGC 4OGCA 4R7EA 4F1PA 2Y1MA 2ECTA 2KKYA 5TABA 2RI7A 2JMIA 3LQJA 2RR4A 4FK5A 3U5NA 2K17A 5TBNA 1Z2QA 2KGIA 2F6JA 1WEWA 1HYIA 4Z0OA 5LKUA 5H1TA 2E6SA 2VNFA 1FP0A 4GB0A 4W4UA 1WEUA 3O37A 3I2DA 5KH9A 1Z6UA 2KR4A 3N9OA 2KREA 2KWKA 3ZYQA 3ZTGA 1WIMA 4ZUXU 5B76A 4YABA 4OGEA 3LDYA 2ECVA 3T7LA 4AYCA 1WILA 4N3WA 2IDAA 2B0OE 2XOZA 3LQIA 3LVRE 4A49A 2YQLA 2YYRA 1CHCA 2L5UA 5B75A 1WENA 3MHSA 2VJFB 2KWNA 2LQ6A 2YUCA 2CRWA 2VPDA 3L1ZB 5K3QA 3VK6A 4TKPB 2I50A 4UP0A 3SOXA 3MDBC 2K16A 2DJAA 5B78A 5FERA 3GV4A 1LDKC 3SUBA 2E61A 4YBSA 2KYUA 5TDRA 3HTKC 3DDTA 1MM3A 4A4BA 4LKAA 5D1LB 2MIQA 2PNXA 4XI1A 5H1VA 4YBTA 1MM2A 2ECJA 2MNYA 5SVIB 1WEPA 2L7PA 2KE1A 4LADB 2XOYA 3ZVZB 2IQJA 3MHHA 5B77A 1X4UA 2KWOA 3M62A 2M3HA 2G43A 4YAXA 1VFYA 1XWHA 2K1JA 2M6MA 2MD7B 5LCWB 2L43A 3DPLR 2QJ0A 2YW8A 4L7XA 3ZVYA 2E6RA 4CA1A 4QQ4A 3T9KA 4BHWA 4YBMA 2P57A 4S3OB 3L1XA 3L11A 1VYXA 4I7CA 4F52B 4I7DA 4AVXA 3FEHA 2JMJA 2JUNA 2PUYA 3PLWA 3GL6A 3O34A 2KU3A 3EB6A 4QF2A 2XEUA 3M63A 4WZ0A 2LGGA 3PHDA 3H7HA 2L75A 2MT5A 2Y43A 1HYJA 4ZDTA 3T6RA 3RTRB 4QF3A 1ZBDB 5B79A 2YQMA 5G04B 4X3GA 5AITA 2G6QA 3HCUA 2CKLB 1E4UA 1WE9A 3ZNIA 2LN0A 2H0DB 4GNGA 4IC2A 4MVTA 1FBVA 2L0BA 3KQIA 3NG2A 3O70A 1N87A 3ASLA 2D8SA 4FO9A 2OXQC 4B86C 2FFWA 5D1KB 2FD4A 5I3LA 1WEMA 2G45A 3KNVA 4LK9A 3FAOA 4A4CA 2EXUA 1MBMA 2FUUA 3U5OA 2HYED 2MA6A 3KDEC 1U6GB 2EODA 5G0FA 4PTBA 2QIZA 2LXPC 2CRRA 3Q1DA 2LAUA 3E2DA 4CCGX 5AIUA 4PPEA 4MSXA 3FANA 3JUEA 2XB1A 3HCTA 2VJEB 2VP7A 4UP5A 5G05B 4YADA 1T1HA 3N9QA 4V3KC 3LRQA 4Q6FA 3RPGB 4WA6A 4WZ2A 4AUQB 2CSZA 2YT5A 5LKZA 5KH3A 4A0CD 2LGKA 3LJUX 3C6WA 5SVYA 2DX8A 5SVIA 3C5KA 5DINA 5EYAF 1WEEA 2K4DA 2YSMA 2KKXA 3ZPV1 5JG6A 2CSYA 3HCSA 2LDRA 1LDJB 4N4FA 2ECNA 2AN6A 5C13A 3DQVR 2CONA 1G25A 2LV9A 4GNDA 3KV6A 2JM3A 2XP0A 3QZVA 4LJNA 5SVXA 2NAAA 4Z0RA 5TRBA 2QICA 2Y1NA 4P5OB 1JM7A 2JRJA 3M99A 5H9MA 2C2LA 2VPGA 4I7BA 1DCQA 4B7YC 3KV5A 4FIPA 2L80A 2M13A 4FJCA 3V43A 3IHPA 2CSVA 2EGPA 