4AYCB

Rnf8 ring domain structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
126
Chain Sequence
b'KDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNINKMVNNLSSEVKERRIVLIRERKAKRLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 42
structure length 126
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycB02
4FIPA 2QJ0A 4WA6A 5TDWA 2MD8C 2Y1NA 1Z6UA 2D8SA 2LN0A 2MA5A 4V3KC 4O64A 4R2YA 5KH9A 2L0BA 2YQMA 4PTBA 3O37A 1X4IA 4AYCA 4LLBA 2G6QA 2VJEB 1WENA 2OXQC 1HYJA 4YAXA 1V87A 3T6RA 1VFYA 3HCUA 3O70A 4QF2A 3HCTA 5H1TA 2M85A 2K16A 3I2DA 3M62A 2BAYA 1WGMA 1WEUA 4GNGA 1WEEA 5KH7A 4LJNA 2KR4A 4P5OB 2KYUA 2KE1A 3IHPA 5B75A 4UI9B 4FK5A 1JM7B 2VPGA 2JMDA 4B7YC 2F42A 3RPGC 2MNZA 2MNYA 2M3HA 1VYXA 5KH3A 5LKZA 5I3LA 2M1RA 3C5KA 2I50A 2KWKA 4S3OB 5LCWB 2MIQA 2UZGA 4ZDTA 2CSYA 3MHSA 2YUCA 3SOXA 5D1MB 4LK9A 4ZUXU 3PHDA 1WILA 1DVPA 4WZ0A 3ZYQA 4S3OC 5B8DA 2ECVA 3N9LA 4LADB 1WE9A 2KWOA 3ZPV1 2KIZA 2JMJA 2KGIA 4R7EA 4WZ2A 2ECTA 4NN2A 4PPEA 3SOUA 3ZPVE 4A49A 5FB0A 5G0FA 5TRBA 2H0DB 3SHBA 2KWJA 2HDPA 2K1JA 2DX8A 1JOCA 2VNFA 2CKLB 2VP7A 4CCGX 2LDRA 4N3WA 1WEQA 3LQJA 4N4FA 3L1ZB 1LDJB 3L11A 1E4UA 4AYCB 4CA1A 2ZETC 2XEUA 3PUQA 3ZVZB 1WIMA 4BHWA 1WEOA 2LGLA 3M63A 5J3XA 1IYMA 2YHNA 1Z2QA 2QIZA 1WEVA 4IC3A 5DKAA 4Q6FA 5B76A 3GL6A 2FSAA 3M99A 4IC2A 4UP5A 5LKXA 5G05B 2VJEA 3U5MA 2Y43A 3O33A 2ECGA 4LKAA 2L5UA 5G04B 2L43A 3EB6A 2VJFB 2LGGA 4GB0A 2IDAA 2Y1MA 4XI1A 4L58A 3ZVYA 3DQVR 3ZTGA 3GV4A 4R8PK 2RI7A 3ASLA 4MVTA 5D1KB 5B78A 5C11A 2YW8A 3SOWA 5B79A 3L1XA 3HCSA 1G25A 4W4UA 2XB1A 3KV5A 2CSZA 2F6NA 5H1UA 1T1HA 2VPDA 4WZ3B 4A4CA 1MM3A 4QF3A 4V3LC 3HTKC 2YSMA 2YURA 1ZBDB 1X4UA 2VPBA 1X4JA 4YBSA 2JMIA 2LXHC 5H1VA 2HYED 2LV9A 5B77A 4YATA 2C2VS 1N87A 1BORA 2FUIA 3NG2A 1F62A 5AIUA 4MSXA 1FP0A 4YBMA 3DPLR 4BBQA 3N9NA 3EB5A 3LQIA 2E6SA 4YC9A 1WEPA 3U5PA 2EA6A 5DINA 1WEWA 4YABA 3O35A 2C2LA 3FL2A 1CHCA 5FEYA 1WFKA 2NAAA 3U5OA 2LXPC 4A0CD 4AUQB 4I7CA 5H9MA 4FJCA 2KU3A 2YU4A 2G43A 3N9PA 5EYAF 2YT5A 2YREA 5FB1A 3N9QA 5C13A 3U5NA 2F6JA 1WESA 3O34A 4C9ZA 2G45A 2YHOA 4YBTA 5TABA 3KNVA 1XWHA 3N9OA 2MUMA 3C6WA 1WEMA 1RMDA 1VD4A 5D1LB 2EODA 4GNEA 3LRQA 2YYRA 2L80A 2ECIA 2KWNA 3KQIA 3RTRB 2MA6A 4I7DA 2LGVA 5AITA 3RPGB 2VJFA 2PUYA 4F52B 1K2FA 2JRJA 4FO9A 3O36A 1MM2A 2LRIC 1JM7A 2LQ6A 4YADA 3QZVA 4GNDA 2FUUA 2RSDA 2K4DA 2L75A 3VK6A 2ECWA 2PNXA 4ZQLA 3LQHA 2KGGA 2LGKA 2ECJA 4A4BA 2KFTA 2YQLA 2CT2A 2KREA 4GNFA 3MHHA 4TKPB 3PURA 1FBVA 1LDKC 2MT5A 4AVXA 2VPEA 3O7AA 5FERA 2M6MA 2E6RA 2MD7B 4UP0A 4AP4A 5TDRA 2YSJA 3N9MA 5LKTA 2EGPA 5LKUA 3KV6A 5JG6A 4X3GA 4L7XA 4B86C 3V43A 2AN6A 3ZNIA 2H0DA 2ECNA 5TBNA 1HYIA 1U6GB 4I7BA 3T7LA 1Z60A 2CKLA 2QICA 2K17A
