2I50A

Solution structure of ubp-m znf-ubp domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
PVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 16
publication title Solution structure of the Ubp-M BUZ domain, a highly specific protein module that recognizes the C-terminal tail of free ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 122
sequence length 122
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2i50A00
3EB5A 5EYAF 4AYCB 5H9MA 3O33A 2F6JA 1WEWA 4YC9A 4AUQB 2F42A 3RPGB 4FIPA 2VPBA 3ZYQA 2KYUA 4Q6FA 3O34A 4NN2A 5LCWB 2CSZA 2KFTA 3IHPA 1WEEA 5KH3A 1WFKA 5LKUA 2G6QA 2L0BA 1FBVA 3LQIA 4LK9A 2MT5A 2HYED 4UP0A 2K16A 5TBNA 2CKLB 2CT2A 3RTRB 2QICA 4GNFA 3LRQA 4WZ2A 3V43A 2KGGA 3RPGC 4R8PK 3N9LA 3DPLR 3N9OA 3O36A 4LKAA 4YATA 1MM2A 2ECWA 4IC3A 3VK6A 2G43A 4WZ0A 2H0DB 3PURA 3PUQA 2C2VS 2KE1A 1XWHA 4FK5A 2LRIC 4O64A 4S3OB 4L58A 1Z60A 5B77A 2ZETC 1LDKC 1LDJB 4GNGA 4XI1A 4N4FA 2JRJA 2LGLA 1WENA 1JOCA 5B78A 2YHOA 5DINA 5G0FA 4YAXA 2EODA 5TDRA 2VJEB 3LQHA 3L11A 2KR4A 3MHHA 4TKPB 1WE9A 2FSAA 2G45A 5I3LA 2H0DA 3EB6A 4IC2A 5B75A 2KGIA 2RSDA 2MIQA 2OXQC 3N9QA 4PTBA 4YBSA 4R7EA 1G25A 3U5OA 2MUMA 4X3GA 5D1KB 2MD7B 4W4UA 4FO9A 4I7DA 3NG2A 3M63A 4S3OC 1VD4A 2VJFA 3MHSA 5KH9A 2VJEA 1BORA 1WGMA 1V87A 3O37A 1ZBDB 2L75A 2VPGA 2YT5A 2MNZA 3HCUA 5FEYA 4BBQA 5G04B 1N87A 1VYXA 4FJCA 1F62A 3N9PA 3LQJA 2JMJA 2M85A 4AYCA 1Z2QA 2ECNA 2M3HA 3ZVYA 2YQMA 4WZ3B 4YADA 2K17A 2RI7A 3GL6A 1X4IA 3HTKC 3T7LA 2YYRA 2HDPA 4QF3A 1DVPA 2VNFA 2KWKA 5FB1A 2MD8C 4WA6A 2L80A 4A49A 1HYIA 1WEQA 2ECGA 2K1JA 1FP0A 4I7BA 2Y1NA 2LDRA 3FL2A 2FUUA 2E6SA 5TABA 2YHNA 2KU3A 2PNXA 4YBTA 4N3WA 4F52B 3HCSA 1IYMA 4GB0A 2DX8A 4C9ZA 3O35A 2CKLA 2YREA 2XEUA 3L1XA 3C6WA 5D1MB 3GV4A 2BAYA 5B8DA 3KV5A 3ZNIA 3T6RA 2YU4A 5TRBA 5AIUA 4L7XA 4MVTA 3PHDA 3SOUA 5AITA 4LLBA 3U5PA 2UZGA 1WEMA 4I7CA 4MSXA 4LJNA 2LGKA 2Y1MA 2LGGA 1X4UA 2L43A 3ZPV1 3I2DA 1WESA 1WEVA 2ECVA 2LXHC 3O70A 3ASLA 5KH7A 2MA6A 2MNYA 3QZVA 2YW8A 5B79A 2FUIA 4A0CD 5G05B 2KWOA 2EA6A 2YSMA 4GNDA 2YURA 5B76A 2LN0A 5C13A 1K2FA 3KNVA 2Y43A 5H1VA 3SOXA 2VPEA 3M99A 4YBMA 4LADB 1T1HA 2LXPC 1JM7B 1X4JA 5FERA 2PUYA 2CSYA 1WEOA 2JMIA 3U5MA 4A4BA 1WEPA 1CHCA 2IDAA 5C11A 3M62A 1Z6UA 4CA1A 3SHBA 5LKZA 2KREA 2LGVA 4ZDTA 4GNEA 4R2YA 3ZVZB 2KIZA 2D8SA 1VFYA 2LV9A 5H1TA 3O7AA 2YSJA 1RMDA 4YABA 3KQIA 5H1UA 2VP7A 1JM7A 1WILA 2F6NA 4P5OB 2KWNA 5JG6A 1WEUA 4CCGX 1HYJA 5D1LB 