4AYCB

Rnf8 ring domain structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
126
Chain Sequence
KDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNINKMVNNLSSEVKERRIVLIRERKAKRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 126
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycB02
2YQLA 2FUUA 4WZ2A 3L11A 2L5UA 4UI9B 2MA5A 2M85A 5JG6A 2K16A 4S3OB 3HCUA 2G45A 1JOCA 4LLBA 4R2YA 1WEOA 2HDPA 3MHSA 3ZVYA 5H1UA 1V87A 5TDRA 2L43A 4S3OC 4GNFA 2MUMA 2YHNA 1WEPA 3ZPV1 3QZVA 2YT5A 3N9NA 3N9MA 2KGGA 2VPDA 3U5OA 4C9ZA 2Y1NA 4A49A 2Y43A 3C6WA 5B76A 2ECVA 2LXPC 1WEMA 4TKPB 2NAAA 5FEYA 2M1RA 3SOXA 5H1VA 3LQHA 4YBSA 3KQIA 4LJNA 4R7EA 1F62A 3SHBA 3HCTA 1WGMA 2LGKA 2M6MA 5FB1A 3KNVA 2EA6A 3RTRB 4XI1A 5TDWA 2C2LA 1ZBDB 1JM7B 2C2VS 1X4IA 2OXQC 4F52B 3L1ZB 2G43A 5H1TA 2VNFA 1MM2A 3L1XA 2MD8C 1WEVA 1U6GB 1WENA 5B8DA 3PHDA 3PURA 4BBQA 3ZVZB 3FL2A 3KV6A 2KWNA 3ASLA 1DVPA 4NN2A 5G05B 4ZUXU 3U5NA 2YREA 5B78A 4I7BA 4MSXA 4L7XA 4X3GA 5FB0A 2KU3A 2KWKA 2KWOA 3C5KA 2VPGA 3M99A 2L80A 3O37A 5TBNA 2CSZA 2MNZA 4WZ0A 4YAXA 1JM7A 4LK9A 2LXHC 3RPGB 2AN6A 3I2DA 4GB0A 4V3LC 4L58A 1VYXA 2H0DB 5KH7A 4PTBA 3RPGC 2CT2A 5EYAF 4YATA 4YBTA 5AIUA 5TRBA 4V3KC 1XWHA 3O35A 2QICA 5G04B 2KE1A 2ZETC 4PPEA 1IYMA 4GNEA 4ZDTA 2K1JA 2ECIA 2ECJA 2JMJA 4FJCA 4UP5A 5DKAA 2LGGA 2VPBA 4N3WA 2H0DA 4I7DA 1WFKA 2E6RA 2K4DA 3T7LA 2PNXA 4FIPA 1T1HA 2L0BA 2G6QA 5D1MB 2ECTA 3ZYQA 3O36A 1WEUA 2YU4A 4MVTA 3KV5A 1VD4A 4A4BA 4A4CA 5J3XA 4W4UA 2LDRA 3M62A 3LQIA 3ZPVE 3U5MA 2F6JA 1WE9A 2YUCA 4YBMA 3M63A 2DX8A 5H9MA 5AITA 3GL6A 1K2FA 5LCWB 3NG2A 2I50A 4AUQB 5FERA 5B75A 4AVXA 5KH3A 1MM3A 4IC3A 4FK5A 4QF2A 3GV4A 4GNDA 2XEUA 4CCGX 4QF3A 3ZTGA 4B7YC 4CA1A 3U5PA 1RMDA 2YSJA 2CKLA 1WEWA 4R8PK 2RSDA 3LQJA 2UZGA 4IC2A 5D1KB 1Z60A 2YHOA 2KYUA 3EB5A 3T6RA 3HTKC 2MIQA 2VP7A 2F6NA 2KR4A 1Z6UA 2FUIA 4YABA 2VJFB 1WILA 1X4UA 3DPLR 3MHHA 4N4FA 4I7CA 1FP0A 3O7AA 2M3HA 1CHCA 2LRIC 2ECNA 2FSAA 1Z2QA 2QIZA 3ZNIA 3DQVR 3N9LA 5I3LA 3HCSA 4YADA 5C11A 1G25A 2LV9A 5KH9A 1E4UA 2LGVA 2ECWA 5G0FA 4LADB 1VFYA 2EGPA 1LDJB 4FO9A 1BORA 2LQ6A 3VK6A 2RI7A 2VJEB 3SOWA 5LKXA 3N9QA 5LKTA 2K17A 2XB1A 2KWJA 2VPEA 2VJFA 2CKLB 1N87A 4BHWA 2YYRA 2MA6A 3O33A 2QJ0A 4AYCB 1HYIA 1WESA 2YQMA 4Q6FA 2KFTA 2D8SA 2HYED 2JMIA 3N9OA 4WA6A 2YW8A 