2I50A

Solution structure of ubp-m znf-ubp domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
PVCRHIRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRSEPHCLVLSLDNWSVWCYVCDNEVQYCSSNQLGQVVDYVRKQAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 16
publication title Solution structure of the Ubp-M BUZ domain, a highly specific protein module that recognizes the C-terminal tail of free ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 34
structure length 122
sequence length 122
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2i50A00
2I50A 1BORA 3I2DA 5C11A 1WEWA 3L1ZB 3ZYQA 2FUIA 5LKTA 2ECNA 2K1JA 2VJEB 2M85A 4R2YA 2M1RA 4ZQLA 3EB6A 1WEQA 5LKXA 1X4JA 1WENA 4GNGA 2VP7A 2H0DA 2Y1MA 2QJ0A 5D1LB 3O33A 3GV4A 4YBMA 3M62A 3PUQA 5B76A 2IDAA 2LRIC 1DVPA 5FB0A 1Z6UA 1WE9A 4V3KC 3N9MA 2H0DB 2KREA 3O7AA 3N9NA 1JM7A 4GNDA 2KE1A 4R7EA 4A4BA 3T7LA 2CKLA 2C2LA 4O64A 5LCWB 2KIZA 2YQLA 5D1MB 4YATA 1G25A 2VPDA 1JM7B 4CA1A 1WEOA 3QZVA 2MT5A 2CKLB 2HYED 1LDJB 2YQMA 4XI1A 3SOUA 2M6MA 4F52B 3N9QA 5DINA 2LGLA 2YUCA 2YT5A 2CSZA 4BBQA 4AVXA 2LXHC 2EGPA 5H1TA 2F42A 1XWHA 4PTBA 3RTRB 2G45A 4N3WA 1U6GB 3U5NA 2K16A 2MA5A 3HTKC 2EODA 4LJNA 1Z2QA 3L11A 2JMJA 5TDRA 1WESA 2YSMA 2PUYA 2LGVA 2JMDA 3L1XA 2L0BA 2ECWA 2YW8A 5KH7A 4R8PK 3PHDA 2F6JA 4YADA 1ZBDB 2NAAA 4B86C 5AIUA 1WIMA 2F6NA 4YABA 4QF3A 3HCTA 1WGMA 4CCGX 5FERA 5C13A 2MIQA 2M3HA 5J3XA 3HCSA 2KGGA 1VFYA 1MM3A 3T6RA 2K17A 5FB1A 2LXPC 2YURA 3GL6A 2HDPA 2VNFA 4WA6A 4PPEA 3SOXA 2YU4A 5DKAA 1JOCA 3KV6A 4FJCA 2L80A 2XB1A 1IYMA 2MNZA 4AUQB 2DX8A 2FUUA 3C5KA 2L75A 1RMDA 2AN6A 3EB5A 4L58A 4YBTA 4BHWA 4A49A 3U5OA 4FK5A 1T1HA 2MD7B 1FP0A 5LKUA 4FIPA 4TKPB 4WZ2A 2EA6A 2YSJA 4A0CD 2KR4A 4QF2A 4C9ZA 5G0FA 3O36A 2KWJA 3M63A 3SHBA 2QIZA 2K4DA 4UP0A 2KWOA 4UI9B 3ZPV1 4W4UA 2XEUA 5FEYA 2KYUA 2QICA 3LQHA 1WEEA 4LK9A 1CHCA 4YAXA 5G05B 3ZNIA 2L5UA 1VYXA 2LQ6A 3ZVZB 2G43A 2VJFB 2LV9A 4NN2A 1WEUA 3NG2A 3PURA 3M99A 2KU3A 5H1VA 2VPEA 2LGGA 5I3LA 5B77A 2OXQC 3ZPVE 5B8DA 3O35A 3N9OA 3ASLA 3N9LA 4YC9A 2YYRA 4AP4A 3O34A 5KH3A 3SOWA 2LN0A 2KFTA 1LDKC 5KH9A 1VD4A 5TDWA 4FO9A 1HYJA 3O37A 5H9MA 2YREA 2Y43A 2VPBA 1K2FA 2PNXA 2G6QA 3IHPA 4LLBA 1WEMA 4GNEA 3ZVYA 2JRJA 1WFKA 5B75A 3VK6A 1V87A 5H1UA 3DPLR 2CT2A 5B78A 1X4UA 3MHSA 2ECJA 3MHHA 2CSYA 2VPGA 2ECIA 2JMIA 4S3OB 2ZETC 2YHOA 3FL2A 2LDRA 4AYCA 5AITA 1WEVA 2MUMA 1FBVA 1F62A 2ECVA 4ZUXU 2E6SA 2ECTA 4GB0A 4WZ3B 4UP5A 5TBNA 