4AYCB

Rnf8 ring domain structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
126
Chain Sequence
KDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNINKMVNNLSSEVKERRIVLIRERKAKRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
total genus 42
structure length 126
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycB02
2F42A 2ECTA 3L1XA 3O36A 2YUCA 3T7LA 2MA6A 2VJEB 4PTBA 2VP7A 5H1TA 5I3LA 2LV9A 4PPEA 1WE9A 5TRBA 3KV5A 2JMJA 3KV6A 3N9QA 2E6SA 3RTRB 4W4UA 3N9MA 3ZYQA 1WEOA 4N4FA 1WEEA 3GL6A 2Y43A 1FBVA 2ECVA 4V3LC 1JM7A 4I7DA 2KFTA 2XEUA 3C5KA 1LDKC 1HYIA 2M6MA 2MIQA 3ZTGA 4YAXA 2MNYA 5C11A 1T1HA 4YABA 2YREA 4XI1A 2K17A 4A49A 4BBQA 2AN6A 5DKAA 1ZBDB 2IDAA 3SOXA 2FUUA 4NN2A 4B7YC 3I2DA 3N9NA 4LLBA 5FB1A 1WEQA 3ZVZB 5B76A 1MM3A 2ZETC 2QIZA 4CA1A 4B86C 2ECIA 3M99A 2HYED 4L7XA 1K2FA 4MVTA 5FB0A 2CKLB 4YC9A 2PNXA 5LKUA 2QICA 1CHCA 2YU4A 2KGIA 2YSJA 4FO9A 1WGMA 3V43A 2ECGA 3SOUA 4GB0A 1IYMA 2I50A 4R7EA 3HCSA 2CSYA 5LKZA 1DVPA 2VNFA 4Q6FA 4FIPA 2LGGA 2YHNA 3C6WA 4QF2A 3SOWA 4C9ZA 2G6QA 2D8SA 2ECJA 2YHOA 4GNDA 4S3OC 3ZVYA 2LGVA 3O70A 3LQJA 2YQMA 3L11A 2JMDA 4LADB 5G05B 1XWHA 1MM2A 4IC3A 2VJEA 5D1MB 5H1UA 2Y1NA 5B79A 2YT5A 1WENA 3U5NA 4YBSA 4ZQLA 2FUIA 3O35A 4ZUXU 1WEUA 3RPGC 1N87A 2LXHC 1JOCA 5H1VA 2NAAA 2LN0A 1LDJB 2QJ0A 1HYJA 1RMDA 4I7CA 2KGGA 2MT5A 3N9OA 4S3OB 2ECWA 4O64A 1VD4A 1WEVA 2XB1A 2K16A 2YYRA 1WESA 3MHSA 3PUQA 3O37A 3O34A 2HDPA 3SHBA 5AIUA 4WZ0A 4UP0A 4I7BA 2M85A 2CSZA 4WZ2A 2RI7A 2KWNA 2L43A 2YW8A 4WZ3B 2VPDA 2KE1A 3O7AA 1U6GB 3ZPVE 2KWJA 4FK5A 4AYCB 5B75A 2EODA 4A4CA 2DX8A 3M62A 2L0BA 2UZGA 1JM7B 3O33A 3M63A 3EB5A 4AVXA 1VYXA 3U5OA 5B78A 4LK9A 2K4DA 4QF3A 2H0DB 1WFKA 4P5OB 1F62A 5H9MA 5TBNA 2JMIA 3ASLA 3KQIA 2FSAA 3FL2A 3KNVA 2C2VS 2BAYA 4UI9B 5J3XA 5D1KB 4YADA 2L5UA 4R2YA 1X4UA 2JRJA 3U5PA 3U5MA 3IHPA 3GV4A 5TDWA 3T6RA 2Y1MA 4BHWA 5KH9A 5B77A 5LKXA 2F6NA 1E4UA 2K1JA 3PURA 4F52B 2ECNA 3PHDA 5G04B 4ZDTA 1Z2QA 2LGKA 4UP5A 2YQLA 2VJFB 4MSXA 3ZPV1 2VPEA 3EB6A 2CT2A 4A0CD 4GNEA 2YSMA 5LCWB 2VPGA 4A4BA 3LQIA 4LKAA 2G45A 4V3KC 2KIZA 3HCUA 2LQ6A 4WA6A 1BORA 3DQVR 5KH3A 1G25A 2LXPC 3VK6A 2MNZA 5G0FA 2L80A 1WEWA 2M3HA 2L75A 5KH7A 4R8PK 3ZNIA 5EYAF 2KR4A 2OXQC 4CCGX 4IC2A 3NG2A 4LJNA 1WEPA 2CKLA 4YATA 2LGLA 3N9LA 2LDRA 3LQHA 2PUYA 2KWOA 5B8DA 2YURA 1V87A 1X4JA 1Z60A 2LRIC 2M1RA 5D1LB 2E6RA 3RPGB 2KREA 2MA5A 2MUMA 2KYUA 2VPBA 3LRQA 4L58A 4N3WA 3MHHA 5TABA 4GNFA 2C2LA 2H0DA 2F6JA 5DINA 2RSDA 5FEYA 5LKTA 5FERA 2G43A 2EA6A 1VFYA 5C13A 4AYCA 1WEMA 1X4IA 5TDRA 4TKPB 3HCTA 2KU3A 4GNGA 3QZVA 4AP4A 2KWKA 4X3GA 2EGPA 1Z6UA 5AITA 5JG6A 3L1ZB 1FP0A 1WIMA 2MD7B 3DPLR 3N9PA 3HTKC 1WILA 4FJCA 4YBTA 4AUQB 4YBMA 2VJFA 2MD8C