chains in the Genus database with same CATH superfamily
4FIPA 2QJ0A 4WA6A 5TDWA 2MD8C 2Y1NA 1Z6UA 2D8SA 2LN0A 2MA5A 2OWAA 4V3KC 4O64A 4R2YA 3DDTA 5KH9A 2L0BA 2YQMA 4PTBA 3O37A 1X4IA 4AYCA 4LLBA 2DSMA 2G6QA 2VJEB 1WENA 5SVIB 2OXQC 1HYJA 2LAUA 4YAXA 1V87A 3T6RA 3M7KA 5SVYA 1VFYA 2FFWA 3HCUA 3O70A 4QF2A 3HCTA 5H1TA 1MBMA 1DCQA 2M85A 2K16A 3I2DA 3M62A 2BAYA 1WGMA 1WEUA 4GNGA 1WEEA 5KH7A 4LJNA 2JM3A 2KR4A 4P5OB 2KYUA 2KE1A 3IHPA 5B75A 4UI9B 4FK5A 1JM7B 2VPGA 2JMDA 2B0OE 4B7YC 2F42A 3RPGC 2MNZA 2MNYA 2M3HA 4H9DA 1VYXA 2D8UA 2KKYA 5KH3A 5LKZA 5I3LA 2M1RA 3C5KA 2I50A 2KWKA 3FM8C 4S3OB 5LCWB 2MIQA 2UZGA 4ZDTA 2CSYA 3MHSA 2YUCA 3SOXA 3O47A 5D1MB 4LK9A 4ZUXU 3PHDA 1WILA 1DVPA 4WZ0A 3ZYQA 4S3OC 5B8DA 2ECVA 3N9LA 4LADB 1WE9A 2KWOA 3ZPV1 2KIZA 2JMJA 2KGIA 4R7EA 4WZ2A 2ECTA 4NN2A 3E2DA 4PPEA 3SOUA 3ZPVE 4A49A 5FB0A 5G0FA 2JUNA 5TRBA 2H0DB 3SHBA 2KWJA 2HDPA 2K1JA 4OGCA 2DX8A 3FANA 1JOCA 2VNFA 2CKLB 2MKEA 2VP7A 4CCGX 3Q1DA 2LDRA 4N3WA 1WEQA 3LQJA 4N4FA 3L1ZB 1LDJB 2IQJA 3L11A 2YVRA 1E4UA 3FJUB 4AYCB 4CA1A 2RR4A 2ZETC 2XEUA 3PUQA 3ZVZB 1WIMA 4BHWA 1WEOA 2LGLA 3M63A 5J3XA 1IYMA 2YHNA 1Z2QA 2CSVA 2QIZA 1WEVA 4IC3A 5DKAA 4Z0OA 4Q6FA 3T9KA 2FD4A 5B76A 3GL6A 2FSAA 3M99A 4IC2A 4UP5A 5LKXA 5G05B 2VJEA 3U5MA 5SVIA 2Y43A 3O33A 2XP0A 2ECGA 4LKAA 2L5UA 5G04B 2L43A 3EB6A 2VJFB 2LGGA 4GB0A 2XOCA 2IDAA 2Y1MA 4XI1A 4L58A 3ZVYA 3DQVR 3ZTGA 3GV4A 4R8PK 2RI7A 3ASLA 4MVTA 5D1KB 5B78A 5C11A 2YW8A 3SOWA 5B79A 2XOZA 3L1XA 3HCSA 3FAOA 1G25A 4W4UA 2XB1A 3KV5A 2CSZA 2L7PA 2F6NA 5H1UA 1T1HA 2VPDA 4WZ3B 4A4CA 2KKXA 1MM3A 4QF3A 4V3LC 3HTKC 2YSMA 2YURA 1ZBDB 1X4UA 2VPBA 1X4JA 4YBSA 2JMIA 2LXHC 5H1VA 2HYED 2LV9A 5B77A 4YATA 2C2VS 3LVQE 1N87A 1BORA 2FUIA 3NG2A 3MDBC 1F62A 5AIUA 4Z0RA 4MSXA 1FP0A 3LDYA 4YBMA 3DPLR 4BBQA 3N9NA 3EB5A 3H7HA 3LQIA 2E6SA 4YC9A 1WEPA 3U5PA 2EA6A 5DINA 1WEWA 4YABA 3O35A 2C2LA 3FL2A 1CHCA 5FEYA 2E61A 2CONA 1WFKA 2NAAA 4OGEA 3U5OA 2LXPC 4A0CD 4AUQB 4I7CA 5H9MA 4FJCA 2KU3A 2YU4A 2G43A 3N9PA 2DJAA 4F1PA 2EGMA 5EYAF 2YT5A 3DWDA 2YREA 5FB1A 3N9QA 5C13A 3U5NA 2F6JA 1WESA 3O34A 4C9ZA 2G45A 2YHOA 4YBTA 5TABA 3KNVA 1XWHA 3N9OA 3LVRE 