2LGKA 3KNVA 3ZTGA 1MM2A 4MVTA 4MSXA 4AYCB 2RI7A 2MD8C 5TABA 3N9PA 5TRBA 4S3OC 2L43A 2RSDA 1E4UA 5D1KB 2MA6A 1N87A 4N4FA 2E6RA 4GNFA 2UZGA 4LKAA 3LQIA 2VJFA 2YHNA 5JG6A 4L7XA 2Y1NA 4A4CA 2BAYA 1X4IA 4V3LC 2KGIA 3DQVR 5LKZA 3LRQA 5EYAF 2KWNA 3U5PA 3KQIA 3KV5A 4X3GA 4I7CA 1WEPA 1WILA 2D8SA 3RPGB 3C6WA 1Z60A 2C2VS 3LQJA 5G04B 4ZDTA 4LADB 4I7DA 3HCUA 2FSAA 4Q6FA 1HYIA 4WZ0A 3O70A 3V43A 2MNYA 4YBSA 3U5MA 4I7BA 4IC3A 5B79A 4B7YC 2KWKA 2VJEA 4P5OB 3RPGC 4IC2A 2ECGA
chains in the Genus database with same CATH superfamily
2I50A 1BORA 2CSVA 3I2DA 5C11A 3T9KA 1WEWA 3L1ZB 3ZYQA 2FUIA 5LKTA 4OGEA 2ECNA 2DSMA 2K1JA 2VJEB 3H7HA 3LVRE 2M85A 4R2YA 2M1RA 4ZQLA 3EB6A 1WEQA 2YVRA 5LKXA 1X4JA 2D8UA 1WENA 4GNGA 5SVIA 2VP7A 4Z0RA 2H0DA 3DWDA 2Y1MA 2QJ0A 3PLWA 5D1LB 3O33A 5SVXA 3GV4A 4YBMA 3M62A 3PUQA 4H9DA 5B76A 2IDAA 2LRIC 1DVPA 5FB0A 1Z6UA 1WE9A 4V3KC 2IQJA 3N9MA 2H0DB 2KREA 3O7AA 3N9NA 1JM7A 4GNDA 2KE1A 4R7EA 4A4BA 3T7LA 2CKLA 2C2LA 4O64A 5LCWB 2KIZA 2YQLA 5D1MB 4YATA 1G25A 2VPDA 3KDEC 3FEHA 1JM7B 4CA1A 1WEOA 3QZVA 2MT5A 2CKLB 2FFWA 2HYED 1LDJB 2YQMA 4XI1A 3SOUA 2M6MA 4F52B 3N9QA 5DINA 2LGLA 2YUCA 2YT5A 2CSZA 4BBQA 4AVXA 2LXHC 2EGPA 5H1TA 2F42A 1XWHA 1DCQA 4PTBA 3RTRB 2G45A 4N3WA 1U6GB 4Z0OA 3U5NA 3LVQE 2K16A 2MA5A 3HTKC 2EODA 2MKEA 4LJNA 1Z2QA 3L11A 2JMJA 5TDRA 1WESA 2YSMA 2PUYA 2LGVA 2JMDA 3L1XA 2L0BA 2ECWA 2YW8A 5KH7A 4R8PK 3PHDA 2F6JA 4YADA 1ZBDB 2NAAA 4B86C 5AIUA 3FAOA 2DJAA 1WIMA 2F6NA 4YABA 2EXUA 3E2DA 4QF3A 3HCTA 1WGMA 4CCGX 5FERA 5C13A 2FD4A 2MIQA 2M3HA 5J3XA 3HCSA 2KGGA 1VFYA 1MM3A 5SVYA 3T6RA 3O47A 2K17A 5FB1A 2LXPC 2YURA 3GL6A 2HDPA 2VNFA 4WA6A 4PPEA 3SOXA 2XOCA 2JUNA 2YU4A 5DKAA 1JOCA 3KV6A 4FJCA 2B0OE 2L80A 2XB1A 1IYMA 2M13A 2MNZA 2E61A 4AUQB 2L7PA 2DX8A 2FUUA 3C5KA 3Q1DA 2L75A 1RMDA 2AN6A 3EB5A 4L58A 4YBTA 4BHWA 4A49A 3U5OA 4FK5A 1T1HA 2MD7B 1FP0A 5LKUA 4FIPA 4TKPB 2XP0A 4WZ2A 2EA6A 2YSJA 4A0CD 2KR4A 4QF2A 4C9ZA 1MBMA 5G0FA 3O36A 2KWJA 3M63A 3SHBA 2QIZA 2K4DA 4UP0A 2KWOA 4UI9B 3ZPV1 4W4UA 2XEUA 5FEYA 2KYUA 2QICA 3LQHA 1WEEA 4LK9A 1CHCA 4YAXA 5G05B 3ZNIA 2L5UA 1VYXA 2LQ6A 3ZVZB 2G43A 2VJFB 2LV9A 4NN2A 1WEUA 3NG2A 3PURA 3M99A 2KU3A 5H1VA 2VPEA 2LGGA 5I3LA 5B77A 2OXQC 2EGMA 3ZPVE 5B8DA 3O35A 3N9OA 3ASLA 3N9LA 4YC9A 2YYRA 4AP4A 3O34A 5KH3A 3SOWA 2LN0A 2KFTA 1LDKC 5KH9A 1VD4A 5TDWA 4FO9A 1HYJA 3O37A 5H9MA 3MDBC 2YREA 2Y43A 2VPBA 1K2FA 2PNXA 2G6QA 3IHPA 4QQ4A 4LLBA 1WEMA 4GNEA 3DDTA 3ZVYA 2JRJA 