chains in the Genus database with same CATH superfamily
4Z0RA 2F42A 2ECTA 3L1XA 3O36A 2YUCA 3T7LA 2MA6A 2VJEB 4PTBA 2VP7A 5H1TA 5I3LA 3H7HA 2LV9A 4PPEA 2XOZA 1WE9A 5TRBA 3KV5A 2JMJA 3KV6A 3N9QA 2E6SA 3RTRB 4W4UA 3N9MA 3ZYQA 5SVYA 1WEOA 4N4FA 1WEEA 5SVIA 3GL6A 2Y43A 1FBVA 2ECVA 4V3LC 2JUNA 2E61A 1JM7A 4I7DA 2KFTA 2XEUA 3C5KA 1LDKC 1HYIA 2M6MA 2MIQA 3ZTGA 4YAXA 2MNYA 5C11A 1T1HA 2EXUA 2YREA 4YABA 4XI1A 2K17A 4A49A 4BBQA 2AN6A 5DKAA 1ZBDB 2IDAA 3SOXA 2FUUA 4NN2A 4B7YC 3I2DA 3N9NA 4LLBA 5FB1A 1WEQA 3ZVZB 5B76A 1MM3A 2ZETC 2QIZA 4CA1A 2EGMA 2FD4A 4B86C 2ECIA 3M99A 2HYED 4L7XA 1K2FA 2MKEA 4MVTA 2KKXA 5FB0A 2B0OE 2CKLB 4YC9A 3PLWA 2PNXA 5LKUA 2QICA 1CHCA 2YU4A 2KGIA 2YSJA 4FO9A 1WGMA 3V43A 2ECGA 3SOUA 4GB0A 5SVXA 1IYMA 2I50A 4R7EA 3HCSA 2P57A 2CSYA 5LKZA 1DVPA 2VNFA 4Q6FA 4FIPA 2LGGA 2YHNA 3C6WA 4QF2A 3SOWA 4C9ZA 2G6QA 2D8SA 2ECJA 2YHOA 4OGEA 4GNDA 4S3OC 3ZVYA 2LGVA 3O70A 3LQJA 2YQMA 3L11A 2JMDA 4LADB 5G05B 1XWHA 1MM2A 4IC3A 2VJEA 2CRWA 5D1MB 5H1UA 2Y1NA 5B79A 2YT5A 1WENA 3U5NA 2YVRA 3MDBC 4YBSA 4ZQLA 2FUIA 3O35A 4ZUXU 1WEUA 3FAOA 3RPGC 1N87A 1DCQA 3JUEA 2LXHC 1JOCA 5H1VA 2NAAA 2LN0A 4H9DA 1LDJB 2QJ0A 1HYJA 1RMDA 4I7CA 2KGGA 2MT5A 2D8UA 4O62A 3N9OA 4S3OB 2ECWA 4O64A 3SUBA 1VD4A 1WEVA 2XB1A 2K16A 2YYRA 1WESA 2FFWA 3MHSA 3PUQA 3O37A 3O34A 3M7KA 2HDPA 3SHBA 5AIUA 4WZ0A 4UP0A 4I7BA 2M85A 2CSZA 4WZ2A 2RI7A 2KWNA 3T9KA 2L43A 2YW8A 4WZ3B 2VPDA 2KE1A 3O7AA 1U6GB 3ZPVE 2KWJA 4FK5A 4AYCB 5B75A 4OGCA 2EODA 4A4CA 2DX8A 3M62A 2L0BA 2UZGA 3FEHA 1JM7B 3O33A 3M63A 3EB5A 4AVXA 1VYXA 5SVIB 3U5OA 2IQJA 5B78A 4LK9A 2K4DA 4QF3A 2H0DB 2JM3A 2CRRA 3FANA 1WFKA 3LVQE 4P5OB 1F62A 5H9MA 5TBNA 2JMIA 3ASLA 3KQIA 2FSAA 3FL2A 3KNVA 2C2VS 2BAYA 4UI9B 3LVRE 5J3XA 5D1KB 4YADA 2L5UA 4R2YA 1X4UA 2JRJA 3U5PA 2LAUA 3U5MA 3IHPA 3DDTA 3GV4A 5TDWA 3T6RA 2Y1MA 4BHWA 5KH9A 5B77A 5LKXA 2F6NA 1E4UA 2K1JA 3E2DA 3PURA 2ECNA 4F52B 3LDYA 3PHDA 5G04B 4ZDTA 1Z2QA 2LGKA 4UP5A 2YQLA 2VJFB 4MSXA 3ZPV1 2VPEA 3EB6A 2CT2A 4A0CD 4GNEA 2YSMA 5LCWB 2VPGA 4A4BA 3LQIA 4LKAA 2G45A 3FM8C 4V3KC 2KIZA 3HCUA 2LQ6A 3FJUB 2KKYA 4WA6A 1BORA 3DQVR 5KH3A 1G25A 2LXPC 3VK6A 