2MUMA 3C6WA 1WEMA 1RMDA 1VD4A 5D1LB 2EODA 4GNEA 3LRQA 2M13A 2YYRA 2L80A 2ECIA 2KWNA 3KQIA 3RTRB 2MA6A 3LJUX 4I7DA 2LGVA 5AITA 3RPGB 2XOYA 5SVXA 2VJFA 2PUYA 4F52B 1K2FA 2JRJA 4FO9A 3O36A 1MM2A 2LRIC 1JM7A 2LQ6A 4YADA 3QZVA 2CRRA 4GNDA 2FUUA 5K3QA 4QQ4A 2RSDA 2K4DA 2L75A 3VK6A 2ECWA 2PNXA 4ZQLA 3LQHA 2KGGA 2LGKA 2ECJA 4A4BA 3FEHA 2KFTA 2YQLA 2CT2A 2KREA 4GNFA 3MHHA 4TKPB 3JUEA 2CRWA 3PURA 1FBVA 1LDKC 2MT5A 4AVXA 2VPEA 3O7AA 5FERA 2M6MA 2E6RA 2MD7B 4UP0A 2P57A 3SUBA 4AP4A 5TDRA 2YSJA 3N9MA 5LKTA 4O62A 2EGPA 5LKUA 3KV6A 5JG6A 4X3GA 4L7XA 4B86C 2EXUA 3V43A 2AN6A 3ZNIA 2H0DA 2ECNA 5TBNA 1HYIA 1U6GB 4I7BA 3T7LA 3PLWA 1Z60A 3KDEC 2CKLA 2QICA 2K17A
chains in the Genus database with same CATH topology
4FIPA 2QJ0A 4WA6A 5TDWA 2MD8C 2Y1NA 1Z6UA 2D8SA 2LN0A 2MA5A 4V3KC 4O64A 4R2YA 5KH9A 2L0BA 2YQMA 4PTBA 3O37A 1X4IA 4AYCA 4LLBA 2G6QA 2VJEB 1WENA 2OXQC 1HYJA 4YAXA 1V87A 3T6RA 1VFYA 3HCUA 3O70A 4QF2A 3HCTA 5H1TA 2M85A 2K16A 3I2DA 3M62A 2BAYA 1WGMA 1WEUA 4GNGA 1WEEA 5KH7A 4LJNA 2KR4A 4P5OB 2KYUA 2KE1A 3IHPA 5B75A 4UI9B 4FK5A 1JM7B 2VPGA 2JMDA 4B7YC 2F42A 3RPGC 2MNZA 2MNYA 2M3HA 1VYXA 5KH3A 5LKZA 5I3LA 2M1RA 3C5KA 2I50A 2KWKA 4S3OB 5LCWB 2MIQA 2UZGA 4ZDTA 2CSYA 3MHSA 2YUCA 3SOXA 5D1MB 4LK9A 4ZUXU 3PHDA 1WILA 1DVPA 4WZ0A 3ZYQA 4S3OC 5B8DA 2ECVA 3N9LA 4LADB 1WE9A 2KWOA 3ZPV1 2KIZA 2JMJA 2KGIA 4R7EA 4WZ2A 2ECTA 4NN2A 4PPEA 3SOUA 3ZPVE 4A49A 5FB0A 5G0FA 5TRBA 2H0DB 3SHBA 2KWJA 2HDPA 2K1JA 2DX8A 1JOCA 2VNFA 2CKLB 2VP7A 4CCGX 2LDRA 4N3WA 1WEQA 3LQJA 4N4FA 3L1ZB 1LDJB 3L11A 1E4UA 4AYCB 4CA1A 2ZETC 2XEUA 3PUQA 3ZVZB 1WIMA 4BHWA 1WEOA 2LGLA 3M63A 5J3XA 1IYMA 2YHNA 1Z2QA 2QIZA 1WEVA 4IC3A 5DKAA 4Q6FA 5B76A 3GL6A 2FSAA 3M99A 4IC2A 4UP5A 5LKXA 5G05B 2VJEA 3U5MA 2Y43A 3O33A 2ECGA 4LKAA 2L5UA 5G04B 2L43A 3EB6A 2VJFB 2LGGA 4GB0A 2IDAA 2Y1MA 4XI1A 4L58A 3ZVYA 3DQVR 3ZTGA 3GV4A 4R8PK 2RI7A 3ASLA 4MVTA 5D1KB 5B78A 5C11A 2YW8A 3SOWA 5B79A 3L1XA 3HCSA 1G25A 4W4UA 2XB1A 3KV5A 2CSZA 2F6NA 5H1UA 1T1HA 2VPDA 4WZ3B 4A4CA 1MM3A 4QF3A 4V3LC 3HTKC 2YSMA 2YURA 1ZBDB 1X4UA 2VPBA 1X4JA 4YBSA 2JMIA 2LXHC 5H1VA 2HYED 2LV9A 5B77A 4YATA 2C2VS 1N87A 1BORA 2FUIA 3NG2A 1F62A 5AIUA 4MSXA 1FP0A 4YBMA 3DPLR 4BBQA 3N9NA 3EB5A 3LQIA 2E6SA 4YC9A 1WEPA 3U5PA 2EA6A 5DINA 1WEWA 4YABA 3O35A 2C2LA 3FL2A 1CHCA 5FEYA 1WFKA 2NAAA 3U5OA 2LXPC 4A0CD 4AUQB 4I7CA 5H9MA 4FJCA 2KU3A 2YU4A 2G43A 3N9PA 5EYAF 2YT5A 2YREA 5FB1A 