1WFKA 5B75A 3M7KA 3VK6A 2JM3A 5K3QA 1V87A 3FJUB 5H1UA 3DPLR 2CT2A 5B78A 1X4UA 3MHSA 2ECJA 3MHHA 2CSYA 2VPGA 2ECIA 2JMIA 4S3OB 2ZETC 2YHOA 3FL2A 2LDRA 4AYCA 5AITA 3SUBA 1WEVA 2MUMA 1FBVA 1F62A 2ECVA 4ZUXU 2E6SA 2ECTA 4GB0A 4WZ3B 4UP5A 5TBNA 2P57A 2LGKA 3LDYA 3KNVA 3ZTGA 4F1PA 5SVIB 1MM2A 4MVTA 4MSXA 4AYCB 2RI7A 2MD8C 5TABA 3N9PA 5TRBA 4S3OC 2L43A 2RSDA 1E4UA 5D1KB 2MA6A 1N87A 4N4FA 2E6RA 4GNFA 2UZGA 4LKAA 3LQIA 2VJFA 2YHNA 2XOYA 5JG6A 3LJUX 4L7XA 2Y1NA 2KKXA 4A4CA 2BAYA 1X4IA 4V3LC 3FM8C 2KGIA 3DQVR 5LKZA 2KKYA 3LRQA 5EYAF 2KWNA 3U5PA 3KQIA 2CRWA 3KV5A 2LAUA 4X3GA 4I7CA 1WEPA 1WILA 2D8SA 2XOZA 3RPGB 3C6WA 1Z60A 2C2VS 3LQJA 5G04B 4ZDTA 4LADB 4I7DA 3HCUA 2FSAA 4Q6FA 2OWAA 3JUEA 1HYIA 3FANA 4WZ0A 3O70A 3V43A 2MNYA 4YBSA 3U5MA 4I7BA 4IC3A 5B79A 4B7YC 2CONA 2KWKA 2VJEA 4O62A 4P5OB 2CRRA 3RPGC 4IC2A 2RR4A 4OGCA 2ECGA
chains in the Genus database with same CATH topology
2I50A 1BORA 3I2DA 5C11A 1WEWA 3L1ZB 3ZYQA 2FUIA 5LKTA 2ECNA 2K1JA 2VJEB 2M85A 4R2YA 2M1RA 4ZQLA 3EB6A 1WEQA 5LKXA 1X4JA 1WENA 4GNGA 2VP7A 2H0DA 2Y1MA 2QJ0A 5D1LB 3O33A 3GV4A 4YBMA 3M62A 3PUQA 5B76A 2IDAA 2LRIC 1DVPA 5FB0A 1Z6UA 1WE9A 4V3KC 3N9MA 2H0DB 2KREA 3O7AA 3N9NA 1JM7A 4GNDA 2KE1A 4R7EA 4A4BA 3T7LA 2CKLA 2C2LA 4O64A 5LCWB 2KIZA 2YQLA 5D1MB 4YATA 1G25A 2VPDA 1JM7B 4CA1A 1WEOA 3QZVA 2MT5A 2CKLB 2HYED 1LDJB 2YQMA 4XI1A 3SOUA 2M6MA 4F52B 3N9QA 5DINA 2LGLA 2YUCA 2YT5A 2CSZA 4BBQA 4AVXA 2LXHC 2EGPA 5H1TA 2F42A 1XWHA 4PTBA 3RTRB 2G45A 4N3WA 1U6GB 3U5NA 2K16A 2MA5A 3HTKC 2EODA 4LJNA 1Z2QA 3L11A 2JMJA 5TDRA 1WESA 2YSMA 2PUYA 2LGVA 2JMDA 3L1XA 2L0BA 2ECWA 2YW8A 5KH7A 4R8PK 3PHDA 2F6JA 4YADA 1ZBDB 2NAAA 4B86C 5AIUA 1WIMA 2F6NA 4YABA 4QF3A 3HCTA 1WGMA 4CCGX 5FERA 5C13A 2MIQA 2M3HA 5J3XA 3HCSA 2KGGA 1VFYA 1MM3A 3T6RA 2K17A 5FB1A 2LXPC 2YURA 3GL6A 2HDPA 2VNFA 4WA6A 4PPEA 3SOXA 2YU4A 5DKAA 1JOCA 3KV6A 4FJCA 2L80A 2XB1A 1IYMA 2MNZA 4AUQB 2DX8A 2FUUA 3C5KA 2L75A 1RMDA 2AN6A 3EB5A 4L58A 4YBTA 4BHWA 4A49A 3U5OA 4FK5A 1T1HA 2MD7B 1FP0A 5LKUA 4FIPA 4TKPB 4WZ2A 2EA6A 2YSJA 4A0CD 2KR4A 4QF2A 4C9ZA 5G0FA 3O36A 2KWJA 3M63A 3SHBA 2QIZA 2K4DA 4UP0A 2KWOA 4UI9B 3ZPV1 4W4UA 2XEUA 5FEYA 2KYUA 2QICA 3LQHA 1WEEA 4LK9A 1CHCA 4YAXA 5G05B 3ZNIA 2L5UA 1VYXA 2LQ6A 3ZVZB 2G43A 2VJFB 2LV9A 4NN2A 1WEUA 3NG2A 3PURA 3M99A 2KU3A 5H1VA 2VPEA 2LGGA 5I3LA 5B77A 2OXQC 3ZPVE 5B8DA 3O35A 3N9OA 3ASLA 3N9LA 4YC9A 2YYRA 4AP4A 3O34A 5KH3A 3SOWA 2LN0A 2KFTA 1LDKC 5KH9A 