2MNZA 2DSMA 5G0FA 2L80A 1WEWA 2M3HA 2L75A 5KH7A 4QQ4A 4R8PK 3ZNIA 3Q1DA 5EYAF 2KR4A 2OXQC 4CCGX 4IC2A 3NG2A 4LJNA 1WEPA 2CKLA 4YATA 2LGLA 3N9LA 2LDRA 3LQHA 2PUYA 3KDEC 2KWOA 2RR4A 5B8DA 2YURA 1V87A 1X4JA 4F1PA 1Z60A 2LRIC 2M1RA 2OWAA 5D1LB 2XOCA 2XP0A 2E6RA 3RPGB 2KREA 2MA5A 2MUMA 2KYUA 2VPBA 3LRQA 4L58A 3LJUX 2M13A 4N3WA 3MHHA 5TABA 4GNFA 2C2LA 2H0DA 2F6JA 5DINA 2RSDA 5FEYA 5LKTA 5FERA 4Z0OA 5K3QA 2G43A 2EA6A 1VFYA 2CSVA 2L7PA 5C13A 2DJAA 4AYCA 1WEMA 3O47A 1X4IA 5TDRA 4TKPB 3HCTA 2KU3A 4GNGA 3QZVA 2XOYA 4AP4A 2KWKA 4X3GA 2EGPA 1Z6UA 5AITA 5JG6A 3L1ZB 1MBMA 1FP0A 1WIMA 2MD7B 3DPLR 3N9PA 3HTKC 1WILA 4FJCA 4YBTA 4AUQB 4YBMA 2CONA 2VJFA 2MD8C 3DWDA
chains in the Genus database with same CATH topology
2F42A 2ECTA 3L1XA 3O36A 2YUCA 3T7LA 2MA6A 2VJEB 4PTBA 2VP7A 5H1TA 5I3LA 2LV9A 4PPEA 1WE9A 5TRBA 3KV5A 2JMJA 3KV6A 3N9QA 2E6SA 3RTRB 4W4UA 3N9MA 3ZYQA 1WEOA 4N4FA 1WEEA 3GL6A 2Y43A 1FBVA 2ECVA 4V3LC 1JM7A 4I7DA 2KFTA 2XEUA 3C5KA 1LDKC 1HYIA 2M6MA 2MIQA 3ZTGA 4YAXA 2MNYA 5C11A 1T1HA 4YABA 2YREA 4XI1A 2K17A 4A49A 4BBQA 2AN6A 5DKAA 1ZBDB 2IDAA 3SOXA 2FUUA 4NN2A 4B7YC 3I2DA 3N9NA 4LLBA 5FB1A 1WEQA 3ZVZB 5B76A 1MM3A 2ZETC 2QIZA 4CA1A 4B86C 2ECIA 3M99A 2HYED 4L7XA 1K2FA 4MVTA 5FB0A 2CKLB 4YC9A 2PNXA 5LKUA 2QICA 1CHCA 2YU4A 2KGIA 2YSJA 4FO9A 1WGMA 3V43A 2ECGA 3SOUA 4GB0A 1IYMA 2I50A 4R7EA 3HCSA 2CSYA 5LKZA 1DVPA 2VNFA 4Q6FA 4FIPA 2LGGA 2YHNA 3C6WA 4QF2A 3SOWA 4C9ZA 2G6QA 2D8SA 2ECJA 2YHOA 4GNDA 4S3OC 3ZVYA 2LGVA 3O70A 3LQJA 2YQMA 3L11A 2JMDA 4LADB 5G05B 1XWHA 1MM2A 4IC3A 2VJEA 5D1MB 5H1UA 2Y1NA 5B79A 2YT5A 1WENA 3U5NA 4YBSA 4ZQLA 2FUIA 3O35A 4ZUXU 1WEUA 3RPGC 1N87A 2LXHC 1JOCA 5H1VA 2NAAA 2LN0A 1LDJB 2QJ0A 1HYJA 1RMDA 4I7CA 2KGGA 2MT5A 3N9OA 4S3OB 2ECWA 4O64A 1VD4A 1WEVA 2XB1A 2K16A 2YYRA 1WESA 3MHSA 3PUQA 3O37A 3O34A 2HDPA 3SHBA 5AIUA 4WZ0A 4UP0A 4I7BA 2M85A 2CSZA 4WZ2A 2RI7A 2KWNA 2L43A 2YW8A 4WZ3B 2VPDA 2KE1A 3O7AA 1U6GB 3ZPVE 2KWJA 4FK5A 4AYCB 5B75A 2EODA 4A4CA 2DX8A 3M62A 2L0BA 2UZGA 1JM7B 3O33A 3M63A 3EB5A 4AVXA 1VYXA 3U5OA 5B78A 4LK9A 2K4DA 4QF3A 2H0DB 1WFKA 4P5OB 1F62A 5H9MA 5TBNA 2JMIA 3ASLA 3KQIA 2FSAA 3FL2A 3KNVA 2C2VS 2BAYA 4UI9B 5J3XA 5D1KB 4YADA 2L5UA 4R2YA 1X4UA 2JRJA 3U5PA 3U5MA 3IHPA 3GV4A 5TDWA 3T6RA 2Y1MA 4BHWA 5KH9A 5B77A 5LKXA 2F6NA 1E4UA 2K1JA 3PURA 4F52B 2ECNA 3PHDA 5G04B 4ZDTA 1Z2QA 2LGKA 4UP5A 2YQLA 2VJFB 4MSXA 3ZPV1 2VPEA 3EB6A 2CT2A 4A0CD 