3N9QA 5C13A 3U5NA 2F6JA 1WESA 3O34A 4C9ZA 2G45A 2YHOA 4YBTA 5TABA 3KNVA 1XWHA 3N9OA 2MUMA 3C6WA 1WEMA 1RMDA 1VD4A 5D1LB 2EODA 4GNEA 3LRQA 2YYRA 2L80A 2ECIA 2KWNA 3KQIA 3RTRB 2MA6A 4I7DA 2LGVA 5AITA 3RPGB 2VJFA 2PUYA 4F52B 1K2FA 2JRJA 4FO9A 3O36A 1MM2A 2LRIC 1JM7A 2LQ6A 4YADA 3QZVA 4GNDA 2FUUA 2RSDA 2K4DA 2L75A 3VK6A 2ECWA 2PNXA 4ZQLA 3LQHA 2KGGA 2LGKA 2ECJA 4A4BA 2KFTA 2YQLA 2CT2A 2KREA 4GNFA 3MHHA 4TKPB 3PURA 1FBVA 1LDKC 2MT5A 4AVXA 2VPEA 3O7AA 5FERA 2M6MA 2E6RA 2MD7B 4UP0A 4AP4A 5TDRA 2YSJA 3N9MA 5LKTA 2EGPA 5LKUA 3KV6A 5JG6A 4X3GA 4L7XA 4B86C 3V43A 2AN6A 3ZNIA 2H0DA 2ECNA 5TBNA 1HYIA 1U6GB 4I7BA 3T7LA 1Z60A 2CKLA 2QICA 2K17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIP A;  2QJ0 A;  4WA6 A;  5TDW A;  2MD8 C;  2Y1N A;  1Z6U A;  2D8S A;  2LN0 A;  2MA5 A;  4V3K C;  4O64 A;  4R2Y A;  5KH9 A;  2L0B A;  2YQM A;  4PTB A;  3O37 A;  1X4I A;  4AYC A;  4LLB A;  2G6Q A;  2VJE B;  1WEN A;  2OXQ C;  1HYJ A;  4YAX A;  1V87 A;  3T6R A;  1VFY A;  3HCU A;  3O70 A;  4QF2 A;  3HCT A;  5H1T A;  2M85 A;  2K16 A;  3I2D A;  3M62 A;  2BAY A;  1WGM A;  1WEU A;  4GNG A;  1WEE A;  5KH7 A;  4LJN A;  2KR4 A;  4P5O B;  2KYU A;  2KE1 A;  3IHP A;  5B75 A;  4UI9 B;  4FK5 A;  1JM7 B;  2VPG A;  2JMD A;  4B7Y C;  2F42 A;  3RPG C;  2MNZ A;  2MNY A;  2M3H A;  1VYX A;  5KH3 A;  5LKZ A;  5I3L A;  2M1R A;  3C5K A;  2I50 A;  2KWK A;  4S3O B;  5LCW B;  2MIQ A;  2UZG A;  4ZDT A;  2CSY A;  3MHS A;  2YUC A;  3SOX A;  5D1M B;  4LK9 A;  4ZUX U;  3PHD A;  1WIL A;  1DVP A;  4WZ0 A;  3ZYQ A;  4S3O C;  5B8D A;  2ECV A;  3N9L A;  4LAD B;  1WE9 A;  2KWO A;  3ZPV 1;  2KIZ A;  2JMJ A;  2KGI A;  4R7E A;  4WZ2 A;  2ECT A;  4NN2 A;  4PPE A;  3SOU A;  3ZPV E;  4A49 A;  5FB0 A;  5G0F A;  5TRB A;  2H0D B;  3SHB A;  2KWJ A;  2HDP A;  2K1J A;  2DX8 A;  1JOC A;  2VNF A;  2CKL B;  2VP7 A;  4CCG X;  2LDR A;  4N3W A;  1WEQ A;  3LQJ A;  4N4F A;  3L1Z B;  1LDJ B;  3L11 A;  1E4U A;  4AYC B;  4CA1 A;  2ZET C;  2XEU A;  3PUQ A;  3ZVZ B;  1WIM A;  4BHW A;  1WEO A;  2LGL A;  3M63 A;  5J3X A;  1IYM A;  2YHN A;  1Z2Q A;  2QIZ A;  1WEV A;  4IC3 A;  5DKA A;  4Q6F A;  5B76 A;  3GL6 A;  2FSA A;  3M99 A;  4IC2 A;  4UP5 A;  5LKX A;  5G05 B;  2VJE A;  3U5M A;  2Y43 A;  3O33 A;  2ECG A;  4LKA A;  2L5U A;  5G04 B;  2L43 A;  3EB6 A;  2VJF B;  2LGG A;  4GB0 A;  2IDA A;  2Y1M A;  4XI1 A;  4L58 A;  3ZVY A;  3DQV R;  3ZTG A;  3GV4 