3N9PA 5DINA 3SOUA 2MD7B 3EB6A 2E6SA 2F42A 3O70A 1WEEA 5B79A 2IDAA 3O34A 3PUQA 4P5OB 2KGIA 2EODA 5TABA 2CSYA 1X4JA 4O64A 2BAYA 4WZ3B 2KIZA 2YURA 4ZQLA 5LKUA 2LN0A 5B77A 4YC9A 1LDKC 4AP4A 2VJEA 4UP0A 5D1LB 4A0CD 1FBVA 4GNGA 2ECGA 1WIMA 1WEQA 4LKAA 2MNYA 3V43A 5LKZA 5C13A 4AYCA 4B86C 2Y1MA 2PUYA 2YSMA 3LRQA 2MT5A 2JRJA 2LGLA 2JMDA 2KREA 3IHPA 1HYJA 2L75A
chains in the Genus database with same CATH superfamily
2YQLA 2XOZA 2FUUA 4WZ2A 3L11A 2L5UA 4UI9B 2MA5A 2M85A 5JG6A 2K16A 2OWAA 4S3OB 3HCUA 2G45A 1JOCA 4LLBA 4R2YA 1WEOA 2HDPA 3MHSA 3ZVYA 5H1UA 1V87A 5TDRA 2L43A 2JM3A 4S3OC 4GNFA 2MUMA 2YHNA 4Z0RA 1WEPA 3ZPV1 3QZVA 2YT5A 3N9NA 3N9MA 2KGGA 2VPDA 3FM8C 3U5OA 2CRWA 4C9ZA 2Y1NA 4QQ4A 4A49A 2Y43A 3C6WA 5B76A 2ECVA 2LXPC 1WEMA 2XP0A 5SVIA 4TKPB 2FFWA 2NAAA 4H9DA 5FEYA 3DDTA 2M1RA 3SOXA 5H1VA 3LQHA 2XOCA 4YBSA 3KQIA 4LJNA 4R7EA 1F62A 3SHBA 3HCTA 1WGMA 2LGKA 2M6MA 5FB1A 3KNVA 2EA6A 3RTRB 4XI1A 5TDWA 2MKEA 2C2LA 1ZBDB 1JM7B 2C2VS 1X4IA 3T9KA 2OXQC 4F52B 3L1ZB 1HYJA 2G43A 5H1TA 2VNFA 1MM2A 3L1XA 2MD8C 1WEVA 1U6GB 1WENA 2DSMA 3PHDA 3PURA 5B8DA 4BBQA 3ZVZB 3FL2A 3KV6A 2KWNA 3ASLA 1DVPA 4NN2A 5G05B 1DCQA 4ZUXU 3U5NA 2YREA 5K3QA 5B78A 4I7BA 4MSXA 4L7XA 4X3GA 5FB0A 2KU3A 2KWKA 2KWOA 3C5KA 2VPGA 3M99A 2L80A 3O37A 4Z0OA 5TBNA 2CSZA 2MNZA 4WZ0A 4YAXA 1JM7A 4LK9A 2LXHC 3RPGB 2AN6A 3I2DA 4GB0A 4V3LC 3FJUB 4L58A 1VYXA 2H0DB 5KH7A 4PTBA 2EXUA 3RPGC 2CT2A 4OGEA 5EYAF 4YATA 3FAOA 4YBTA 5AIUA 5TRBA 4V3KC 1XWHA 3M7KA 3O35A 2QICA 5G04B 3FANA 2KE1A 3PLWA 2ZETC 4PPEA 1IYMA 4GNEA 4ZDTA 2K1JA 2ECIA 2ECJA 2JMJA 4FJCA 4UP5A 5DKAA 2M13A 2LGGA 2VPBA 2CRRA 4N3WA 5SVXA 2H0DA 1MBMA 3Q1DA 2E61A 4I7DA 2JUNA 1WFKA 2E6RA 2K4DA 3T7LA 2PNXA 4FIPA 1T1HA 2L0BA 2G6QA 5D1MB 2ECTA 3ZYQA 2LAUA 3O36A 1WEUA 2YU4A 4MVTA 3KV5A 1VD4A 4A4BA 3LVQE 4A4CA 5J3XA 4W4UA 2LDRA 3M62A 3LQIA 3ZPVE 3U5MA 2F6JA 1WE9A 2YUCA 4YBMA 3M63A 2DX8A 5H9MA 5AITA 3GL6A 1K2FA 5LCWB 3NG2A 2I50A 2KKXA 4AUQB 5FERA 5B75A 4AVXA 3E2DA 5KH3A 1MM3A 4IC3A 2CSVA 4FK5A 4QF2A 2L7PA 3GV4A 4GNDA 2XEUA 4CCGX 3KDEC 4QF3A 3ZTGA 4B7YC 4CA1A 3DWDA 3U5PA 1RMDA 2YSJA 2CKLA 2D8UA 2KKYA 1WEWA 4R8PK 3LJUX 2RSDA 2IQJA 3LQJA 2UZGA 4IC2A 5D1KB 1Z60A 2YHOA 2KYUA 3EB5A 3T6RA 3HTKC 3H7HA 2MIQA 2VP7A 2F6NA 2KR4A 1Z6UA 2B0OE 2FUIA 4YABA 2VJFB 