1VD4A 5TDWA 4FO9A 1HYJA 3O37A 5H9MA 2YREA 2Y43A 2VPBA 1K2FA 2PNXA 2G6QA 3IHPA 4LLBA 1WEMA 4GNEA 3ZVYA 2JRJA 1WFKA 5B75A 3VK6A 1V87A 5H1UA 3DPLR 2CT2A 5B78A 1X4UA 3MHSA 2ECJA 3MHHA 2CSYA 2VPGA 2ECIA 2JMIA 4S3OB 2ZETC 2YHOA 3FL2A 2LDRA 4AYCA 5AITA 1WEVA 2MUMA 1FBVA 1F62A 2ECVA 4ZUXU 2E6SA 2ECTA 4GB0A 4WZ3B 4UP5A 5TBNA 2LGKA 3KNVA 3ZTGA 1MM2A 4MVTA 4MSXA 4AYCB 2RI7A 2MD8C 5TABA 3N9PA 5TRBA 4S3OC 2L43A 2RSDA 1E4UA 5D1KB 2MA6A 1N87A 4N4FA 2E6RA 4GNFA 2UZGA 4LKAA 3LQIA 2VJFA 2YHNA 5JG6A 4L7XA 2Y1NA 4A4CA 2BAYA 1X4IA 4V3LC 2KGIA 3DQVR 5LKZA 3LRQA 5EYAF 2KWNA 3U5PA 3KQIA 3KV5A 4X3GA 4I7CA 1WEPA 1WILA 2D8SA 3RPGB 3C6WA 1Z60A 2C2VS 3LQJA 5G04B 4ZDTA 4LADB 4I7DA 3HCUA 2FSAA 4Q6FA 1HYIA 4WZ0A 3O70A 3V43A 2MNYA 4YBSA 3U5MA 4I7BA 4IC3A 5B79A 4B7YC 2KWKA 2VJEA 4P5OB 3RPGC 4IC2A 2ECGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I50 A;  1BOR A;  3I2D A;  5C11 A;  1WEW A;  3L1Z B;  3ZYQ A;  2FUI A;  5LKT A;  2ECN A;  2K1J A;  2VJE B;  2M85 A;  4R2Y A;  2M1R A;  4ZQL A;  3EB6 A;  1WEQ A;  5LKX A;  1X4J A;  1WEN A;  4GNG A;  2VP7 A;  2H0D A;  2Y1M A;  2QJ0 A;  5D1L B;  3O33 A;  3GV4 A;  4YBM A;  3M62 A;  3PUQ A;  5B76 A;  2IDA A;  2LRI C;  1DVP A;  5FB0 A;  1Z6U A;  1WE9 A;  4V3K C;  3N9M A;  2H0D B;  2KRE A;  3O7A A;  3N9N A;  1JM7 A;  4GND A;  2KE1 A;  4R7E A;  4A4B A;  3T7L A;  2CKL A;  2C2L A;  4O64 A;  5LCW B;  2KIZ A;  2YQL A;  5D1M B;  4YAT A;  1G25 A;  2VPD A;  1JM7 B;  4CA1 A;  1WEO A;  3QZV A;  2MT5 A;  2CKL B;  2HYE D;  1LDJ B;  2YQM A;  4XI1 A;  3SOU A;  2M6M A;  4F52 B;  3N9Q A;  5DIN A;  2LGL A;  2YUC A;  2YT5 A;  2CSZ A;  4BBQ A;  4AVX A;  2LXH C;  2EGP A;  5H1T A;  2F42 A;  1XWH A;  4PTB A;  3RTR B;  2G45 A;  4N3W A;  1U6G B;  3U5N A;  2K16 A;  2MA5 A;  3HTK C;  2EOD A;  4LJN A;  1Z2Q A;  3L11 A;  2JMJ A;  5TDR A;  1WES A;  2YSM A;  2PUY A;  2LGV A;  2JMD A;  3L1X A;  2L0B A;  2ECW A;  2YW8 A;  5KH7 A;  4R8P K;  3PHD A;  2F6J A;  4YAD A;  1ZBD B;  2NAA A;  4B86 C;  5AIU A;  1WIM A;  2F6N A;  4YAB A;  4QF3 A;  3HCT A;  1WGM A;  4CCG X;  5FER A;  5C13 A;  2MIQ A;  2M3H A;  5J3X A;  3HCS A;  2KGG A;  1VFY A;  1MM3 A;  3T6R A;  2K17 A;  5FB1 A;  2LXP C;  2YUR A;  3GL6 A;  2HDP A;  2VNF A;  4WA6 A;  4PPE A;  3SOX A;  2YU4 A;  5DKA A;  1JOC A;  3KV6 A;  4FJC A;  2L80 A;  2XB1 A;  1IYM A;  2MNZ A;  4AUQ B;  2DX8 A;  2FUU A;  3C5K A;  2L75 A;  1RMD A;  2AN6 A;  3EB5 A;  4L58 A;  4YBT