3N9NA 5TDWA 3DQVR 3HCTA 2YQLA 2KWJA 4V3LC 2EGPA 4BHWA 1WIMA 4PPEA 5DKAA 2I50A 2JMDA 3ZTGA 2VPDA 2ECIA 2ECJA 2K4DA 5FB0A 3KV6A 3L1ZB 3C5KA 5LKTA 3N9MA 1MM3A 4ZUXU 2MA5A 4B86C 5J3XA 3ZPVE 4ZQLA 4AVXA 2ECTA 3SOWA 2AN6A 2M1RA 2VJFB 4QF2A 2QIZA 4UP5A 2M6MA 2QJ0A 4V3KC 2C2LA 2LQ6A 2XB1A 2NAAA 2L5UA 5LKXA 4A4CA 2YUCA 1E4UA 2E6RA 4AP4A 4UI9B 4B7YC 1U6GB 3U5NA
chains in the Genus database with same CATH superfamily
3EB5A 5K3QA 5EYAF 4AYCB 5H9MA 3O33A 2JM3A 3LDYA 2F6JA 1WEWA 4YC9A 5SVXA 3O47A 4AUQB 2F42A 3RPGB 3DDTA 4FIPA 2VPBA 3ZYQA 2XP0A 2KYUA 4Q6FA 3O34A 4NN2A 5LCWB 2CSZA 2KFTA 3FJUB 2XOCA 3SUBA 3IHPA 1WEEA 5KH3A 2DSMA 1WFKA 5LKUA 2G6QA 2L0BA 1FBVA 3LQIA 3T9KA 5SVYA 4LK9A 2JUNA 2MT5A 2HYED 4UP0A 2K16A 5TBNA 2CKLB 2CT2A 3RTRB 2QICA 4GNFA 3LRQA 3FAOA 4WZ2A 3V43A 2KGGA 3RPGC 1DCQA 3N9LA 4R8PK 3DPLR 3N9OA 3O36A 4LKAA 4YATA 4F1PA 1MM2A 2ECWA 4IC3A 3VK6A 2G43A 4WZ0A 2H0DB 3PURA 3PUQA 1MBMA 2C2VS 2KE1A 2KKXA 1XWHA 4FK5A 2LRIC 4O64A 4L58A 4S3OB 1Z60A 5B77A 2ZETC 1LDKC 1LDJB 4GNGA 4XI1A 4N4FA 2IQJA 2JRJA 2LGLA 1WENA 1JOCA 5B78A 2YHOA 5DINA 2EODA 4YAXA 5G0FA 5TDRA 2VJEB 2M13A 3LQHA 3L11A 3FANA 2KR4A 3MHHA 4TKPB 3H7HA 1WE9A 2FSAA 2G45A 5I3LA 2H0DA 3EB6A 4IC2A 5B75A 2KGIA 3FM8C 2RSDA 2MIQA 2OXQC 3N9QA 4PTBA 4YBSA 4R7EA 1G25A 3U5OA 4OGCA 2CRWA 2MUMA 4X3GA 5D1KB 2MD7B 3KDEC 4W4UA 4FO9A 4I7DA 2EGMA 3NG2A 3M63A 4S3OC 1VD4A 2VJFA 3MHSA 5KH9A 2VJEA 1BORA 1WGMA 1V87A 3O37A 1ZBDB 2L75A 2VPGA 2YT5A 2CSVA 2CONA 2MNZA 3HCUA 5FEYA 4BBQA 5G04B 1N87A 3JUEA 1VYXA 4FJCA 1F62A 3N9PA 4O62A 3LQJA 2JMJA 2M85A 4AYCA 1Z2QA 2ECNA 2M3HA 3ZVYA 2YQMA 2D8UA 4WZ3B 4YADA 2K17A 2RI7A 3GL6A 2YVRA 1X4IA 3HTKC 3LVQE 3T7LA 2YYRA 2HDPA 3M7KA 4QF3A 1DVPA 2VNFA 2KWKA 5FB1A 2MD8C 4WA6A 2L80A 4A49A 1HYIA 2FFWA 1WEQA 2ECGA 2K1JA 1FP0A 4I7BA 2P57A 2Y1NA 2LDRA 3FL2A 2FUUA 2E6SA 5TABA 2YHNA 2KU3A 2PNXA 4YBTA 4N3WA 4F52B 3HCSA 1IYMA 4GB0A 2DX8A 4C9ZA 3O35A 2CKLA 2YREA 2XEUA 3L1XA 3C6WA 5D1MB 3GV4A 2BAYA 5B8DA 3KV5A 3ZNIA 3T6RA 2YU4A 5TRBA 2KKYA 5AIUA 3FEHA 4L7XA 4MVTA 3PHDA 3SOUA 2OWAA 5AITA 4LLBA 3U5PA 2UZGA 1WEMA 4I7CA 4MSXA 4LJNA 2DJAA 2LGKA 2Y1MA 2LGGA 1X4UA 2L43A 2XOZA 3ZPV1 3I2DA 1WESA 1WEVA 2ECVA 2LXHC 3O70A 3ASLA 5KH7A 2MA6A 2MNYA 3QZVA 2YW8A 2XOYA 5B79A 2FUIA 4A0CD 5G05B 2KWOA 2EA6A 2YSMA 4GNDA 2YURA 5B76A 2LN0A 5C13A 1K2FA 3KNVA 2EXUA 2Y43A 5H1VA 3SOXA 2VPEA 3M99A 4YBMA 3DWDA 4LADB 1T1HA 2LXPC 2MKEA 1JM7B 1X4JA 5FERA 