4OGCA 1WILA 1X4UA 3DPLR 3MHHA 4F1PA 4N4FA 4I7CA 2CONA 1FP0A 3O47A 3O7AA 2M3HA 1CHCA 2LRIC 2ECNA 2FSAA 1Z2QA 2QIZA 3ZNIA 3DQVR 3N9LA 5I3LA 3HCSA 4YADA 5C11A 1G25A 2LV9A 5KH9A 1E4UA 2LGVA 2YVRA 2ECWA 5G0FA 4LADB 1VFYA 2RR4A 2EGPA 1LDJB 3LVRE 4FO9A 1BORA 2LQ6A 3VK6A 2RI7A 2VJEB 3SOWA 5LKXA 3N9QA 5LKTA 2K17A 2XB1A 2KWJA 2VPEA 2VJFA 2CKLB 1N87A 3SUBA 4BHWA 2YYRA 2MA6A 2EGMA 3FEHA 3MDBC 3O33A 2QJ0A 4AYCB 1HYIA 3JUEA 1WESA 2YQMA 2P57A 4Q6FA 2KFTA 2D8SA 2HYED 2JMIA 3N9OA 4WA6A 2YW8A 3N9PA 5DINA 3SOUA 2MD7B 3EB6A 2E6SA 2F42A 3O70A 1WEEA 5B79A 2IDAA 3O34A 3PUQA 4P5OB 2KGIA 2EODA 5TABA 2CSYA 1X4JA 4O64A 2BAYA 4WZ3B 2KIZA 2YURA 4ZQLA 5LKUA 2FD4A 2LN0A 5B77A 4YC9A 1LDKC 4AP4A 2VJEA 4UP0A 5D1LB 4A0CD 1FBVA 4GNGA 2ECGA 1WIMA 1WEQA 5SVYA 4LKAA 2MNYA 3V43A 5LKZA 5C13A 3LDYA 4O62A 4AYCA 4B86C 2Y1MA 2PUYA 2YSMA 3LRQA 2MT5A 2JRJA 2LGLA 2JMDA 2KREA 2DJAA 2XOYA 3IHPA 5SVIB 2L75A
chains in the Genus database with same CATH topology
2YQLA 2FUUA 4WZ2A 3L11A 2L5UA 4UI9B 2MA5A 2M85A 5JG6A 2K16A 4S3OB 3HCUA 2G45A 1JOCA 4LLBA 4R2YA 1WEOA 2HDPA 3MHSA 3ZVYA 5H1UA 1V87A 5TDRA 2L43A 4S3OC 4GNFA 2MUMA 2YHNA 1WEPA 3ZPV1 3QZVA 2YT5A 3N9NA 3N9MA 2KGGA 2VPDA 3U5OA 4C9ZA 2Y1NA 4A49A 2Y43A 3C6WA 5B76A 2ECVA 2LXPC 1WEMA 4TKPB 2NAAA 5FEYA 2M1RA 3SOXA 5H1VA 3LQHA 4YBSA 3KQIA 4LJNA 4R7EA 1F62A 3SHBA 3HCTA 1WGMA 2LGKA 2M6MA 5FB1A 3KNVA 2EA6A 3RTRB 4XI1A 5TDWA 2C2LA 1ZBDB 1JM7B 2C2VS 1X4IA 2OXQC 4F52B 3L1ZB 2G43A 5H1TA 2VNFA 1MM2A 3L1XA 2MD8C 1WEVA 1U6GB 1WENA 5B8DA 3PHDA 3PURA 4BBQA 3ZVZB 3FL2A 3KV6A 2KWNA 3ASLA 1DVPA 4NN2A 5G05B 4ZUXU 3U5NA 2YREA 5B78A 4I7BA 4MSXA 4L7XA 4X3GA 5FB0A 2KU3A 2KWKA 2KWOA 3C5KA 2VPGA 3M99A 2L80A 3O37A 5TBNA 2CSZA 2MNZA 4WZ0A 4YAXA 1JM7A 4LK9A 2LXHC 3RPGB 2AN6A 3I2DA 4GB0A 4V3LC 4L58A 1VYXA 2H0DB 5KH7A 4PTBA 3RPGC 2CT2A 5EYAF 4YATA 4YBTA 5AIUA 5TRBA 4V3KC 1XWHA 3O35A 2QICA 5G04B 2KE1A 2ZETC 4PPEA 1IYMA 4GNEA 4ZDTA 2K1JA 2ECIA 2ECJA 2JMJA 4FJCA 4UP5A 5DKAA 2LGGA 2VPBA 4N3WA 2H0DA 4I7DA 1WFKA 2E6RA 2K4DA 3T7LA 2PNXA 4FIPA 1T1HA 2L0BA 2G6QA 5D1MB 2ECTA 3ZYQA 3O36A 1WEUA 2YU4A 4MVTA 3KV5A 1VD4A 4A4BA 4A4CA 5J3XA 4W4UA 2LDRA 3M62A 3LQIA 3ZPVE 3U5MA 2F6JA 1WE9A 2YUCA 4YBMA 3M63A 2DX8A 5H9MA 5AITA 3GL6A 1K2FA 5LCWB 3NG2A 2I50A 4AUQB 5FERA 5B75A 4AVXA 5KH3A 1MM3A 