A;  4BHW A;  4A49 A;  3U5O A;  4FK5 A;  1T1H A;  2MD7 B;  1FP0 A;  5LKU A;  4FIP A;  4TKP B;  4WZ2 A;  2EA6 A;  2YSJ A;  4A0C D;  2KR4 A;  4QF2 A;  4C9Z A;  5G0F A;  3O36 A;  2KWJ A;  3M63 A;  3SHB A;  2QIZ A;  2K4D A;  4UP0 A;  2KWO A;  4UI9 B;  3ZPV 1;  4W4U A;  2XEU A;  5FEY A;  2KYU A;  2QIC A;  3LQH A;  1WEE A;  4LK9 A;  1CHC A;  4YAX A;  5G05 B;  3ZNI A;  2L5U A;  1VYX A;  2LQ6 A;  3ZVZ B;  2G43 A;  2VJF B;  2LV9 A;  4NN2 A;  1WEU A;  3NG2 A;  3PUR A;  3M99 A;  2KU3 A;  5H1V A;  2VPE A;  2LGG A;  5I3L A;  5B77 A;  2OXQ C;  3ZPV E;  5B8D A;  3O35 A;  3N9O A;  3ASL A;  3N9L A;  4YC9 A;  2YYR A;  4AP4 A;  3O34 A;  5KH3 A;  3SOW A;  2LN0 A;  2KFT A;  1LDK C;  5KH9 A;  1VD4 A;  5TDW A;  4FO9 A;  1HYJ A;  3O37 A;  5H9M A;  2YRE A;  2Y43 A;  2VPB A;  1K2F A;  2PNX A;  2G6Q A;  3IHP A;  4LLB A;  1WEM A;  4GNE A;  3ZVY A;  2JRJ A;  1WFK A;  5B75 A;  3VK6 A;  1V87 A;  5H1U A;  3DPL R;  2CT2 A;  5B78 A;  1X4U A;  3MHS A;  2ECJ A;  3MHH A;  2CSY A;  2VPG A;  2ECI A;  2JMI A;  4S3O B;  2ZET C;  2YHO A;  3FL2 A;  2LDR A;  4AYC A;  5AIT A;  1WEV A;  2MUM A;  1FBV A;  1F62 A;  2ECV A;  4ZUX U;  2E6S A;  2ECT A;  4GB0 A;  4WZ3 B;  4UP5 A;  5TBN A;  2LGK A;  3KNV A;  3ZTG A;  1MM2 A;  4MVT A;  4MSX A;  4AYC B;  2RI7 A;  2MD8 C;  5TAB A;  3N9P A;  5TRB A;  4S3O C;  2L43 A;  2RSD A;  1E4U A;  5D1K B;  2MA6 A;  1N87 A;  4N4F A;  2E6R A;  4GNF A;  2UZG A;  4LKA A;  3LQI A;  2VJF A;  2YHN A;  5JG6 A;  4L7X A;  2Y1N A;  4A4C A;  2BAY A;  1X4I A;  4V3L C;  2KGI A;  3DQV R;  5LKZ A;  3LRQ A;  5EYA F;  2KWN A;  3U5P A;  3KQI A;  3KV5 A;  4X3G A;  4I7C A;  1WEP A;  1WIL A;  2D8S A;  3RPG B;  3C6W A;  1Z60 A;  2C2V S;  3LQJ A;  5G04 B;  4ZDT A;  4LAD B;  4I7D A;  3HCU A;  2FSA A;  4Q6F A;  1HYI A;  4WZ0 A;  3O70 A;  3V43 A;  2MNY A;  4YBS A;  3U5M A;  4I7B A;  4IC3 A;  5B79 A;  4B7Y C;  2KWK A;  2VJE A;  4P5O B;  3RPG C;  4IC2 A;  2ECG A; 
#chains in the Genus database with same CATH topology
 2I50 A;  1BOR A;  2CSV A;  3I2D A;  5C11 A;  3T9K A;  1WEW A;  3L1Z B;  3ZYQ A;  2FUI A;  5LKT A;  4OGE A;  2ECN A;  2DSM A;  2K1J A;  2VJE B;  3H7H A;  3LVR E;  2M85 A;  4R2Y A;  2M1R A;  4ZQL A;  3EB6 A;  1WEQ A;  2YVR A;  5LKX A;  1X4J A;  2D8U A;  1WEN A;  4GNG A;  5SVI A;  2VP7 A;  4Z0R A;  2H0D A;  3DWD A;  2Y1M A;  2QJ0 A;  3PLW A;  5D1L B;  3O33 A;  5SVX A;  3GV4 A;  4YBM A;  3M62 A;  3PUQ A;  4H9D A;  5B76 