2PUYA 2CSYA 1WEOA 2JMIA 3U5MA 2E61A 4A4BA 1WEPA 1CHCA 2IDAA 2L7PA 5C11A 3E2DA 2LAUA 3M62A 1Z6UA 4CA1A 4QQ4A 3SHBA 5LKZA 2KREA 2LGVA 4ZDTA 4GNEA 4R2YA 3ZVZB 2KIZA 2D8SA 1VFYA 2LV9A 5H1TA 3O7AA 2YSJA 3Q1DA 1RMDA 4YABA 3KQIA 5H1UA 2VP7A 4OGEA 1JM7A 1WILA 2F6NA 4P5OB 2KWNA 4Z0RA 3PLWA 5JG6A 1WEUA 4CCGX 1HYJA 5D1LB 3N9NA 5TDWA 3DQVR 3HCTA 2YQLA 2KWJA 4V3LC 2EGPA 4BHWA 1WIMA 3MDBC 4PPEA 5DKAA 2B0OE 2I50A 2JMDA 3ZTGA 5SVIB 2VPDA 2ECIA 2ECJA 2K4DA 5FB0A 3LVRE 3KV6A 3L1ZB 3C5KA 5LKTA 3N9MA 2CRRA 1MM3A 4ZUXU 2MA5A 4B86C 2FD4A 3LJUX 5J3XA 3ZPVE 2RR4A 4ZQLA 4AVXA 2ECTA 3SOWA 2AN6A 2M1RA 4Z0OA 2VJFB 4QF2A 2QIZA 4UP5A 2M6MA 2QJ0A 4V3KC 2C2LA 2LQ6A 2XB1A 2NAAA 2L5UA 5SVIA 5LKXA 4A4CA 2YUCA 1E4UA 2E6RA 4AP4A 4UI9B 4B7YC 1U6GB 4H9DA 3U5NA
chains in the Genus database with same CATH topology
3EB5A 5EYAF 4AYCB 5H9MA 3O33A 2F6JA 1WEWA 4YC9A 4AUQB 2F42A 3RPGB 4FIPA 2VPBA 3ZYQA 2KYUA 4Q6FA 3O34A 4NN2A 5LCWB 2CSZA 2KFTA 3IHPA 1WEEA 5KH3A 1WFKA 5LKUA 2G6QA 2L0BA 1FBVA 3LQIA 4LK9A 2MT5A 2HYED 4UP0A 2K16A 5TBNA 2CKLB 2CT2A 3RTRB 2QICA 4GNFA 3LRQA 4WZ2A 3V43A 2KGGA 3RPGC 4R8PK 3N9LA 3DPLR 3N9OA 3O36A 4LKAA 4YATA 1MM2A 2ECWA 4IC3A 3VK6A 2G43A 4WZ0A 2H0DB 3PURA 3PUQA 2C2VS 2KE1A 1XWHA 4FK5A 2LRIC 4O64A 4S3OB 4L58A 1Z60A 5B77A 2ZETC 1LDKC 1LDJB 4GNGA 4XI1A 4N4FA 2JRJA 2LGLA 1WENA 1JOCA 5B78A 2YHOA 5DINA 5G0FA 4YAXA 2EODA 5TDRA 2VJEB 3LQHA 3L11A 2KR4A 3MHHA 4TKPB 1WE9A 2FSAA 2G45A 5I3LA 2H0DA 3EB6A 4IC2A 5B75A 2KGIA 2RSDA 2MIQA 2OXQC 3N9QA 4PTBA 4YBSA 4R7EA 1G25A 3U5OA 2MUMA 4X3GA 5D1KB 2MD7B 4W4UA 4FO9A 4I7DA 3NG2A 3M63A 4S3OC 1VD4A 2VJFA 3MHSA 5KH9A 2VJEA 1BORA 1WGMA 1V87A 3O37A 1ZBDB 2L75A 2VPGA 2YT5A 2MNZA 3HCUA 5FEYA 4BBQA 5G04B 1N87A 1VYXA 4FJCA 1F62A 3N9PA 3LQJA 2JMJA 2M85A 4AYCA 1Z2QA 2ECNA 2M3HA 3ZVYA 2YQMA 4WZ3B 4YADA 2K17A 2RI7A 3GL6A 1X4IA 3HTKC 3T7LA 2YYRA 2HDPA 4QF3A 1DVPA 2VNFA 2KWKA 5FB1A 2MD8C 4WA6A 2L80A 4A49A 1HYIA 1WEQA 2ECGA 2K1JA 1FP0A 4I7BA 2Y1NA 2LDRA 3FL2A 2FUUA 2E6SA 5TABA 2YHNA 2KU3A 2PNXA 4YBTA 4N3WA 4F52B 3HCSA 1IYMA 4GB0A 2DX8A 4C9ZA 3O35A 2CKLA 2YREA 2XEUA 3L1XA 3C6WA 5D1MB 3GV4A 2BAYA 5B8DA 3KV5A 3ZNIA 3T6RA 2YU4A 5TRBA 5AIUA 4L7XA 4MVTA 3PHDA 3SOUA 5AITA 4LLBA 3U5PA 2UZGA 1WEMA 4I7CA 4MSXA 4LJNA 2LGKA 2Y1MA 2LGGA 1X4UA 2L43A 3ZPV1 3I2DA 1WESA 1WEVA 2ECVA 2LXHC 3O70A 3ASLA 5KH7A 2MA6A 2MNYA 3QZVA 2YW8A 5B79A 2FUIA 4A0CD 5G05B 2KWOA 2EA6A 2YSMA 4GNDA 2YURA 5B76A 