4GNEA 2YSMA 5LCWB 2VPGA 4A4BA 3LQIA 4LKAA 2G45A 4V3KC 2KIZA 3HCUA 2LQ6A 4WA6A 1BORA 3DQVR 5KH3A 1G25A 2LXPC 3VK6A 2MNZA 5G0FA 2L80A 1WEWA 2M3HA 2L75A 5KH7A 4R8PK 3ZNIA 5EYAF 2KR4A 2OXQC 4CCGX 4IC2A 3NG2A 4LJNA 1WEPA 2CKLA 4YATA 2LGLA 3N9LA 2LDRA 3LQHA 2PUYA 2KWOA 5B8DA 2YURA 1V87A 1X4JA 1Z60A 2LRIC 2M1RA 5D1LB 2E6RA 3RPGB 2KREA 2MA5A 2MUMA 2KYUA 2VPBA 3LRQA 4L58A 4N3WA 3MHHA 5TABA 4GNFA 2C2LA 2H0DA 2F6JA 5DINA 2RSDA 5FEYA 5LKTA 5FERA 2G43A 2EA6A 1VFYA 5C13A 4AYCA 1WEMA 1X4IA 5TDRA 4TKPB 3HCTA 2KU3A 4GNGA 3QZVA 4AP4A 2KWKA 4X3GA 2EGPA 1Z6UA 5AITA 5JG6A 3L1ZB 1FP0A 1WIMA 2MD7B 3DPLR 3N9PA 3HTKC 1WILA 4FJCA 4YBTA 4AUQB 4YBMA 2VJFA 2MD8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F42 A;  2ECT A;  3L1X A;  3O36 A;  2YUC A;  3T7L A;  2MA6 A;  2VJE B;  4PTB A;  2VP7 A;  5H1T A;  5I3L A;  2LV9 A;  4PPE A;  1WE9 A;  5TRB A;  3KV5 A;  2JMJ A;  3KV6 A;  3N9Q A;  2E6S A;  3RTR B;  4W4U A;  3N9M A;  3ZYQ A;  1WEO A;  4N4F A;  1WEE A;  3GL6 A;  2Y43 A;  1FBV A;  2ECV A;  4V3L C;  1JM7 A;  4I7D A;  2KFT A;  2XEU A;  3C5K A;  1LDK C;  1HYI A;  2M6M A;  2MIQ A;  3ZTG A;  4YAX A;  2MNY A;  5C11 A;  1T1H A;  4YAB A;  2YRE A;  4XI1 A;  2K17 A;  4A49 A;  4BBQ A;  2AN6 A;  5DKA A;  1ZBD B;  2IDA A;  3SOX A;  2FUU A;  4NN2 A;  4B7Y C;  3I2D A;  3N9N A;  4LLB A;  5FB1 A;  1WEQ A;  3ZVZ B;  5B76 A;  1MM3 A;  2ZET C;  2QIZ A;  4CA1 A;  4B86 C;  2ECI A;  3M99 A;  2HYE D;  4L7X A;  1K2F A;  4MVT A;  5FB0 A;  2CKL B;  4YC9 A;  2PNX A;  5LKU A;  2QIC A;  1CHC A;  2YU4 A;  2KGI A;  2YSJ A;  4FO9 A;  1WGM A;  3V43 A;  2ECG A;  3SOU A;  4GB0 A;  1IYM A;  2I50 A;  4R7E A;  3HCS A;  2CSY A;  5LKZ A;  1DVP A;  2VNF A;  4Q6F A;  4FIP A;  2LGG A;  2YHN A;  3C6W A;  4QF2 A;  3SOW A;  4C9Z A;  2G6Q A;  2D8S A;  2ECJ A;  2YHO A;  4GND A;  4S3O C;  3ZVY A;  2LGV A;  3O70 A;  3LQJ A;  2YQM A;  3L11 A;  2JMD A;  4LAD B;  5G05 B;  1XWH A;  1MM2 A;  4IC3 A;  2VJE A;  5D1M B;  5H1U A;  2Y1N A;  5B79 A;  2YT5 A;  1WEN A;  3U5N A;  4YBS A;  4ZQL A;  2FUI A;  3O35 A;  4ZUX U;  1WEU A;  3RPG C;  1N87 A;  2LXH C;  1JOC A;  5H1V A;  2NAA A;  2LN0 A;  1LDJ B;  2QJ0 A;  1HYJ A;  1RMD A;  4I7C A;  2KGG A;  2MT5 A;  3N9O A;  4S3O B;  2ECW A;  4O64 A;  1VD4 A;  1WEV A;  2XB1 A;  2K16 A;  2YYR A;  1WES A;  3MHS A;  3PUQ A;  3O37 A;  3O34 A;  2HDP A;  3SHB A;  5AIU A;  4WZ0 A;  4UP0 A;  4I7B A;  2M85 A;  