2LGLA 4GNFA 4R2YA 2MNZA 2YVRA 5C11A 1WEQA 4AYCB 2VPBA 5FEYA 2F42A 4S3OC 3N9LA 5LKXA 2YSJA 4GNEA 1JOCA 2CKLA 2ECWA 5FB0A 3ZPVE 5FB1A 2MD8C 2H0DA 3FM8C 3U5MA 2MKEA 3LQHA 1F62A 4LLBA 4V3LC 2MA5A 2EA6A 4BBQA 4YATA 2ECIA 2F6NA 2M85A 2ZETC 2C2VS 2KFTA 3O7AA 2LRIC 1WFKA 3SOWA 2VJFA 2RSDA 4O62A 4ZQLA 2OWAA 5H1UA 3U5PA 3N9NA 4NN2A 4UI9B 3SHBA 3O35A 2EGMA 2LGVA 2YREA 4R8PK
chains in the Genus database with same CATH topology
2XOYA 2LAUA 3M7KA 2B0OE 2XOZA 2IQJA 3FJUB 3LVRE 3O47A 3SUBA 4Z0OA 2E61A 2KKXA 4OGCA 4F1PA 2EXUA 1DCQA 3DWDA 3FEHA 2JUNA 2YREA 2KKYA 3DDTA 2D8UA 3E2DA 3PLWA 2CRWA 2M13A 4O62A 3KDEC 4H9DA 3JUEA 2CONA 2OWAA 3LJUX 2RR4A 5K3QA 5SVYA 3FM8C 3LVQE 2CSVA 3H7HA 2MKEA 2JM3A 3MDBC 2YVRA 2XP0A 5SVIB 2FFWA 2EGMA 5SVXA 4QQ4A 4OGEA 5SVIA 2DJAA 3T9KA 3LDYA 2L7PA 2P57A 4Z0RA 2CRRA 2XOCA 3Q1DA 2FD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOY A;  2XOZ A;  2XP0 A;  2XOC A; 
#chains in the Genus database with same CATH topology
 3SOU A;  3FJU B;  1DVP A;  2KIZ A;  1WGM A;  1VD4 A;  2VPE A;  3DWD A;  1X4I A;  2YU4 A;  4C9Z A;  1K2F A;  2D8U A;  4H9D A;  4AP4 A;  2YHO A;  5B8D A;  2BAY A;  2KWJ A;  2HDP A;  2MUM A;  2UZG A;  1BOR A;  1WES A;  2VJE A;  2FUI A;  2KGG A;  1Z60 A;  1RMD A;  3PUQ A;  2CT2 A;  2LXH C;  2YUR A;  5LKT A;  3N9P A;  3O47 A;  3N9M A;  2JMD A;  4WZ3 B;  1WEV A;  1IYM A;  1V87 A;  5D1M B;  2M1R A;  5DKA A;  3EB5 A;  5KH7 A;  4O64 A;  1WEO A;  5J3X A;  3O33 A;  1X4J A;  2FSA A;  5TDW A;  3FL2 A;  2DSM A;  3O36 A;  3LVQ E;  3PUR A;  4IC3 A;  1JM7 B;  2XOC A;  2YHN A;  4L58 A;  2ECG A;  3M7K A;  4YC9 A;  3RPG C;  4OGC A;  4R7E A;  4F1P A;  2Y1M A;  2ECT A;  2KKY A;  5TAB A;  2RI7 A;  2JMI A;  3LQJ A;  2RR4 A;  4FK5 A;  3U5N A;  2K17 A;  5TBN A;  1Z2Q A;  2KGI A;  2F6J A;  1WEW A;  1HYI A;  4Z0O A;  5LKU A;  5H1T A;  2E6S A;  2VNF A;  1FP0 A;  4GB0 A;  4W4U A;  1WEU A;  3O37 A;  3I2D A;  5KH9 A;  1Z6U A;  2KR4 