2LN0A 5C13A 1K2FA 3KNVA 2Y43A 5H1VA 3SOXA 2VPEA 3M99A 4YBMA 4LADB 1T1HA 2LXPC 1JM7B 1X4JA 5FERA 2PUYA 2CSYA 1WEOA 2JMIA 3U5MA 4A4BA 1WEPA 1CHCA 2IDAA 5C11A 3M62A 1Z6UA 4CA1A 3SHBA 5LKZA 2KREA 2LGVA 4ZDTA 4GNEA 4R2YA 3ZVZB 2KIZA 2D8SA 1VFYA 2LV9A 5H1TA 3O7AA 2YSJA 1RMDA 4YABA 3KQIA 5H1UA 2VP7A 1JM7A 1WILA 2F6NA 4P5OB 2KWNA 5JG6A 1WEUA 4CCGX 1HYJA 5D1LB 3N9NA 5TDWA 3DQVR 3HCTA 2YQLA 2KWJA 4V3LC 2EGPA 4BHWA 1WIMA 4PPEA 5DKAA 2I50A 2JMDA 3ZTGA 2VPDA 2ECIA 2ECJA 2K4DA 5FB0A 3KV6A 3L1ZB 3C5KA 5LKTA 3N9MA 1MM3A 4ZUXU 2MA5A 4B86C 5J3XA 3ZPVE 4ZQLA 4AVXA 2ECTA 3SOWA 2AN6A 2M1RA 2VJFB 4QF2A 2QIZA 4UP5A 2M6MA 2QJ0A 4V3KC 2C2LA 2LQ6A 2XB1A 2NAAA 2L5UA 5LKXA 4A4CA 2YUCA 1E4UA 2E6RA 4AP4A 4UI9B 4B7YC 1U6GB 3U5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EB5 A;  5EYA F;  4AYC B;  5H9M A;  3O33 A;  2F6J A;  1WEW A;  4YC9 A;  4AUQ B;  2F42 A;  3RPG B;  4FIP A;  2VPB A;  3ZYQ A;  2KYU A;  4Q6F A;  3O34 A;  4NN2 A;  5LCW B;  2CSZ A;  2KFT A;  3IHP A;  1WEE A;  5KH3 A;  1WFK A;  5LKU A;  2G6Q A;  2L0B A;  1FBV A;  3LQI A;  4LK9 A;  2MT5 A;  2HYE D;  4UP0 A;  2K16 A;  5TBN A;  2CKL B;  2CT2 A;  3RTR B;  2QIC A;  4GNF A;  3LRQ A;  4WZ2 A;  3V43 A;  2KGG A;  3RPG C;  4R8P K;  3N9L A;  3DPL R;  3N9O A;  3O36 A;  4LKA A;  4YAT A;  1MM2 A;  2ECW A;  4IC3 A;  3VK6 A;  2G43 A;  4WZ0 A;  2H0D B;  3PUR A;  3PUQ A;  2C2V S;  2KE1 A;  1XWH A;  4FK5 A;  2LRI C;  4O64 A;  4S3O B;  4L58 A;  1Z60 A;  5B77 A;  2ZET C;  1LDK C;  1LDJ B;  4GNG A;  4XI1 A;  4N4F A;  2JRJ A;  2LGL A;  1WEN A;  1JOC A;  5B78 A;  2YHO A;  5DIN A;  5G0F A;  4YAX A;  2EOD A;  5TDR A;  2VJE B;  3LQH A;  3L11 A;  2KR4 A;  3MHH A;  4TKP B;  1WE9 A;  2FSA A;  2G45 A;  5I3L A;  2H0D A;  3EB6 A;  4IC2 A;  5B75 A;  2KGI A;  2RSD A;  2MIQ A;  2OXQ C;  3N9Q A;  4PTB A;  4YBS A;  4R7E A;  1G25 A;  3U5O A;  2MUM A;  4X3G A;  5D1K B;  2MD7 B;  4W4U A;  4FO9 A;  4I7D A;  3NG2 A;  3M63 A;  4S3O C;  1VD4 A;  2VJF A;  3MHS A;  5KH9 A;  2VJE A;  1BOR A;  1WGM A;  1V87 A;  3O37 A;  1ZBD B;  2L75 A;  2VPG A;  2YT5 A;  2MNZ A;  3HCU A;  5FEY A;  4BBQ A;  5G04 B;  1N87 A;  1VYX A;  4FJC A;  1F62 A;  3N9P A;  3LQJ A;  2JMJ A;  2M85 A;  4AYC A;  1Z2Q A;  2ECN A;  2M3H A;  3ZVY A;  2YQM A;  4WZ3 B;  4YAD A;  2K17 A;  2RI7 A;  3GL6 A;  1X4I A;  3HTK C;  3T7L A;  2YYR A;  2HDP A;  4QF3 A;  1DVP A;  2VNF A;  2KWK A;  5FB1 A;  2MD8 C;  4WA6 A;  2L80 