2CSZ A;  4WZ2 A;  2RI7 A;  2KWN A;  2L43 A;  2YW8 A;  4WZ3 B;  2VPD A;  2KE1 A;  3O7A A;  1U6G B;  3ZPV E;  2KWJ A;  4FK5 A;  4AYC B;  5B75 A;  2EOD A;  4A4C A;  2DX8 A;  3M62 A;  2L0B A;  2UZG A;  1JM7 B;  3O33 A;  3M63 A;  3EB5 A;  4AVX A;  1VYX A;  3U5O A;  5B78 A;  4LK9 A;  2K4D A;  4QF3 A;  2H0D B;  1WFK A;  4P5O B;  1F62 A;  5H9M A;  5TBN A;  2JMI A;  3ASL A;  3KQI A;  2FSA A;  3FL2 A;  3KNV A;  2C2V S;  2BAY A;  4UI9 B;  5J3X A;  5D1K B;  4YAD A;  2L5U A;  4R2Y A;  1X4U A;  2JRJ A;  3U5P A;  3U5M A;  3IHP A;  3GV4 A;  5TDW A;  3T6R A;  2Y1M A;  4BHW A;  5KH9 A;  5B77 A;  5LKX A;  2F6N A;  1E4U A;  2K1J A;  3PUR A;  4F52 B;  2ECN A;  3PHD A;  5G04 B;  4ZDT A;  1Z2Q A;  2LGK A;  4UP5 A;  2YQL A;  2VJF B;  4MSX A;  3ZPV 1;  2VPE A;  3EB6 A;  2CT2 A;  4A0C D;  4GNE A;  2YSM A;  5LCW B;  2VPG A;  4A4B A;  3LQI A;  4LKA A;  2G45 A;  4V3K C;  2KIZ A;  3HCU A;  2LQ6 A;  4WA6 A;  1BOR A;  3DQV R;  5KH3 A;  1G25 A;  2LXP C;  3VK6 A;  2MNZ A;  5G0F A;  2L80 A;  1WEW A;  2M3H A;  2L75 A;  5KH7 A;  4R8P K;  3ZNI A;  5EYA F;  2KR4 A;  2OXQ C;  4CCG X;  4IC2 A;  3NG2 A;  4LJN A;  1WEP A;  2CKL A;  4YAT A;  2LGL A;  3N9L A;  2LDR A;  3LQH A;  2PUY A;  2KWO A;  5B8D A;  2YUR A;  1V87 A;  1X4J A;  1Z60 A;  2LRI C;  2M1R A;  5D1L B;  2E6R A;  3RPG B;  2KRE A;  2MA5 A;  2MUM A;  2KYU A;  2VPB A;  3LRQ A;  4L58 A;  4N3W A;  3MHH A;  5TAB A;  4GNF A;  2C2L A;  2H0D A;  2F6J A;  5DIN A;  2RSD A;  5FEY A;  5LKT A;  5FER A;  2G43 A;  2EA6 A;  1VFY A;  5C13 A;  4AYC A;  1WEM A;  1X4I A;  5TDR A;  4TKP B;  3HCT A;  2KU3 A;  4GNG A;  3QZV A;  4AP4 A;  2KWK A;  4X3G A;  2EGP A;  1Z6U A;  5AIT A;  5JG6 A;  3L1Z B;  1FP0 A;  1WIM A;  2MD7 B;  3DPL R;  3N9P A;  3HTK C;  1WIL A;  4FJC A;  4YBT A;  4AUQ B;  4YBM A;  2VJF A;  2MD8 C; 
#chains in the Genus database with same CATH topology
 4Z0R A;  2F42 A;  2ECT A;  3L1X A;  3O36 A;  2YUC A;  3T7L A;  2MA6 A;  2VJE B;  4PTB A;  2VP7 A;  5H1T A;  5I3L A;  3H7H A;  2LV9 A;  4PPE A;  2XOZ A;  1WE9 A;  5TRB A;  3KV5 A;  2JMJ A;  3KV6 A;  3N9Q A;  2E6S A;  3RTR B;  4W4U A;  3N9M A;  3ZYQ A;  5SVY A;  1WEO A;  4N4F A;  1WEE A;  5SVI A;  3GL6 A;  2Y43 A;  1FBV A;  2ECV A;  4V3L C;  2JUN A;  2E61 A;  1JM7 A;  4I7D A;  2KFT A;  2XEU A;  3C5K A;  1LDK C;  1HYI A;  2M6M A;  2MIQ A;  3ZTG A;  4YAX A;  2MNY A;  5C11 A;  1T1H A;  2EXU A;  2YRE A;  