A;  3N9O A;  2KRE A;  2KWK A;  3ZYQ A;  3ZTG A;  1WIM A;  4ZUX U;  5B76 A;  4YAB A;  4OGE A;  3LDY A;  2ECV A;  3T7L A;  4AYC A;  1WIL A;  4N3W A;  2IDA A;  2B0O E;  2XOZ A;  3LQI A;  3LVR E;  4A49 A;  2YQL A;  2YYR A;  1CHC A;  2L5U A;  5B75 A;  1WEN A;  3MHS A;  2VJF B;  2KWN A;  2LQ6 A;  2YUC A;  2CRW A;  2VPD A;  3L1Z B;  5K3Q A;  3VK6 A;  4TKP B;  2I50 A;  4UP0 A;  3SOX A;  3MDB C;  2K16 A;  2DJA A;  5B78 A;  5FER A;  3GV4 A;  1LDK C;  3SUB A;  2E61 A;  4YBS A;  2KYU A;  5TDR A;  3HTK C;  3DDT A;  1MM3 A;  4A4B A;  4LKA A;  5D1L B;  2MIQ A;  2PNX A;  4XI1 A;  5H1V A;  4YBT A;  1MM2 A;  2ECJ A;  2MNY A;  5SVI B;  1WEP A;  2L7P A;  2KE1 A;  4LAD B;  2XOY A;  3ZVZ B;  2IQJ A;  3MHH A;  5B77 A;  1X4U A;  2KWO A;  3M62 A;  2M3H A;  2G43 A;  4YAX A;  1VFY A;  1XWH A;  2K1J A;  2M6M A;  2MD7 B;  5LCW B;  2L43 A;  3DPL R;  2QJ0 A;  2YW8 A;  4L7X A;  3ZVY A;  2E6R A;  4CA1 A;  4QQ4 A;  3T9K A;  4BHW A;  4YBM A;  2P57 A;  4S3O B;  3L1X A;  3L11 A;  1VYX A;  4I7C A;  4F52 B;  4I7D A;  4AVX A;  3FEH A;  2JMJ A;  2JUN A;  2PUY A;  3PLW A;  3GL6 A;  3O34 A;  2KU3 A;  3EB6 A;  4QF2 A;  2XEU A;  3M63 A;  4WZ0 A;  2LGG A;  3PHD A;  3H7H A;  2L75 A;  2MT5 A;  2Y43 A;  1HYJ A;  4ZDT A;  3T6R A;  3RTR B;  4QF3 A;  1ZBD B;  5B79 A;  2YQM A;  5G04 B;  4X3G A;  5AIT A;  2G6Q A;  3HCU A;  2CKL B;  1E4U A;  1WE9 A;  3ZNI A;  2LN0 A;  2H0D B;  4GNG A;  4IC2 A;  4MVT A;  1FBV A;  2L0B A;  3KQI A;  3NG2 A;  3O70 A;  1N87 A;  3ASL A;  2D8S A;  4FO9 A;  2OXQ C;  4B86 C;  2FFW A;  5D1K B;  2FD4 A;  5I3L A;  1WEM A;  2G45 A;  3KNV A;  4LK9 A;  3FAO A;  4A4C A;  2EXU A;  1MBM A;  2FUU A;  3U5O A;  2HYE D;  2MA6 A;  3KDE C;  1U6G B;  2EOD A;  5G0F A;  4PTB A;  2QIZ A;  2LXP C;  2CRR A;  3Q1D A;  2LAU A;  3E2D A;  4CCG X;  5AIU A;  4PPE A;  4MSX A;  3FAN A;  3JUE A;  2XB1 A;  3HCT A;  2VJE B;  2VP7 A;  4UP5 A;  5G05 B;  4YAD A;  1T1H A;  3N9Q A;  4V3K