A;  4A49 A;  1HYI A;  1WEQ A;  2ECG A;  2K1J A;  1FP0 A;  4I7B A;  2Y1N A;  2LDR A;  3FL2 A;  2FUU A;  2E6S A;  5TAB A;  2YHN A;  2KU3 A;  2PNX A;  4YBT A;  4N3W A;  4F52 B;  3HCS A;  1IYM A;  4GB0 A;  2DX8 A;  4C9Z A;  3O35 A;  2CKL A;  2YRE A;  2XEU A;  3L1X A;  3C6W A;  5D1M B;  3GV4 A;  2BAY A;  5B8D A;  3KV5 A;  3ZNI A;  3T6R A;  2YU4 A;  5TRB A;  5AIU A;  4L7X A;  4MVT A;  3PHD A;  3SOU A;  5AIT A;  4LLB A;  3U5P A;  2UZG A;  1WEM A;  4I7C A;  4MSX A;  4LJN A;  2LGK A;  2Y1M A;  2LGG A;  1X4U A;  2L43 A;  3ZPV 1;  3I2D A;  1WES A;  1WEV A;  2ECV A;  2LXH C;  3O70 A;  3ASL A;  5KH7 A;  2MA6 A;  2MNY A;  3QZV A;  2YW8 A;  5B79 A;  2FUI A;  4A0C D;  5G05 B;  2KWO A;  2EA6 A;  2YSM A;  4GND A;  2YUR A;  5B76 A;  2LN0 A;  5C13 A;  1K2F A;  3KNV A;  2Y43 A;  5H1V A;  3SOX A;  2VPE A;  3M99 A;  4YBM A;  4LAD B;  1T1H A;  2LXP C;  1JM7 B;  1X4J A;  5FER A;  2PUY A;  2CSY A;  1WEO A;  2JMI A;  3U5M A;  4A4B A;  1WEP A;  1CHC A;  2IDA A;  5C11 A;  3M62 A;  1Z6U A;  4CA1 A;  3SHB A;  5LKZ A;  2KRE A;  2LGV A;  4ZDT A;  4GNE A;  4R2Y A;  3ZVZ B;  2KIZ A;  2D8S A;  1VFY A;  2LV9 A;  5H1T A;  3O7A A;  2YSJ A;  1RMD A;  4YAB A;  3KQI A;  5H1U A;  2VP7 A;  1JM7 A;  1WIL A;  2F6N A;  4P5O B;  2KWN A;  5JG6 A;  1WEU A;  4CCG X;  1HYJ A;  5D1L B;  3N9N A;  5TDW A;  3DQV R;  3HCT A;  2YQL A;  2KWJ A;  4V3L C;  2EGP A;  4BHW A;  1WIM A;  4PPE A;  5DKA A;  2I50 A;  2JMD A;  3ZTG A;  2VPD A;  2ECI A;  2ECJ A;  2K4D A;  5FB0 A;  3KV6 A;  3L1Z B;  3C5K A;  5LKT A;  3N9M A;  1MM3 A;  4ZUX U;  2MA5 A;  4B86 C;  5J3X A;  3ZPV E;  4ZQL A;  4AVX A;  2ECT A;  3SOW A;  2AN6 A;  2M1R A;  2VJF B;  4QF2 A;  2QIZ A;  4UP5 A;  2M6M A;  2QJ0 A;  4V3K C;  2C2L A;  2LQ6 A;  2XB1 A;  2NAA A;  2L5U A;  5LKX A;  4A4C A;  2YUC A;  1E4U A;  2E6R A;  4AP4 A;  4UI9 B;  4B7Y C;  1U6G B;  3U5N A; 
#chains in the Genus database with same CATH topology
 3EB5 A;  5K3Q A;  5EYA F;  4AYC B;  5H9M A;  3O33 A;  2JM3 A;  3LDY A;  2F6J A;  1WEW A;  4YC9 A;  5SVX A;  3O47 A;  4AUQ B;  2F42 A;  3RPG B;  3DDT A;  4FIP A;  2VPB A;  3ZYQ A;  2XP0 A;  2KYU A;  4Q6F A;  3O34 A;  4NN2 A;  5LCW B;  2CSZ A;  2KFT A;  3FJU B;  2XOC A;  3SUB A;  3IHP A;  1WEE A;  5KH3 A;  2DSM A;  1WFK A;  5LKU A;  2G6Q A;  2L0B A;  1FBV A;  3LQI A;  3T9K A;  5SVY A;  4LK9 A;  2JUN A;  2MT5 A;  2HYE D;  4UP0 A;  2K16 A;  5TBN A;  2CKL B;  2CT2 