A;  4R8P K;  2RI7 A;  3ASL A;  4MVT A;  5D1K B;  5B78 A;  5C11 A;  2YW8 A;  3SOW A;  5B79 A;  3L1X A;  3HCS A;  1G25 A;  4W4U A;  2XB1 A;  3KV5 A;  2CSZ A;  2F6N A;  5H1U A;  1T1H A;  2VPD A;  4WZ3 B;  4A4C A;  1MM3 A;  4QF3 A;  4V3L C;  3HTK C;  2YSM A;  2YUR A;  1ZBD B;  1X4U A;  2VPB A;  1X4J A;  4YBS A;  2JMI A;  2LXH C;  5H1V A;  2HYE D;  2LV9 A;  5B77 A;  4YAT A;  2C2V S;  1N87 A;  1BOR A;  2FUI A;  3NG2 A;  1F62 A;  5AIU A;  4MSX A;  1FP0 A;  4YBM A;  3DPL R;  4BBQ A;  3N9N A;  3EB5 A;  3LQI A;  2E6S A;  4YC9 A;  1WEP A;  3U5P A;  2EA6 A;  5DIN A;  1WEW A;  4YAB A;  3O35 A;  2C2L A;  3FL2 A;  1CHC A;  5FEY A;  1WFK A;  2NAA A;  3U5O A;  2LXP C;  4A0C D;  4AUQ B;  4I7C A;  5H9M A;  4FJC A;  2KU3 A;  2YU4 A;  2G43 A;  3N9P A;  5EYA F;  2YT5 A;  2YRE A;  5FB1 A;  3N9Q A;  5C13 A;  3U5N A;  2F6J A;  1WES A;  3O34 A;  4C9Z A;  2G45 A;  2YHO A;  4YBT A;  5TAB A;  3KNV A;  1XWH A;  3N9O A;  2MUM A;  3C6W A;  1WEM A;  1RMD A;  1VD4 A;  5D1L B;  2EOD A;  4GNE A;  3LRQ A;  2YYR A;  2L80 A;  2ECI A;  2KWN A;  3KQI A;  3RTR B;  2MA6 A;  4I7D A;  2LGV A;  5AIT A;  3RPG B;  2VJF A;  2PUY A;  4F52 B;  1K2F A;  2JRJ A;  4FO9 A;  3O36 A;  1MM2 A;  2LRI C;  1JM7 A;  2LQ6 A;  4YAD A;  3QZV A;  4GND A;  2FUU A;  2RSD A;  2K4D A;  2L75 A;  3VK6 A;  2ECW A;  2PNX A;  4ZQL A;  3LQH A;  2KGG A;  2LGK A;  2ECJ A;  4A4B A;  2KFT A;  2YQL A;  2CT2 A;  2KRE A;  4GNF A;  3MHH A;  4TKP B;  3PUR A;  1FBV A;  1LDK C;  2MT5 A;  4AVX A;  2VPE A;  3O7A A;  5FER A;  2M6M A;  2E6R A;  2MD7 B;  4UP0 A;  4AP4 A;  5TDR A;  2YSJ A;  3N9M A;  5LKT A;  2EGP A;  5LKU A;  3KV6 A;  5JG6 A;  4X3G A;  4L7X A;  4B86 C;  3V43 A;  2AN6 A;  3ZNI A;  2H0D A;  2ECN A;  5TBN A;  1HYI A;  1U6G B;  4I7B A;  3T7L A;  1Z60 A;  2CKL A;  2QIC A;  2K17 A; 
#chains in the Genus database with same CATH topology
 4FIP A;  2QJ0 A;  4WA6 A;  5TDW A;  2MD8 C;  2Y1N A;  1Z6U A;  2D8S A;  2LN0 A;  2MA5 A;  2OWA A;  4V3K C;  4O64 A;  4R2Y A;  3DDT A;  5KH9 A;  2L0B A;  2YQM A;  4PTB A;  3O37 A;  1X4I A;  4AYC A;  4LLB A;  2DSM A;  2G6Q A;  2VJE B;  1WEN A;  5SVI B;  2OXQ C;  1HYJ A;  2LAU A;  4YAX A;  1V87 A;  3T6R A;  3M7K A;  5SVY A;  1VFY A;  2FFW A;  3HCU A;  3O70 A;  4QF2 A;  3HCT A;  5H1T A;  1MBM A;  1DCQ A;  2M85 A;  2K16 A;  3I2D A;  3M62 A;  2BAY A;  1WGM A;  1WEU A;  4GNG A;  1WEE A;  5KH7 A;  4LJN A;  2JM3 