4YAB A;  4XI1 A;  2K17 A;  4A49 A;  4BBQ A;  2AN6 A;  5DKA A;  1ZBD B;  2IDA A;  3SOX A;  2FUU A;  4NN2 A;  4B7Y C;  3I2D A;  3N9N A;  4LLB A;  5FB1 A;  1WEQ A;  3ZVZ B;  5B76 A;  1MM3 A;  2ZET C;  2QIZ A;  4CA1 A;  2EGM A;  2FD4 A;  4B86 C;  2ECI A;  3M99 A;  2HYE D;  4L7X A;  1K2F A;  2MKE A;  4MVT A;  2KKX A;  5FB0 A;  2B0O E;  2CKL B;  4YC9 A;  3PLW A;  2PNX A;  5LKU A;  2QIC A;  1CHC A;  2YU4 A;  2KGI A;  2YSJ A;  4FO9 A;  1WGM A;  3V43 A;  2ECG A;  3SOU A;  4GB0 A;  5SVX A;  1IYM A;  2I50 A;  4R7E A;  3HCS A;  2P57 A;  2CSY A;  5LKZ A;  1DVP A;  2VNF A;  4Q6F A;  4FIP A;  2LGG A;  2YHN A;  3C6W A;  4QF2 A;  3SOW A;  4C9Z A;  2G6Q A;  2D8S A;  2ECJ A;  2YHO A;  4OGE A;  4GND A;  4S3O C;  3ZVY A;  2LGV A;  3O70 A;  3LQJ A;  2YQM A;  3L11 A;  2JMD A;  4LAD B;  5G05 B;  1XWH A;  1MM2 A;  4IC3 A;  2VJE A;  2CRW A;  5D1M B;  5H1U A;  2Y1N A;  5B79 A;  2YT5 A;  1WEN A;  3U5N A;  2YVR A;  3MDB C;  4YBS A;  4ZQL A;  2FUI A;  3O35 A;  4ZUX U;  1WEU A;  3FAO A;  3RPG C;  1N87 A;  1DCQ A;  3JUE A;  2LXH C;  1JOC A;  5H1V A;  2NAA A;  2LN0 A;  4H9D A;  1LDJ B;  2QJ0 A;  1HYJ A;  1RMD A;  4I7C A;  2KGG A;  2MT5 A;  2D8U A;  4O62 A;  3N9O A;  4S3O B;  2ECW A;  4O64 A;  3SUB A;  1VD4 A;  1WEV A;  2XB1 A;  2K16 A;  2YYR A;  1WES A;  2FFW A;  3MHS A;  3PUQ A;  3O37 A;  3O34 A;  3M7K A;  2HDP A;  3SHB A;  5AIU A;  4WZ0 A;  4UP0 A;  4I7B A;  2M85 A;  2CSZ A;  4WZ2 A;  2RI7 A;  2KWN A;  3T9K A;  2L43 A;  2YW8 A;  4WZ3 B;  2VPD A;  2KE1 A;  3O7A A;  1U6G B;  3ZPV E;  2KWJ A;  4FK5 A;  4AYC B;  5B75 A;  4OGC A;  2EOD A;  4A4C A;  2DX8 A;  3M62 A;  2L0B A;  2UZG A;  3FEH A;  1JM7 B;  3O33 A;  3M63 A;  3EB5 A;  4AVX A;  1VYX A;  5SVI B;  3U5O A;  2IQJ A;  5B78 A;  4LK9 A;  2K4D A;  4QF3 A;  2H0D B;  2JM3 A;  2CRR A;  3FAN A;  1WFK A;  3LVQ E;  4P5O B;  1F62 A;  5H9M A;  5TBN A;  2JMI A;  3ASL A;  3KQI A;  2FSA A;  3FL2 A;  3KNV A;  2C2V S;  2BAY A;  4UI9 B;  3LVR E;  5J3X A;  5D1K B;  4YAD A;  2L5U A;  4R2Y A;  1X4U A;  2JRJ A;  3U5P A;  2LAU A;  3U5M A;  3IHP A;  3DDT A;  3GV4 A;  5TDW A;  3T6R A;  2Y1M A;  4BHW A;  5KH9 A;  5B77 A;  5LKX A;  2F6N A;  1E4U A;  2K1J A;  3E2D A;  3PUR A;  2ECN A;  4F52 B;  3LDY A;  3PHD A;  5G04 B;  4ZDT A;  1Z2Q A;  2LGK A;  4UP5 A;  2YQL A;  2VJF B;  4MSX A;  3ZPV 1;  2VPE A;  3EB6 A;  2CT2 A;  4A0C D;  4GNE A;  2YSM A;  5LCW B;  2VPG A;  