A;  3RTR B;  2QIC A;  4GNF A;  3LRQ A;  3FAO A;  4WZ2 A;  3V43 A;  2KGG A;  3RPG C;  1DCQ A;  3N9L A;  4R8P K;  3DPL R;  3N9O A;  3O36 A;  4LKA A;  4YAT A;  4F1P A;  1MM2 A;  2ECW A;  4IC3 A;  3VK6 A;  2G43 A;  4WZ0 A;  2H0D B;  3PUR A;  3PUQ A;  1MBM A;  2C2V S;  2KE1 A;  2KKX A;  1XWH A;  4FK5 A;  2LRI C;  4O64 A;  4L58 A;  4S3O B;  1Z60 A;  5B77 A;  2ZET C;  1LDK C;  1LDJ B;  4GNG A;  4XI1 A;  4N4F A;  2IQJ A;  2JRJ A;  2LGL A;  1WEN A;  1JOC A;  5B78 A;  2YHO A;  5DIN A;  2EOD A;  4YAX A;  5G0F A;  5TDR A;  2VJE B;  2M13 A;  3LQH A;  3L11 A;  3FAN A;  2KR4 A;  3MHH A;  4TKP B;  3H7H A;  1WE9 A;  2FSA A;  2G45 A;  5I3L A;  2H0D A;  3EB6 A;  4IC2 A;  5B75 A;  2KGI A;  3FM8 C;  2RSD A;  2MIQ A;  2OXQ C;  3N9Q A;  4PTB A;  4YBS A;  4R7E A;  1G25 A;  3U5O A;  4OGC A;  2CRW A;  2MUM A;  4X3G A;  5D1K B;  2MD7 B;  3KDE C;  4W4U A;  4FO9 A;  4I7D A;  2EGM A;  3NG2 A;  3M63 A;  4S3O C;  1VD4 A;  2VJF A;  3MHS A;  5KH9 A;  2VJE A;  1BOR A;  1WGM A;  1V87 A;  3O37 A;  1ZBD B;  2L75 A;  2VPG A;  2YT5 A;  2CSV A;  2CON A;  2MNZ A;  3HCU A;  5FEY A;  4BBQ A;  5G04 B;  1N87 A;  3JUE A;  1VYX A;  4FJC A;  1F62 A;  3N9P A;  4O62 A;  3LQJ A;  2JMJ A;  2M85 A;  4AYC A;  1Z2Q A;  2ECN A;  2M3H A;  3ZVY A;  2YQM A;  2D8U A;  4WZ3 B;  4YAD A;  2K17 A;  2RI7 A;  3GL6 A;  2YVR A;  1X4I A;  3HTK C;  3LVQ E;  3T7L A;  2YYR A;  2HDP A;  3M7K A;  4QF3 A;  1DVP A;  2VNF A;  2KWK A;  5FB1 A;  2MD8 C;  4WA6 A;  2L80 A;  4A49 A;  1HYI A;  2FFW A;  1WEQ A;  2ECG A;  2K1J A;  1FP0 A;  4I7B A;  2P57 A;  2Y1N A;  2LDR A;  3FL2 A;  2FUU A;  2E6S A;  5TAB A;  2YHN A;  2KU3 A;  2PNX A;  4YBT A;  4N3W A;  4F52 B;  3HCS A;  1IYM A;  4GB0 A;  2DX8 A;  4C9Z A;  3O35 A;  2CKL A;  2YRE A;  2XEU A;  3L1X A;  3C6W A;  5D1M B;  3GV4 A;  2BAY A;  5B8D A;  3KV5 A;  3ZNI A;  3T6R A;  2YU4 A;  5TRB A;  2KKY A;  5AIU A;  3FEH A;  4L7X A;  4MVT A;  3PHD A;  3SOU A;  2OWA A;  5AIT A;  4LLB A;  3U5P A;  2UZG A;  1WEM A;  4I7C A;  4MSX A;  4LJN A;  2DJA A;  2LGK A;  2Y1M A;  2LGG A;  1X4U A;  2L43 A;  2XOZ A;  3ZPV 1;  3I2D A;  1WES A;  1WEV A;  2ECV A;  2LXH C;  3O70 A;  3ASL A;  5KH7 A;  2MA6 A;  2MNY A;  3QZV A;  2YW8 A;  2XOY A;  5B79 A;  2FUI A;  4A0C D;  5G05 B;  2KWO A;  2EA6 A;  2YSM A;  4GND A;  2YUR A;  5B76 A;  2LN0 A;  5C13 A;  1K2F A;  3KNV A;  2EXU A;  2Y43 A;  5H1V A;  3SOX A;  2VPE A;  3M99 A;  4YBM A;  