4IC3A 4FK5A 4QF2A 3GV4A 4GNDA 2XEUA 4CCGX 4QF3A 3ZTGA 4B7YC 4CA1A 3U5PA 1RMDA 2YSJA 2CKLA 1WEWA 4R8PK 2RSDA 3LQJA 2UZGA 4IC2A 5D1KB 1Z60A 2YHOA 2KYUA 3EB5A 3T6RA 3HTKC 2MIQA 2VP7A 2F6NA 2KR4A 1Z6UA 2FUIA 4YABA 2VJFB 1WILA 1X4UA 3DPLR 3MHHA 4N4FA 4I7CA 1FP0A 3O7AA 2M3HA 1CHCA 2LRIC 2ECNA 2FSAA 1Z2QA 2QIZA 3ZNIA 3DQVR 3N9LA 5I3LA 3HCSA 4YADA 5C11A 1G25A 2LV9A 5KH9A 1E4UA 2LGVA 2ECWA 5G0FA 4LADB 1VFYA 2EGPA 1LDJB 4FO9A 1BORA 2LQ6A 3VK6A 2RI7A 2VJEB 3SOWA 5LKXA 3N9QA 5LKTA 2K17A 2XB1A 2KWJA 2VPEA 2VJFA 2CKLB 1N87A 4BHWA 2YYRA 2MA6A 3O33A 2QJ0A 4AYCB 1HYIA 1WESA 2YQMA 4Q6FA 2KFTA 2D8SA 2HYED 2JMIA 3N9OA 4WA6A 2YW8A 3N9PA 5DINA 3SOUA 2MD7B 3EB6A 2E6SA 2F42A 3O70A 1WEEA 5B79A 2IDAA 3O34A 3PUQA 4P5OB 2KGIA 2EODA 5TABA 2CSYA 1X4JA 4O64A 2BAYA 4WZ3B 2KIZA 2YURA 4ZQLA 5LKUA 2LN0A 5B77A 4YC9A 1LDKC 4AP4A 2VJEA 4UP0A 5D1LB 4A0CD 1FBVA 4GNGA 2ECGA 1WIMA 1WEQA 4LKAA 2MNYA 3V43A 5LKZA 5C13A 4AYCA 4B86C 2Y1MA 2PUYA 2YSMA 3LRQA 2MT5A 2JRJA 2LGLA 2JMDA 2KREA 3IHPA 1HYJA 2L75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQL A;  2FUU A;  4WZ2 A;  3L11 A;  2L5U A;  4UI9 B;  2MA5 A;  2M85 A;  5JG6 A;  2K16 A;  4S3O B;  3HCU A;  2G45 A;  1JOC A;  4LLB A;  4R2Y A;  1WEO A;  2HDP A;  3MHS A;  3ZVY A;  5H1U A;  1V87 A;  5TDR A;  2L43 A;  4S3O C;  4GNF A;  2MUM A;  2YHN A;  1WEP A;  3ZPV 1;  3QZV A;  2YT5 A;  3N9N A;  3N9M A;  2KGG A;  2VPD A;  3U5O A;  4C9Z A;  2Y1N A;  4A49 A;  2Y43 A;  3C6W A;  5B76 A;  2ECV A;  2LXP C;  1WEM A;  4TKP B;  2NAA A;  5FEY A;  2M1R A;  3SOX A;  5H1V A;  3LQH A;  4YBS A;  3KQI A;  4LJN A;  4R7E A;  1F62 A;  3SHB A;  3HCT A;  1WGM A;  2LGK A;  2M6M A;  5FB1 A;  3KNV A;  2EA6 A;  3RTR B;  4XI1 A;  5TDW A;  2C2L A;  1ZBD B;  1JM7 B;  2C2V S;  1X4I A;  2OXQ C;  4F52 B;  3L1Z B;  2G43 A;  5H1T A;  2VNF A;  1MM2 A;  3L1X A;  2MD8 C;  1WEV A;  1U6G B;  1WEN A;  5B8D A;  3PHD A;  3PUR A;  4BBQ A;  3ZVZ B;  3FL2 A;  3KV6 A;  2KWN A;  3ASL A;  1DVP A;  4NN2 A;  5G05 B;  4ZUX U;  3U5N A;  2YRE A;  5B78 A;  4I7B A;  4MSX A;  4L7X A;  4X3G A;  5FB0 A;  2KU3 A;  2KWK A;  2KWO A;  3C5K A;  2VPG A;  3M99 A;  2L80 A;  3O37 A;  5TBN A;  2CSZ A;  2MNZ A;  4WZ0 A;  4YAX A;  1JM7 A;  4LK9 A;  2LXH C;  3RPG B;  2AN6 A;  3I2D A;  4GB0 A;  4V3L