4A4B A;  3LQI A;  4LKA A;  2G45 A;  3FM8 C;  4V3K C;  2KIZ A;  3HCU A;  2LQ6 A;  3FJU B;  2KKY A;  4WA6 A;  1BOR A;  3DQV R;  5KH3 A;  1G25 A;  2LXP C;  3VK6 A;  2MNZ A;  2DSM A;  5G0F A;  2L80 A;  1WEW A;  2M3H A;  2L75 A;  5KH7 A;  4QQ4 A;  4R8P K;  3ZNI A;  3Q1D A;  5EYA F;  2KR4 A;  2OXQ C;  4CCG X;  4IC2 A;  3NG2 A;  4LJN A;  1WEP A;  2CKL A;  4YAT A;  2LGL A;  3N9L A;  2LDR A;  3LQH A;  2PUY A;  3KDE C;  2KWO A;  2RR4 A;  5B8D A;  2YUR A;  1V87 A;  1X4J A;  4F1P A;  1Z60 A;  2LRI C;  2M1R A;  2OWA A;  5D1L B;  2XOC A;  2XP0 A;  2E6R A;  3RPG B;  2KRE A;  2MA5 A;  2MUM A;  2KYU A;  2VPB A;  3LRQ A;  4L58 A;  3LJU X;  2M13 A;  4N3W A;  3MHH A;  5TAB A;  4GNF A;  2C2L A;  2H0D A;  2F6J A;  5DIN A;  2RSD A;  5FEY A;  5LKT A;  5FER A;  4Z0O A;  5K3Q A;  2G43 A;  2EA6 A;  1VFY A;  2CSV A;  2L7P A;  5C13 A;  2DJA A;  4AYC A;  1WEM A;  3O47 A;  1X4I A;  5TDR A;  4TKP B;  3HCT A;  2KU3 A;  4GNG A;  3QZV A;  2XOY A;  4AP4 A;  2KWK A;  4X3G A;  2EGP A;  1Z6U A;  5AIT A;  5JG6 A;  3L1Z B;  1MBM A;  1FP0 A;  1WIM A;  2MD7 B;  3DPL R;  3N9P A;  3HTK C;  1WIL A;  4FJC A;  4YBT A;  4AUQ B;  4YBM A;  2CON A;  2VJF A;  2MD8 C;  3DWD A; 
#chains in the Genus database with same CATH homology
 2F42 A;  2ECT A;  3L1X A;  3O36 A;  2YUC A;  3T7L A;  2MA6 A;  2VJE B;  4PTB A;  2VP7 A;  5H1T A;  5I3L A;  2LV9 A;  4PPE A;  1WE9 A;  5TRB A;  3KV5 A;  2JMJ A;  3KV6 A;  3N9Q A;  2E6S A;  3RTR B;  4W4U A;  3N9M A;  3ZYQ A;  1WEO A;  4N4F A;  1WEE A;  3GL6 A;  2Y43 A;  1FBV A;  2ECV A;  4V3L C;  1JM7 A;  4I7D A;  2KFT A;  2XEU A;  3C5K A;  1LDK C;  1HYI A;  2M6M A;  2MIQ A;  3ZTG A;  4YAX A;  2MNY A;  5C11 A;  1T1H A;  4YAB A;  2YRE A;  4XI1 A;  2K17 A;  4A49 A;  4BBQ A;  2AN6 A;  5DKA A;  1ZBD B;  2IDA A;  3SOX A;  2FUU A;  4NN2 A;  4B7Y C;  3I2D A;  3N9N A;  4LLB A;  5FB1 A;  1WEQ A;  3ZVZ B;  5B76 A;  1MM3 A;  2ZET C;  2QIZ A;  4CA1 A;  4B86 C;  2ECI A;  3M99 A;  2HYE D;  4L7X A;  1K2F A;  4MVT A;  5FB0 A;  2CKL B;  4YC9 A;  2PNX A;  5LKU A;  2QIC A;  1CHC A;  2YU4 A;  2KGI A;  2YSJ A;  4FO9 A;  1WGM A;  3V43 A;  2ECG A;  3SOU A;  4GB0 A;  1IYM A;  2I50 A;  4R7E A;  3HCS A;  2CSY A;  5LKZ A;  1DVP A;  2VNF A;  4Q6F A;  4FIP A;  2LGG A;  2YHN A;  3C6W A;  4QF2 A;  3SOW A;  4C9Z A;  2G6Q A;  2D8S A;  2ECJ A;  2YHO A;  4GND A;  4S3O C;  3ZVY A;  2LGV A;  3O70 A;  3LQJ A;  2YQM