3DWD A;  4LAD B;  1T1H A;  2LXP C;  2MKE A;  1JM7 B;  1X4J A;  5FER A;  2PUY A;  2CSY A;  1WEO A;  2JMI A;  3U5M A;  2E61 A;  4A4B A;  1WEP A;  1CHC A;  2IDA A;  2L7P A;  5C11 A;  3E2D A;  2LAU A;  3M62 A;  1Z6U A;  4CA1 A;  4QQ4 A;  3SHB A;  5LKZ A;  2KRE A;  2LGV A;  4ZDT A;  4GNE A;  4R2Y A;  3ZVZ B;  2KIZ A;  2D8S A;  1VFY A;  2LV9 A;  5H1T A;  3O7A A;  2YSJ A;  3Q1D A;  1RMD A;  4YAB A;  3KQI A;  5H1U A;  2VP7 A;  4OGE A;  1JM7 A;  1WIL A;  2F6N A;  4P5O B;  2KWN A;  4Z0R A;  3PLW A;  5JG6 A;  1WEU A;  4CCG X;  1HYJ A;  5D1L B;  3N9N A;  5TDW A;  3DQV R;  3HCT A;  2YQL A;  2KWJ A;  4V3L C;  2EGP A;  4BHW A;  1WIM A;  3MDB C;  4PPE A;  5DKA A;  2B0O E;  2I50 A;  2JMD A;  3ZTG A;  5SVI B;  2VPD A;  2ECI A;  2ECJ A;  2K4D A;  5FB0 A;  3LVR E;  3KV6 A;  3L1Z B;  3C5K A;  5LKT A;  3N9M A;  2CRR A;  1MM3 A;  4ZUX U;  2MA5 A;  4B86 C;  2FD4 A;  3LJU X;  5J3X A;  3ZPV E;  2RR4 A;  4ZQL A;  4AVX A;  2ECT A;  3SOW A;  2AN6 A;  2M1R A;  4Z0O A;  2VJF B;  4QF2 A;  2QIZ A;  4UP5 A;  2M6M A;  2QJ0 A;  4V3K C;  2C2L A;  2LQ6 A;  2XB1 A;  2NAA A;  2L5U A;  5SVI A;  5LKX A;  4A4C A;  2YUC A;  1E4U A;  2E6R A;  4AP4 A;  4UI9 B;  4B7Y C;  1U6G B;  4H9D A;  3U5N A; 
#chains in the Genus database with same CATH homology
 3EB5 A;  5EYA F;  4AYC B;  5H9M A;  3O33 A;  2F6J A;  1WEW A;  4YC9 A;  4AUQ B;  2F42 A;  3RPG B;  4FIP A;  2VPB A;  3ZYQ A;  2KYU A;  4Q6F A;  3O34 A;  4NN2 A;  5LCW B;  2CSZ A;  2KFT A;  3IHP A;  1WEE A;  5KH3 A;  1WFK A;  5LKU A;  2G6Q A;  2L0B A;  1FBV A;  3LQI A;  4LK9 A;  2MT5 A;  2HYE D;  4UP0 A;  2K16 A;  5TBN A;  2CKL B;  2CT2 A;  3RTR B;  2QIC A;  4GNF A;  3LRQ A;  4WZ2 A;  3V43 A;  2KGG A;  3RPG C;  4R8P K;  3N9L A;  3DPL R;  3N9O A;  3O36 A;  4LKA A;  4YAT A;  1MM2 A;  2ECW A;  4IC3 A;  3VK6 A;  2G43 A;  4WZ0 A;  2H0D B;  3PUR A;  3PUQ A;  2C2V S;  2KE1 A;  1XWH A;  4FK5 A;  2LRI C;  4O64 A;  4S3O B;  4L58 A;  1Z60 A;  5B77 A;  2ZET C;  1LDK C;  1LDJ B;  4GNG A;  4XI1 A;  4N4F A;  2JRJ A;  2LGL A;  1WEN A;  1JOC A;  5B78 A;  2YHO A;  5DIN A;  5G0F A;  4YAX A;  2EOD A;  5TDR A;  2VJE B;  3LQH A;  3L11 A;  2KR4 A;  3MHH A;  4TKP B;  1WE9 A;  2FSA A;  2G45 A;  5I3L A;  2H0D A;  3EB6 A;  4IC2 A;  5B75 A;  2KGI A;  2RSD A;  2MIQ A;  2OXQ C;  3N9Q A;  4PTB A;  4YBS A;  4R7E A;  1G25 A;  3U5O A;  2MUM A;  4X3G A;  5D1K B;  2MD7 B;  4W4U A;  4FO9 A;  4I7D A;  