A;  2KR4 A;  4P5O B;  2KYU A;  2KE1 A;  3IHP A;  5B75 A;  4UI9 B;  4FK5 A;  1JM7 B;  2VPG A;  2JMD A;  2B0O E;  4B7Y C;  2F42 A;  3RPG C;  2MNZ A;  2MNY A;  2M3H A;  4H9D A;  1VYX A;  2D8U A;  2KKY A;  5KH3 A;  5LKZ A;  5I3L A;  2M1R A;  3C5K A;  2I50 A;  2KWK A;  3FM8 C;  4S3O B;  5LCW B;  2MIQ A;  2UZG A;  4ZDT A;  2CSY A;  3MHS A;  2YUC A;  3SOX A;  3O47 A;  5D1M B;  4LK9 A;  4ZUX U;  3PHD A;  1WIL A;  1DVP A;  4WZ0 A;  3ZYQ A;  4S3O C;  5B8D A;  2ECV A;  3N9L A;  4LAD B;  1WE9 A;  2KWO A;  3ZPV 1;  2KIZ A;  2JMJ A;  2KGI A;  4R7E A;  4WZ2 A;  2ECT A;  4NN2 A;  3E2D A;  4PPE A;  3SOU A;  3ZPV E;  4A49 A;  5FB0 A;  5G0F A;  2JUN A;  5TRB A;  2H0D B;  3SHB A;  2KWJ A;  2HDP A;  2K1J A;  4OGC A;  2DX8 A;  3FAN A;  1JOC A;  2VNF A;  2CKL B;  2MKE A;  2VP7 A;  4CCG X;  3Q1D A;  2LDR A;  4N3W A;  1WEQ A;  3LQJ A;  4N4F A;  3L1Z B;  1LDJ B;  2IQJ A;  3L11 A;  2YVR A;  1E4U A;  3FJU B;  4AYC B;  4CA1 A;  2RR4 A;  2ZET C;  2XEU A;  3PUQ A;  3ZVZ B;  1WIM A;  4BHW A;  1WEO A;  2LGL A;  3M63 A;  5J3X A;  1IYM A;  2YHN A;  1Z2Q A;  2CSV A;  2QIZ A;  1WEV A;  4IC3 A;  5DKA A;  4Z0O A;  4Q6F A;  3T9K A;  2FD4 A;  5B76 A;  3GL6 A;  2FSA A;  3M99 A;  4IC2 A;  4UP5 A;  5LKX A;  5G05 B;  2VJE A;  3U5M A;  5SVI A;  2Y43 A;  3O33 A;  2XP0 A;  2ECG A;  4LKA A;  2L5U A;  5G04 B;  2L43 A;  3EB6 A;  2VJF B;  2LGG A;  4GB0 A;  2XOC A;  2IDA A;  2Y1M A;  4XI1 A;  4L58 A;  3ZVY A;  3DQV R;  3ZTG A;  3GV4 A;  4R8P K;  2RI7 A;  3ASL A;  4MVT A;  5D1K B;  5B78 A;  5C11 A;  2YW8 A;  3SOW A;  5B79 A;  2XOZ A;  3L1X A;  3HCS A;  3FAO A;  1G25 A;  4W4U A;  2XB1 A;  3KV5 A;  2CSZ A;  2L7P A;  2F6N A;  5H1U A;  1T1H A;  2VPD A;  4WZ3 B;  4A4C A;  2KKX A;  1MM3 A;  4QF3 A;  4V3L C;  3HTK C;  2YSM A;  2YUR A;  1ZBD B;  1X4U A;  2VPB A;  1X4J A;  4YBS A;  2JMI A;  2LXH C;  5H1V A;  2HYE D;  2LV9 A;  5B77 A;  4YAT A;  2C2V S;  3LVQ E;  1N87 A;  1BOR A;  2FUI A;  3NG2 A;  3MDB C;  1F62 A;  5AIU A;  4Z0R A;  4MSX A;  1FP0 A;  3LDY A;  4YBM A;  3DPL R;  4BBQ A;  3N9N A;  3EB5 A;  3H7H A;  3LQI A;  2E6S A;  4YC9 A;  1WEP A;  3U5P A;  2EA6 A;  5DIN A;  1WEW A;  4YAB A;  3O35 A;  2C2L A;  3FL2 A;  1CHC A;  5FEY A;  2E61 A;  2CON A;  1WFK A;  2NAA A;  4OGE A;  3U5O A;  2LXP C;  4A0C D;  4AUQ B;  4I7C A;  5H9M A;  4FJC A;  2KU3 A;  2YU4 A;  2G43 A;  3N9P A;  2DJA A;  4F1P A;  2EGM A;  5EYA F;  