A;  3L11 A;  2JMD A;  4LAD B;  5G05 B;  1XWH A;  1MM2 A;  4IC3 A;  2VJE A;  5D1M B;  5H1U A;  2Y1N A;  5B79 A;  2YT5 A;  1WEN A;  3U5N A;  4YBS A;  4ZQL A;  2FUI A;  3O35 A;  4ZUX U;  1WEU A;  3RPG C;  1N87 A;  2LXH C;  1JOC A;  5H1V A;  2NAA A;  2LN0 A;  1LDJ B;  2QJ0 A;  1HYJ A;  1RMD A;  4I7C A;  2KGG A;  2MT5 A;  3N9O A;  4S3O B;  2ECW A;  4O64 A;  1VD4 A;  1WEV A;  2XB1 A;  2K16 A;  2YYR A;  1WES A;  3MHS A;  3PUQ A;  3O37 A;  3O34 A;  2HDP A;  3SHB A;  5AIU A;  4WZ0 A;  4UP0 A;  4I7B A;  2M85 A;  2CSZ A;  4WZ2 A;  2RI7 A;  2KWN A;  2L43 A;  2YW8 A;  4WZ3 B;  2VPD A;  2KE1 A;  3O7A A;  1U6G B;  3ZPV E;  2KWJ A;  4FK5 A;  4AYC B;  5B75 A;  2EOD A;  4A4C A;  2DX8 A;  3M62 A;  2L0B A;  2UZG A;  1JM7 B;  3O33 A;  3M63 A;  3EB5 A;  4AVX A;  1VYX A;  3U5O A;  5B78 A;  4LK9 A;  2K4D A;  4QF3 A;  2H0D B;  1WFK A;  4P5O B;  1F62 A;  5H9M A;  5TBN A;  2JMI A;  3ASL A;  3KQI A;  2FSA A;  3FL2 A;  3KNV A;  2C2V S;  2BAY A;  4UI9 B;  5J3X A;  5D1K B;  4YAD A;  2L5U A;  4R2Y A;  1X4U A;  2JRJ A;  3U5P A;  3U5M A;  3IHP A;  3GV4 A;  5TDW A;  3T6R A;  2Y1M A;  4BHW A;  5KH9 A;  5B77 A;  5LKX A;  2F6N A;  1E4U A;  2K1J A;  3PUR A;  4F52 B;  2ECN A;  3PHD A;  5G04 B;  4ZDT A;  1Z2Q A;  2LGK A;  4UP5 A;  2YQL A;  2VJF B;  4MSX A;  3ZPV 1;  2VPE A;  3EB6 A;  2CT2 A;  4A0C D;  4GNE A;  2YSM A;  5LCW B;  2VPG A;  4A4B A;  3LQI A;  4LKA A;  2G45 A;  4V3K C;  2KIZ A;  3HCU A;  2LQ6 A;  4WA6 A;  1BOR A;  3DQV R;  5KH3 A;  1G25 A;  2LXP C;  3VK6 A;  2MNZ A;  5G0F A;  2L80 A;  1WEW A;  2M3H A;  2L75 A;  5KH7 A;  4R8P K;  3ZNI A;  5EYA F;  2KR4 A;  2OXQ C;  4CCG X;  4IC2 A;  3NG2 A;  4LJN A;  1WEP A;  2CKL A;  4YAT A;  2LGL A;  3N9L A;  2LDR A;  3LQH A;  2PUY A;  2KWO A;  5B8D A;  2YUR A;  1V87 A;  1X4J A;  1Z60 A;  2LRI C;  2M1R A;  5D1L B;  2E6R A;  3RPG B;  2KRE A;  2MA5 A;  2MUM A;  2KYU A;  2VPB A;  3LRQ A;  4L58 A;  4N3W A;  3MHH A;  5TAB A;  4GNF A;  2C2L A;  2H0D A;  2F6J A;  5DIN A;  2RSD A;  5FEY A;  5LKT A;  5FER A;  2G43 A;  2EA6 A;  1VFY A;  5C13 A;  4AYC A;  1WEM A;  1X4I A;  5TDR A;  4TKP B;  3HCT A;  2KU3 A;  4GNG A;  3QZV A;  4AP4 A;  2KWK A;  4X3G A;  2EGP A;  1Z6U A;  5AIT A;  5JG6 A;  3L1Z B;  1FP0 A;  1WIM A;  2MD7 B;  3DPL R;  3N9P A;  3HTK C;  1WIL A;  4FJC A;  4YBT A;  4AUQ B;  4YBM A;  2VJF A;  2MD8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...