C;  4L58 A;  1VYX A;  2H0D B;  5KH7 A;  4PTB A;  3RPG C;  2CT2 A;  5EYA F;  4YAT A;  4YBT A;  5AIU A;  5TRB A;  4V3K C;  1XWH A;  3O35 A;  2QIC A;  5G04 B;  2KE1 A;  2ZET C;  4PPE A;  1IYM A;  4GNE A;  4ZDT A;  2K1J A;  2ECI A;  2ECJ A;  2JMJ A;  4FJC A;  4UP5 A;  5DKA A;  2LGG A;  2VPB A;  4N3W A;  2H0D A;  4I7D A;  1WFK A;  2E6R A;  2K4D A;  3T7L A;  2PNX A;  4FIP A;  1T1H A;  2L0B A;  2G6Q A;  5D1M B;  2ECT A;  3ZYQ A;  3O36 A;  1WEU A;  2YU4 A;  4MVT A;  3KV5 A;  1VD4 A;  4A4B A;  4A4C A;  5J3X A;  4W4U A;  2LDR A;  3M62 A;  3LQI A;  3ZPV E;  3U5M A;  2F6J A;  1WE9 A;  2YUC A;  4YBM A;  3M63 A;  2DX8 A;  5H9M A;  5AIT A;  3GL6 A;  1K2F A;  5LCW B;  3NG2 A;  2I50 A;  4AUQ B;  5FER A;  5B75 A;  4AVX A;  5KH3 A;  1MM3 A;  4IC3 A;  4FK5 A;  4QF2 A;  3GV4 A;  4GND A;  2XEU A;  4CCG X;  4QF3 A;  3ZTG A;  4B7Y C;  4CA1 A;  3U5P A;  1RMD A;  2YSJ A;  2CKL A;  1WEW A;  4R8P K;  2RSD A;  3LQJ A;  2UZG A;  4IC2 A;  5D1K B;  1Z60 A;  2YHO A;  2KYU A;  3EB5 A;  3T6R A;  3HTK C;  2MIQ A;  2VP7 A;  2F6N A;  2KR4 A;  1Z6U A;  2FUI A;  4YAB A;  2VJF B;  1WIL A;  1X4U A;  3DPL R;  3MHH A;  4N4F A;  4I7C A;  1FP0 A;  3O7A A;  2M3H A;  1CHC A;  2LRI C;  2ECN A;  2FSA A;  1Z2Q A;  2QIZ A;  3ZNI A;  3DQV R;  3N9L A;  5I3L A;  3HCS A;  4YAD A;  5C11 A;  1G25 A;  2LV9 A;  5KH9 A;  1E4U A;  2LGV A;  2ECW A;  5G0F A;  4LAD B;  1VFY A;  2EGP A;  1LDJ B;  4FO9 A;  1BOR A;  2LQ6 A;  3VK6 A;  2RI7 A;  2VJE B;  3SOW A;  5LKX A;  3N9Q A;  5LKT A;  2K17 A;  2XB1 A;  2KWJ A;  2VPE A;  2VJF A;  2CKL B;  1N87 A;  4BHW A;  2YYR A;  2MA6 A;  3O33 A;  2QJ0 A;  4AYC B;  1HYI A;  1WES A;  2YQM A;  4Q6F A;  2KFT A;  2D8S A;  2HYE D;  2JMI A;  3N9O A;  4WA6 A;  2YW8 A;  3N9P A;  5DIN A;  3SOU A;  2MD7 B;  3EB6 A;  2E6S A;  2F42 A;  3O70 A;  1WEE A;  5B79 A;  2IDA A;  3O34 A;  3PUQ A;  4P5O B;  2KGI A;  2EOD A;  5TAB A;  2CSY A;  1X4J A;  4O64 A;  2BAY A;  4WZ3 B;  2KIZ A;  2YUR A;  4ZQL A;  5LKU A;  2LN0 A;  5B77 A;  4YC9 A;  1LDK C;  4AP4 A;  2VJE A;  4UP0 A;  5D1L B;  4A0C D;  1FBV A;  4GNG A;  2ECG A;  1WIM A;  1WEQ A;  4LKA A;  2MNY A;  3V43 A;  5LKZ A;  5C13 A;  4AYC A;  4B86 C;  2Y1M A;  2PUY A;  2YSM A;  3LRQ A;  2MT5 A;  2JRJ A;  2LGL A;  2JMD A;  2KRE A;  3IHP A;  1HYJ A;  2L75 A; 