C;  3LRQ A;  4Q6F A;  3RPG B;  4WA6 A;  4WZ2 A;  4AUQ B;  2CSZ A;  2YT5 A;  5LKZ A;  5KH3 A;  4A0C D;  2LGK A;  3LJU X;  3C6W A;  5SVY A;  2DX8 A;  5SVI A;  3C5K A;  5DIN A;  5EYA F;  1WEE A;  2K4D A;  2YSM A;  2KKX A;  3ZPV 1;  5JG6 A;  2CSY A;  3HCS A;  2LDR A;  1LDJ B;  4N4F A;  2ECN A;  2AN6 A;  5C13 A;  3DQV R;  2CON A;  1G25 A;  2LV9 A;  4GND A;  3KV6 A;  2JM3 A;  2XP0 A;  3QZV A;  4LJN A;  5SVX A;  2NAA A;  4Z0R A;  5TRB A;  2QIC A;  2Y1N A;  4P5O B;  1JM7 A;  2JRJ A;  3M99 A;  5H9M A;  2C2L A;  2VPG A;  4I7B A;  1DCQ A;  4B7Y C;  3KV5 A;  4FIP A;  2L80 A;  2M13 A;  4FJC A;  3V43 A;  3IHP A;  2CSV A;  2EGP A;  2LGL A;  4GNF A;  4R2Y A;  2MNZ A;  2YVR A;  5C11 A;  1WEQ A;  4AYC B;  2VPB A;  5FEY A;  2F42 A;  4S3O C;  3N9L A;  5LKX A;  2YSJ A;  4GNE A;  1JOC A;  2CKL A;  2ECW A;  5FB0 A;  3ZPV E;  5FB1 A;  2MD8 C;  2H0D A;  3FM8 C;  3U5M A;  2MKE A;  3LQH A;  1F62 A;  4LLB A;  4V3L C;  2MA5 A;  2EA6 A;  4BBQ A;  4YAT A;  2ECI A;  2F6N A;  2M85 A;  2ZET C;  2C2V S;  2KFT A;  3O7A A;  2LRI C;  1WFK A;  3SOW A;  2VJF A;  2RSD A;  4O62 A;  4ZQL A;  2OWA A;  5H1U A;  3U5P A;  3N9N A;  4NN2 A;  4UI9 B;  3SHB A;  3O35 A;  2EGM A;  2LGV A;  2YRE A;  4R8P K; 
#chains in the Genus database with same CATH homology
 2XOY A;  2LAU A;  3M7K A;  2B0O E;  2XOZ A;  2IQJ A;  3FJU B;  3LVR E;  3O47 A;  3SUB A;  4Z0O A;  2E61 A;  2KKX A;  4OGC A;  4F1P A;  2EXU A;  1DCQ A;  3DWD A;  3FEH A;  2JUN A;  2YRE A;  2KKY A;  3DDT A;  2D8U A;  3E2D A;  3PLW A;  2CRW A;  2M13 A;  4O62 A;  3KDE C;  4H9D A;  3JUE A;  2CON A;  2OWA A;  3LJU X;  2RR4 A;  5K3Q A;  5SVY A;  3FM8 C;  3LVQ E;  2CSV A;  3H7H A;  2MKE A;  2JM3 A;  3MDB C;  2YVR A;  2XP0 A;  5SVI B;  2FFW A;  2EGM A;  5SVX A;  4QQ4 A;  4OGE A;  5SVI A;  2DJA A;  3T9K A;  3LDY A;  2L7P A;  2P57 A;  4Z0R A;  2CRR A;  2XOC A;  3Q1D A;  2FD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...