2YT5 A;  3DWD A;  2YRE A;  5FB1 A;  3N9Q A;  5C13 A;  3U5N A;  2F6J A;  1WES A;  3O34 A;  4C9Z A;  2G45 A;  2YHO A;  4YBT A;  5TAB A;  3KNV A;  1XWH A;  3N9O A;  3LVR E;  2MUM A;  3C6W A;  1WEM A;  1RMD A;  1VD4 A;  5D1L B;  2EOD A;  4GNE A;  3LRQ A;  2M13 A;  2YYR A;  2L80 A;  2ECI A;  2KWN A;  3KQI A;  3RTR B;  2MA6 A;  3LJU X;  4I7D A;  2LGV A;  5AIT A;  3RPG B;  2XOY A;  5SVX A;  2VJF A;  2PUY A;  4F52 B;  1K2F A;  2JRJ A;  4FO9 A;  3O36 A;  1MM2 A;  2LRI C;  1JM7 A;  2LQ6 A;  4YAD A;  3QZV A;  2CRR A;  4GND A;  2FUU A;  5K3Q A;  4QQ4 A;  2RSD A;  2K4D A;  2L75 A;  3VK6 A;  2ECW A;  2PNX A;  4ZQL A;  3LQH A;  2KGG A;  2LGK A;  2ECJ A;  4A4B A;  3FEH A;  2KFT A;  2YQL A;  2CT2 A;  2KRE A;  4GNF A;  3MHH A;  4TKP B;  3JUE A;  2CRW A;  3PUR A;  1FBV A;  1LDK C;  2MT5 A;  4AVX A;  2VPE A;  3O7A A;  5FER A;  2M6M A;  2E6R A;  2MD7 B;  4UP0 A;  2P57 A;  3SUB A;  4AP4 A;  5TDR A;  2YSJ A;  3N9M A;  5LKT A;  4O62 A;  2EGP A;  5LKU A;  3KV6 A;  5JG6 A;  4X3G A;  4L7X A;  4B86 C;  2EXU A;  3V43 A;  2AN6 A;  3ZNI A;  2H0D A;  2ECN A;  5TBN A;  1HYI A;  1U6G B;  4I7B A;  3T7L A;  3PLW A;  1Z60 A;  3KDE C;  2CKL A;  2QIC A;  2K17 A; 
#chains in the Genus database with same CATH homology
 4FIP A;  2QJ0 A;  4WA6 A;  5TDW A;  2MD8 C;  2Y1N A;  1Z6U A;  2D8S A;  2LN0 A;  2MA5 A;  4V3K C;  4O64 A;  4R2Y A;  5KH9 A;  2L0B A;  2YQM A;  4PTB A;  3O37 A;  1X4I A;  4AYC A;  4LLB A;  2G6Q A;  2VJE B;  1WEN A;  2OXQ C;  1HYJ A;  4YAX A;  1V87 A;  3T6R A;  1VFY A;  3HCU A;  3O70 A;  4QF2 A;  3HCT A;  5H1T A;  2M85 A;  2K16 A;  3I2D A;  3M62 A;  2BAY A;  1WGM A;  1WEU A;  4GNG A;  1WEE A;  5KH7 A;  4LJN A;  2KR4 A;  4P5O B;  2KYU A;  2KE1 A;  3IHP A;  5B75 A;  4UI9 B;  4FK5 A;  1JM7 B;  2VPG A;  2JMD A;  4B7Y C;  2F42 A;  3RPG C;  2MNZ A;  2MNY A;  2M3H A;  1VYX A;  5KH3 A;  5LKZ A;  5I3L A;  2M1R A;  3C5K A;  2I50 A;  2KWK A;  4S3O B;  5LCW B;  2MIQ A;  2UZG A;  4ZDT A;  2CSY A;  3MHS A;  2YUC A;  3SOX A;  5D1M B;  4LK9 A;  4ZUX U;  3PHD A;  1WIL A;  1DVP A;  4WZ0 A;  3ZYQ A;  4S3O C;  5B8D A;  2ECV A;  3N9L A;  4LAD B;  1WE9 A;  2KWO A;  3ZPV 1;  2KIZ A;  2JMJ A;  2KGI A;  4R7E A;  4WZ2 A;  2ECT A;  4NN2 A;  4PPE A;  3SOU A;  3ZPV E;  4A49 A;  5FB0 A;  5G0F A;  5TRB A;  2H0D B;  3SHB A;  2KWJ A;  2HDP A;  2K1J A;  2DX8 A;  1JOC A;  2VNF A;  2CKL B;  2VP7 A;  4CCG X;  2LDR A;  