3NG2 A;  3M63 A;  4S3O C;  1VD4 A;  2VJF A;  3MHS A;  5KH9 A;  2VJE A;  1BOR A;  1WGM A;  1V87 A;  3O37 A;  1ZBD B;  2L75 A;  2VPG A;  2YT5 A;  2MNZ A;  3HCU A;  5FEY A;  4BBQ A;  5G04 B;  1N87 A;  1VYX A;  4FJC A;  1F62 A;  3N9P A;  3LQJ A;  2JMJ A;  2M85 A;  4AYC A;  1Z2Q A;  2ECN A;  2M3H A;  3ZVY A;  2YQM A;  4WZ3 B;  4YAD A;  2K17 A;  2RI7 A;  3GL6 A;  1X4I A;  3HTK C;  3T7L A;  2YYR A;  2HDP A;  4QF3 A;  1DVP A;  2VNF A;  2KWK A;  5FB1 A;  2MD8 C;  4WA6 A;  2L80 A;  4A49 A;  1HYI A;  1WEQ A;  2ECG A;  2K1J A;  1FP0 A;  4I7B A;  2Y1N A;  2LDR A;  3FL2 A;  2FUU A;  2E6S A;  5TAB A;  2YHN A;  2KU3 A;  2PNX A;  4YBT A;  4N3W A;  4F52 B;  3HCS A;  1IYM A;  4GB0 A;  2DX8 A;  4C9Z A;  3O35 A;  2CKL A;  2YRE A;  2XEU A;  3L1X A;  3C6W A;  5D1M B;  3GV4 A;  2BAY A;  5B8D A;  3KV5 A;  3ZNI A;  3T6R A;  2YU4 A;  5TRB A;  5AIU A;  4L7X A;  4MVT A;  3PHD A;  3SOU A;  5AIT A;  4LLB A;  3U5P A;  2UZG A;  1WEM A;  4I7C A;  4MSX A;  4LJN A;  2LGK A;  2Y1M A;  2LGG A;  1X4U A;  2L43 A;  3ZPV 1;  3I2D A;  1WES A;  1WEV A;  2ECV A;  2LXH C;  3O70 A;  3ASL A;  5KH7 A;  2MA6 A;  2MNY A;  3QZV A;  2YW8 A;  5B79 A;  2FUI A;  4A0C D;  5G05 B;  2KWO A;  2EA6 A;  2YSM A;  4GND A;  2YUR A;  5B76 A;  2LN0 A;  5C13 A;  1K2F A;  3KNV A;  2Y43 A;  5H1V A;  3SOX A;  2VPE A;  3M99 A;  4YBM A;  4LAD B;  1T1H A;  2LXP C;  1JM7 B;  1X4J A;  5FER A;  2PUY A;  2CSY A;  1WEO A;  2JMI A;  3U5M A;  4A4B A;  1WEP A;  1CHC A;  2IDA A;  5C11 A;  3M62 A;  1Z6U A;  4CA1 A;  3SHB A;  5LKZ A;  2KRE A;  2LGV A;  4ZDT A;  4GNE A;  4R2Y A;  3ZVZ B;  2KIZ A;  2D8S A;  1VFY A;  2LV9 A;  5H1T A;  3O7A A;  2YSJ A;  1RMD A;  4YAB A;  3KQI A;  5H1U A;  2VP7 A;  1JM7 A;  1WIL A;  2F6N A;  4P5O B;  2KWN A;  5JG6 A;  1WEU A;  4CCG X;  1HYJ A;  5D1L B;  3N9N A;  5TDW A;  3DQV R;  3HCT A;  2YQL A;  2KWJ A;  4V3L C;  2EGP A;  4BHW A;  1WIM A;  4PPE A;  5DKA A;  2I50 A;  2JMD A;  3ZTG A;  2VPD A;  2ECI A;  2ECJ A;  2K4D A;  5FB0 A;  3KV6 A;  3L1Z B;  3C5K A;  5LKT A;  3N9M A;  1MM3 A;  4ZUX U;  2MA5 A;  4B86 C;  5J3X A;  3ZPV E;  4ZQL A;  4AVX A;  2ECT A;  3SOW A;  2AN6 A;  2M1R A;  2VJF B;  4QF2 A;  2QIZ A;  4UP5 A;  2M6M A;  2QJ0 A;  4V3K C;  2C2L A;  2LQ6 A;  2XB1 A;  2NAA A;  2L5U A;  5LKX A;  4A4C A;  2YUC A;  1E4U A;  2E6R A;  4AP4 A;  4UI9 B;  4B7Y C;  1U6G B;  3U5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...