#chains in the Genus database with same CATH topology
 2YQL A;  2XOZ A;  2FUU A;  4WZ2 A;  3L11 A;  2L5U A;  4UI9 B;  2MA5 A;  2M85 A;  5JG6 A;  2K16 A;  2OWA A;  4S3O B;  3HCU A;  2G45 A;  1JOC A;  4LLB A;  4R2Y A;  1WEO A;  2HDP A;  3MHS A;  3ZVY A;  5H1U A;  1V87 A;  5TDR A;  2L43 A;  2JM3 A;  4S3O C;  4GNF A;  2MUM A;  2YHN A;  4Z0R A;  1WEP A;  3ZPV 1;  3QZV A;  2YT5 A;  3N9N A;  3N9M A;  2KGG A;  2VPD A;  3FM8 C;  3U5O A;  2CRW A;  4C9Z A;  2Y1N A;  4QQ4 A;  4A49 A;  2Y43 A;  3C6W A;  5B76 A;  2ECV A;  2LXP C;  1WEM A;  2XP0 A;  5SVI A;  4TKP B;  2FFW A;  2NAA A;  4H9D A;  5FEY A;  3DDT A;  2M1R A;  3SOX A;  5H1V A;  3LQH A;  2XOC A;  4YBS A;  3KQI A;  4LJN A;  4R7E A;  1F62 A;  3SHB A;  3HCT A;  1WGM A;  2LGK A;  2M6M A;  5FB1 A;  3KNV A;  2EA6 A;  3RTR B;  4XI1 A;  5TDW A;  2MKE A;  2C2L A;  1ZBD B;  1JM7 B;  2C2V S;  1X4I A;  3T9K A;  2OXQ C;  4F52 B;  3L1Z B;  1HYJ A;  2G43 A;  5H1T A;  2VNF A;  1MM2 A;  3L1X A;  2MD8 C;  1WEV A;  1U6G B;  1WEN A;  2DSM A;  3PHD A;  3PUR A;  5B8D A;  4BBQ A;  3ZVZ B;  3FL2 A;  3KV6 A;  2KWN A;  3ASL A;  1DVP A;  4NN2 A;  5G05 B;  1DCQ A;  4ZUX U;  3U5N A;  2YRE A;  5K3Q A;  5B78 A;  4I7B A;  4MSX A;  4L7X A;  4X3G A;  5FB0 A;  2KU3 A;  2KWK A;  2KWO A;  3C5K A;  2VPG A;  3M99 A;  2L80 A;  3O37 A;  4Z0O A;  5TBN A;  2CSZ A;  2MNZ A;  4WZ0 A;  4YAX A;  1JM7 A;  4LK9 A;  2LXH C;  3RPG B;  2AN6 A;  3I2D A;  4GB0 A;  4V3L C;  3FJU B;  4L58 A;  1VYX A;  2H0D B;  5KH7 A;  4PTB A;  2EXU A;  3RPG C;  2CT2 A;  4OGE A;  5EYA F;  4YAT A;  3FAO A;  4YBT A;  5AIU A;  5TRB A;  4V3K C;  1XWH A;  3M7K A;  3O35 A;  2QIC A;  5G04 B;  3FAN A;  2KE1 A;  3PLW A;  2ZET C;  4PPE A;  1IYM A;  4GNE A;  4ZDT A;  2K1J A;  2ECI A;  2ECJ A;  2JMJ A;  4FJC A;  4UP5 A;  5DKA A;  2M13 A;  2LGG A;  2VPB A;  2CRR A;  4N3W A;  5SVX A;  2H0D A;  1MBM A;  3Q1D A;  2E61 A;  4I7D A;  2JUN A;  1WFK A;  2E6R A;  2K4D A;  3T7L A;  2PNX A;  4FIP A;  1T1H A;  2L0B A;  2G6Q A;  5D1M B;  2ECT A;  3ZYQ A;  2LAU A;  3O36 A;  1WEU A;  2YU4 A;  4MVT A;  3KV5 A;  1VD4 A;  4A4B A;  3LVQ E;  4A4C A;  5J3X A;  4W4U A;  2LDR A;  3M62 A;  3LQI A;  3ZPV E;  3U5M A;  2F6J A;  1WE9 A;  2YUC A;  4YBM A;  3M63 A;  2DX8 A;  5H9M A;  5AIT