A;  2IDA A;  2LRI C;  1DVP A;  5FB0 A;  1Z6U A;  1WE9 A;  4V3K C;  2IQJ A;  3N9M A;  2H0D B;  2KRE A;  3O7A A;  3N9N A;  1JM7 A;  4GND A;  2KE1 A;  4R7E A;  4A4B A;  3T7L A;  2CKL A;  2C2L A;  4O64 A;  5LCW B;  2KIZ A;  2YQL A;  5D1M B;  4YAT A;  1G25 A;  2VPD A;  3KDE C;  3FEH A;  1JM7 B;  4CA1 A;  1WEO A;  3QZV A;  2MT5 A;  2CKL B;  2FFW A;  2HYE D;  1LDJ B;  2YQM A;  4XI1 A;  3SOU A;  2M6M A;  4F52 B;  3N9Q A;  5DIN A;  2LGL A;  2YUC A;  2YT5 A;  2CSZ A;  4BBQ A;  4AVX A;  2LXH C;  2EGP A;  5H1T A;  2F42 A;  1XWH A;  1DCQ A;  4PTB A;  3RTR B;  2G45 A;  4N3W A;  1U6G B;  4Z0O A;  3U5N A;  3LVQ E;  2K16 A;  2MA5 A;  3HTK C;  2EOD A;  2MKE A;  4LJN A;  1Z2Q A;  3L11 A;  2JMJ A;  5TDR A;  1WES A;  2YSM A;  2PUY A;  2LGV A;  2JMD A;  3L1X A;  2L0B A;  2ECW A;  2YW8 A;  5KH7 A;  4R8P K;  3PHD A;  2F6J A;  4YAD A;  1ZBD B;  2NAA A;  4B86 C;  5AIU A;  3FAO A;  2DJA A;  1WIM A;  2F6N A;  4YAB A;  2EXU A;  3E2D A;  4QF3 A;  3HCT A;  1WGM A;  4CCG X;  5FER A;  5C13 A;  2FD4 A;  2MIQ A;  2M3H A;  5J3X A;  3HCS A;  2KGG A;  1VFY A;  1MM3 A;  5SVY A;  3T6R A;  3O47 A;  2K17 A;  5FB1 A;  2LXP C;  2YUR A;  3GL6 A;  2HDP A;  2VNF A;  4WA6 A;  4PPE A;  3SOX A;  2XOC A;  2JUN A;  2YU4 A;  5DKA A;  1JOC A;  3KV6 A;  4FJC A;  2B0O E;  2L80 A;  2XB1 A;  1IYM A;  2M13 A;  2MNZ A;  2E61 A;  4AUQ B;  2L7P A;  2DX8 A;  2FUU A;  3C5K A;  3Q1D A;  2L75 A;  1RMD A;  2AN6 A;  3EB5 A;  4L58 A;  4YBT A;  4BHW A;  4A49 A;  3U5O A;  4FK5 A;  1T1H A;  2MD7 B;  1FP0 A;  5LKU A;  4FIP A;  4TKP B;  2XP0 A;  4WZ2 A;  2EA6 A;  2YSJ A;  4A0C D;  2KR4 A;  4QF2 A;  4C9Z A;  1MBM A;  5G0F A;  3O36 A;  2KWJ A;  3M63 A;  3SHB A;  2QIZ A;  2K4D A;  4UP0 A;  2KWO A;  4UI9 B;  3ZPV 1;  4W4U A;  2XEU A;  5FEY A;  2KYU A;  2QIC A;  3LQH A;  1WEE A;  4LK9 A;  1CHC A;  4YAX A;  5G05 B;  3ZNI A;  2L5U A;  1VYX A;  2LQ6 A;  3ZVZ B;  2G43 A;  2VJF B;  2LV9 A;  4NN2 A;  1WEU A;  3NG2 A;  3PUR A;  3M99 A;  2KU3 A;  5H1V A;  2VPE A;  2LGG A;  5I3L A;  5B77 A;  2OXQ C;  2EGM A;  3ZPV E;  5B8D A;  3O35 A;  3N9O A;  3ASL A;  3N9L A;  4YC9 A;  2YYR A;  4AP4 A;  3O34 A;  5KH3 A;  3SOW A;  2LN0 A;  2KFT A;  1LDK C;  5KH9 A;  1VD4 A;  5TDW A;  4FO9 A;  1HYJ A;  3O37 A;  5H9M A;  3MDB C;  2YRE A;  2Y43 A;  2VPB A;  1K2F A;  2PNX A;  2G6Q A;  3IHP A;  4QQ4 A;  4LLB A;  1WEM A;  4GNE A;  3DDT A;  3ZVY A;  2JRJ A;  1WFK A;  5B75 A;  3M7K A;  3VK6 