4N3W A;  1WEQ A;  3LQJ A;  4N4F A;  3L1Z B;  1LDJ B;  3L11 A;  1E4U A;  4AYC B;  4CA1 A;  2ZET C;  2XEU A;  3PUQ A;  3ZVZ B;  1WIM A;  4BHW A;  1WEO A;  2LGL A;  3M63 A;  5J3X A;  1IYM A;  2YHN A;  1Z2Q A;  2QIZ A;  1WEV A;  4IC3 A;  5DKA A;  4Q6F A;  5B76 A;  3GL6 A;  2FSA A;  3M99 A;  4IC2 A;  4UP5 A;  5LKX A;  5G05 B;  2VJE A;  3U5M A;  2Y43 A;  3O33 A;  2ECG A;  4LKA A;  2L5U A;  5G04 B;  2L43 A;  3EB6 A;  2VJF B;  2LGG A;  4GB0 A;  2IDA A;  2Y1M A;  4XI1 A;  4L58 A;  3ZVY A;  3DQV R;  3ZTG A;  3GV4 A;  4R8P K;  2RI7 A;  3ASL A;  4MVT A;  5D1K B;  5B78 A;  5C11 A;  2YW8 A;  3SOW A;  5B79 A;  3L1X A;  3HCS A;  1G25 A;  4W4U A;  2XB1 A;  3KV5 A;  2CSZ A;  2F6N A;  5H1U A;  1T1H A;  2VPD A;  4WZ3 B;  4A4C A;  1MM3 A;  4QF3 A;  4V3L C;  3HTK C;  2YSM A;  2YUR A;  1ZBD B;  1X4U A;  2VPB A;  1X4J A;  4YBS A;  2JMI A;  2LXH C;  5H1V A;  2HYE D;  2LV9 A;  5B77 A;  4YAT A;  2C2V S;  1N87 A;  1BOR A;  2FUI A;  3NG2 A;  1F62 A;  5AIU A;  4MSX A;  1FP0 A;  4YBM A;  3DPL R;  4BBQ A;  3N9N A;  3EB5 A;  3LQI A;  2E6S A;  4YC9 A;  1WEP A;  3U5P A;  2EA6 A;  5DIN A;  1WEW A;  4YAB A;  3O35 A;  2C2L A;  3FL2 A;  1CHC A;  5FEY A;  1WFK A;  2NAA A;  3U5O A;  2LXP C;  4A0C D;  4AUQ B;  4I7C A;  5H9M A;  4FJC A;  2KU3 A;  2YU4 A;  2G43 A;  3N9P A;  5EYA F;  2YT5 A;  2YRE A;  5FB1 A;  3N9Q A;  5C13 A;  3U5N A;  2F6J A;  1WES A;  3O34 A;  4C9Z A;  2G45 A;  2YHO A;  4YBT A;  5TAB A;  3KNV A;  1XWH A;  3N9O A;  2MUM A;  3C6W A;  1WEM A;  1RMD A;  1VD4 A;  5D1L B;  2EOD A;  4GNE A;  3LRQ A;  2YYR A;  2L80 A;  2ECI A;  2KWN A;  3KQI A;  3RTR B;  2MA6 A;  4I7D A;  2LGV A;  5AIT A;  3RPG B;  2VJF A;  2PUY A;  4F52 B;  1K2F A;  2JRJ A;  4FO9 A;  3O36 A;  1MM2 A;  2LRI C;  1JM7 A;  2LQ6 A;  4YAD A;  3QZV A;  4GND A;  2FUU A;  2RSD A;  2K4D A;  2L75 A;  3VK6 A;  2ECW A;  2PNX A;  4ZQL A;  3LQH A;  2KGG A;  2LGK A;  2ECJ A;  4A4B A;  2KFT A;  2YQL A;  2CT2 A;  2KRE A;  4GNF A;  3MHH A;  4TKP B;  3PUR A;  1FBV A;  1LDK C;  2MT5 A;  4AVX A;  2VPE A;  3O7A A;  5FER A;  2M6M A;  2E6R A;  2MD7 B;  4UP0 A;  4AP4 A;  5TDR A;  2YSJ A;  3N9M A;  5LKT A;  2EGP A;  5LKU A;  3KV6 A;  5JG6 A;  4X3G A;  4L7X A;  4B86 C;  3V43 A;  2AN6 A;  3ZNI A;  2H0D A;  2ECN A;  5TBN A;  1HYI A;  1U6G B;  4I7B A;  3T7L A;  1Z60 A;  2CKL A;  2QIC A;  2K17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...