A;  3GL6 A;  1K2F A;  5LCW B;  3NG2 A;  2I50 A;  2KKX A;  4AUQ B;  5FER A;  5B75 A;  4AVX A;  3E2D A;  5KH3 A;  1MM3 A;  4IC3 A;  2CSV A;  4FK5 A;  4QF2 A;  2L7P A;  3GV4 A;  4GND A;  2XEU A;  4CCG X;  3KDE C;  4QF3 A;  3ZTG A;  4B7Y C;  4CA1 A;  3DWD A;  3U5P A;  1RMD A;  2YSJ A;  2CKL A;  2D8U A;  2KKY A;  1WEW A;  4R8P K;  3LJU X;  2RSD A;  2IQJ A;  3LQJ A;  2UZG A;  4IC2 A;  5D1K B;  1Z60 A;  2YHO A;  2KYU A;  3EB5 A;  3T6R A;  3HTK C;  3H7H A;  2MIQ A;  2VP7 A;  2F6N A;  2KR4 A;  1Z6U A;  2B0O E;  2FUI A;  4YAB A;  2VJF B;  4OGC A;  1WIL A;  1X4U A;  3DPL R;  3MHH A;  4F1P A;  4N4F A;  4I7C A;  2CON A;  1FP0 A;  3O47 A;  3O7A A;  2M3H A;  1CHC A;  2LRI C;  2ECN A;  2FSA A;  1Z2Q A;  2QIZ A;  3ZNI A;  3DQV R;  3N9L A;  5I3L A;  3HCS A;  4YAD A;  5C11 A;  1G25 A;  2LV9 A;  5KH9 A;  1E4U A;  2LGV A;  2YVR A;  2ECW A;  5G0F A;  4LAD B;  1VFY A;  2RR4 A;  2EGP A;  1LDJ B;  3LVR E;  4FO9 A;  1BOR A;  2LQ6 A;  3VK6 A;  2RI7 A;  2VJE B;  3SOW A;  5LKX A;  3N9Q A;  5LKT A;  2K17 A;  2XB1 A;  2KWJ A;  2VPE A;  2VJF A;  2CKL B;  1N87 A;  3SUB A;  4BHW A;  2YYR A;  2MA6 A;  2EGM A;  3FEH A;  3MDB C;  3O33 A;  2QJ0 A;  4AYC B;  1HYI A;  3JUE A;  1WES A;  2YQM A;  2P57 A;  4Q6F A;  2KFT A;  2D8S A;  2HYE D;  2JMI A;  3N9O A;  4WA6 A;  2YW8 A;  3N9P A;  5DIN A;  3SOU A;  2MD7 B;  3EB6 A;  2E6S A;  2F42 A;  3O70 A;  1WEE A;  5B79 A;  2IDA A;  3O34 A;  3PUQ A;  4P5O B;  2KGI A;  2EOD A;  5TAB A;  2CSY A;  1X4J A;  4O64 A;  2BAY A;  4WZ3 B;  2KIZ A;  2YUR A;  4ZQL A;  5LKU A;  2FD4 A;  2LN0 A;  5B77 A;  4YC9 A;  1LDK C;  4AP4 A;  2VJE A;  4UP0 A;  5D1L B;  4A0C D;  1FBV A;  4GNG A;  2ECG A;  1WIM A;  1WEQ A;  5SVY A;  4LKA A;  2MNY A;  3V43 A;  5LKZ A;  5C13 A;  3LDY A;  4O62 A;  4AYC A;  4B86 C;  2Y1M A;  2PUY A;  2YSM A;  3LRQ A;  2MT5 A;  2JRJ A;  2LGL A;  2JMD A;  2KRE A;  2DJA A;  2XOY A;  3IHP A;  5SVI B;  2L75 A; 
#chains in the Genus database with same CATH homology