A;  2JM3 A;  5K3Q A;  1V87 A;  3FJU B;  5H1U A;  3DPL R;  2CT2 A;  5B78 A;  1X4U A;  3MHS A;  2ECJ A;  3MHH A;  2CSY A;  2VPG A;  2ECI A;  2JMI A;  4S3O B;  2ZET C;  2YHO A;  3FL2 A;  2LDR A;  4AYC A;  5AIT A;  3SUB A;  1WEV A;  2MUM A;  1FBV A;  1F62 A;  2ECV A;  4ZUX U;  2E6S A;  2ECT A;  4GB0 A;  4WZ3 B;  4UP5 A;  5TBN A;  2P57 A;  2LGK A;  3LDY A;  3KNV A;  3ZTG A;  4F1P A;  5SVI B;  1MM2 A;  4MVT A;  4MSX A;  4AYC B;  2RI7 A;  2MD8 C;  5TAB A;  3N9P A;  5TRB A;  4S3O C;  2L43 A;  2RSD A;  1E4U A;  5D1K B;  2MA6 A;  1N87 A;  4N4F A;  2E6R A;  4GNF A;  2UZG A;  4LKA A;  3LQI A;  2VJF A;  2YHN A;  2XOY A;  5JG6 A;  3LJU X;  4L7X A;  2Y1N A;  2KKX A;  4A4C A;  2BAY A;  1X4I A;  4V3L C;  3FM8 C;  2KGI A;  3DQV R;  5LKZ A;  2KKY A;  3LRQ A;  5EYA F;  2KWN A;  3U5P A;  3KQI A;  2CRW A;  3KV5 A;  2LAU A;  4X3G A;  4I7C A;  1WEP A;  1WIL A;  2D8S A;  2XOZ A;  3RPG B;  3C6W A;  1Z60 A;  2C2V S;  3LQJ A;  5G04 B;  4ZDT A;  4LAD B;  4I7D A;  3HCU A;  2FSA A;  4Q6F A;  2OWA A;  3JUE A;  1HYI A;  3FAN A;  4WZ0 A;  3O70 A;  3V43 A;  2MNY A;  4YBS A;  3U5M A;  4I7B A;  4IC3 A;  5B79 A;  4B7Y C;  2CON A;  2KWK A;  2VJE A;  4O62 A;  4P5O B;  2CRR A;  3RPG C;  4IC2 A;  2RR4 A;  4OGC A;  2ECG A; 
#chains in the Genus database with same CATH homology
 2I50 A;  1BOR A;  3I2D A;  5C11 A;  1WEW A;  3L1Z B;  3ZYQ A;  2FUI A;  5LKT A;  2ECN A;  2K1J A;  2VJE B;  2M85 A;  4R2Y A;  2M1R A;  4ZQL A;  3EB6 A;  1WEQ A;  5LKX A;  1X4J A;  1WEN A;  4GNG A;  2VP7 A;  2H0D A;  2Y1M A;  2QJ0 A;  5D1L B;  3O33 A;  3GV4 A;  4YBM A;  3M62 A;  3PUQ A;  5B76 A;  2IDA A;  2LRI C;  1DVP A;  5FB0 A;  1Z6U A;  1WE9 A;  4V3K C;  3N9M A;  2H0D B;  2KRE A;  3O7A A;  3N9N A;  1JM7 A;  4GND A;  2KE1 A;  4R7E A;  4A4B A;  3T7L A;  2CKL A;  2C2L A;  4O64 A;  5LCW B;  2KIZ A;  2YQL A;  5D1M B;  4YAT A;  1G25 A;  2VPD A;  1JM7 B;  4CA1 A;  1WEO A;  3QZV A;  2MT5 A;  2CKL B;  2HYE D;  1LDJ B;  2YQM A;  4XI1 A;  3SOU A;  2M6M A;  4F52 B;  3N9Q A;  5DIN A;  2LGL A;  2YUC A;  2YT5 A;  2CSZ A;  4BBQ A;  4AVX A;  2LXH C;  2EGP A;  5H1T A;  2F42 A;  1XWH A;  4PTB A;  3RTR B;  2G45 A;  4N3W A;  1U6G B;  3U5N A;  2K16 A;  2MA5 A;  3HTK C;  2EOD A;  4LJN A;  1Z2Q A;  3L11 A;  2JMJ A;  5TDR A;  1WES A;  2YSM A;  2PUY A;  2LGV A;  2JMD A;  3L1X A;  2L0B A;  2ECW A;  2YW8 A;  5KH7 A;  4R8P K;  3PHD A;  2F6J A;  4YAD A;  1ZBD B;  2NAA A;  4B86 C;  5AIU A;  1WIM A;  2F6N A;  4YAB A;  4QF3 A;  3HCT A;  1WGM A;  4CCG X;  5FER A;  5C13 A;  2MIQ A;  2M3H A;  5J3X A;  3HCS A;  2KGG A;  1VFY A;  1MM3 A;  3T6R A;  2K17 A;  5FB1 A;  2LXP C;  2YUR A;  3GL6 A;  2HDP A;  2VNF A;  4WA6 A;  4PPE A;  3SOX A;  2YU4 A;  5DKA A;  1JOC A;  3KV6 A;  4FJC A;  2L80 A;  2XB1 A;  1IYM A;  2MNZ A;  4AUQ B;  2DX8 A;  2FUU A;  3C5K A;  2L75 A;  1RMD A;  2AN6 A;  3EB5 A;  4L58 A;  4YBT A;  4BHW A;  4A49 A;  3U5O A;  4FK5 A;  1T1H A;  2MD7 B;  1FP0 A;  5LKU A;  4FIP A;  4TKP B;  4WZ2 A;  2EA6 A;  2YSJ A;  4A0C D;  2KR4 A;  4QF2 A;  4C9Z A;  5G0F A;  3O36 A;  2KWJ A;  3M63 A;  3SHB A;  2QIZ A;  2K4D A;  4UP0 A;  2KWO A;  4UI9 B;  3ZPV 1;  4W4U A;  2XEU A;  5FEY A;  2KYU A;  2QIC A;  3LQH A;  1WEE A;  4LK9 A;  1CHC A;  4YAX A;  5G05 B;  3ZNI A;  2L5U A;  1VYX A;  2LQ6 A;  3ZVZ B;  2G43 A;  2VJF B;  2LV9 A;  4NN2 A;  1WEU A;  3NG2 A;  3PUR A;  3M99 A;  2KU3 A;  5H1V A;  2VPE A;  2LGG A;  5I3L A;  5B77 A;  2OXQ C;  3ZPV E;  5B8D A;  3O35 A;  3N9O A;  3ASL A;  3N9L A;  4YC9 A;  2YYR A;  4AP4 A;  3O34 A;  5KH3 A;  3SOW A;  2LN0 A;  2KFT A;  1LDK C;  5KH9 A;  1VD4 A;  5TDW A;  4FO9 A;  1HYJ A;  3O37 A;  5H9M A;  2YRE A;  2Y43 A;  2VPB A;  1K2F A;  2PNX A;  2G6Q A;  3IHP A;  4LLB A;  1WEM A;  4GNE A;  3ZVY A;  2JRJ A;  1WFK A;  5B75 A;  3VK6 A;  1V87 A;  5H1U A;  3DPL R;  2CT2 A;  5B78 A;  1X4U A;  3MHS A;  2ECJ A;  3MHH A;  2CSY A;  2VPG A;  2ECI A;  2JMI A;  4S3O B;  2ZET C;  2YHO A;  3FL2 A;  2LDR A;  4AYC A;  5AIT A;  1WEV A;  2MUM A;  1FBV A;  1F62 A;  2ECV A;  4ZUX U;  2E6S A;  2ECT A;  4GB0 A;  4WZ3 B;  4UP5 A;  5TBN A;  2LGK A;  3KNV A;  3ZTG A;  1MM2 A;  4MVT A;  4MSX A;  4AYC B;  2RI7 A;  2MD8 C;  5TAB A;  3N9P A;  5TRB A;  4S3O C;  2L43 A;  2RSD A;  1E4U A;  5D1K B;  2MA6 A;  1N87 A;  4N4F A;  2E6R A;  4GNF A;  2UZG A;  4LKA A;  3LQI A;  2VJF A;  2YHN A;  5JG6 A;  4L7X A;  2Y1N A;  4A4C A;  2BAY A;  1X4I A;  4V3L C;  2KGI A;  3DQV R;  5LKZ A;  3LRQ A;  5EYA F;  2KWN A;  3U5P A;  3KQI A;  3KV5 A;  4X3G A;  4I7C A;  1WEP A;  1WIL A;  2D8S A;  3RPG B;  3C6W A;  1Z60 A;  2C2V S;  3LQJ A;  5G04 B;  4ZDT A;  4LAD B;  4I7D A;  3HCU A;  2FSA A;  4Q6F A;  1HYI A;  4WZ0 A;  3O70 A;  3V43 A;  2MNY A;  4YBS A;  3U5M A;  4I7B A;  4IC3 A;  5B79 A;  4B7Y C;  2KWK A;  2VJE A;  4P5O B;  3RPG C;  4IC2 A;  2ECG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...