 2YQL A;  2FUU A;  4WZ2 A;  3L11 A;  2L5U A;  4UI9 B;  2MA5 A;  2M85 A;  5JG6 A;  2K16 A;  4S3O B;  3HCU A;  2G45 A;  1JOC A;  4LLB A;  4R2Y A;  1WEO A;  2HDP A;  3MHS A;  3ZVY A;  5H1U A;  1V87 A;  5TDR A;  2L43 A;  4S3O C;  4GNF A;  2MUM A;  2YHN A;  1WEP A;  3ZPV 1;  3QZV A;  2YT5 A;  3N9N A;  3N9M A;  2KGG A;  2VPD A;  3U5O A;  4C9Z A;  2Y1N A;  4A49 A;  2Y43 A;  3C6W A;  5B76 A;  2ECV A;  2LXP C;  1WEM A;  4TKP B;  2NAA A;  5FEY A;  2M1R A;  3SOX A;  5H1V A;  3LQH A;  4YBS A;  3KQI A;  4LJN A;  4R7E A;  1F62 A;  3SHB A;  3HCT A;  1WGM A;  2LGK A;  2M6M A;  5FB1 A;  3KNV A;  2EA6 A;  3RTR B;  4XI1 A;  5TDW A;  2C2L A;  1ZBD B;  1JM7 B;  2C2V S;  1X4I A;  2OXQ C;  4F52 B;  3L1Z B;  2G43 A;  5H1T A;  2VNF A;  1MM2 A;  3L1X A;  2MD8 C;  1WEV A;  1U6G B;  1WEN A;  5B8D A;  3PHD A;  3PUR A;  4BBQ A;  3ZVZ B;  3FL2 A;  3KV6 A;  2KWN A;  3ASL A;  1DVP A;  4NN2 A;  5G05 B;  4ZUX U;  3U5N A;  2YRE A;  5B78 A;  4I7B A;  4MSX A;  4L7X A;  4X3G A;  5FB0 A;  2KU3 A;  2KWK A;  2KWO A;  3C5K A;  2VPG A;  3M99 A;  2L80 A;  3O37 A;  5TBN A;  2CSZ A;  2MNZ A;  4WZ0 A;  4YAX A;  1JM7 A;  4LK9 A;  2LXH C;  3RPG B;  2AN6 A;  3I2D A;  4GB0 A;  4V3L C;  4L58 A;  1VYX A;  2H0D B;  5KH7 A;  4PTB A;  3RPG C;  2CT2 A;  5EYA F;  4YAT A;  4YBT A;  5AIU A;  5TRB A;  4V3K C;  1XWH A;  3O35 A;  2QIC A;  5G04 B;  2KE1 A;  2ZET C;  4PPE A;  1IYM A;  4GNE A;  4ZDT A;  2K1J A;  2ECI A;  2ECJ A;  2JMJ A;  4FJC A;  4UP5 A;  5DKA A;  2LGG A;  2VPB A;  4N3W A;  2H0D A;  4I7D A;  1WFK A;  2E6R A;  2K4D A;  3T7L A;  2PNX A;  4FIP A;  1T1H A;  2L0B A;  2G6Q A;  5D1M B;  2ECT A;  3ZYQ A;  3O36 A;  1WEU A;  2YU4 A;  4MVT A;  3KV5 A;  1VD4 A;  4A4B A;  4A4C A;  5J3X A;  4W4U A;  2LDR A;  3M62 A;  3LQI A;  3ZPV E;  3U5M A;  2F6J A;  1WE9 A;  2YUC A;  4YBM A;  3M63 A;  2DX8 A;  5H9M A;  5AIT A;  3GL6 A;  1K2F A;  5LCW B;  3NG2 A;  2I50 A;  4AUQ B;  5FER A;  5B75 A;  4AVX A;  5KH3 A;  1MM3 A;  4IC3 A;  4FK5 A;  4QF2 A;  3GV4 A;  4GND A;  2XEU A;  4CCG X;  4QF3 A;  3ZTG A;  4B7Y C;  4CA1 A;  3U5P A;  1RMD A;  2YSJ A;  2CKL A;  1WEW A;  4R8P K;  2RSD A;  3LQJ A;  2UZG A;  4IC2 A;  5D1K B;  1Z60 A;  2YHO A;  2KYU A;  3EB5 A;  3T6R A;  3HTK C;  2MIQ A;  2VP7 A;  2F6N A;  2KR4 A;  1Z6U A;  2FUI A;  4YAB A;  2VJF B;  1WIL A;  1X4U A;  3DPL R;  3MHH A;  4N4F A;  4I7C A;  1FP0 A;  3O7A A;  2M3H A;  1CHC A;  2LRI C;  2ECN A;  2FSA A;  1Z2Q A;  2QIZ A;  3ZNI A;  3DQV R;  3N9L A;  5I3L A;  3HCS A;  4YAD A;  5C11 A;  1G25 A;  2LV9 A;  5KH9 A;  1E4U A;  2LGV A;  2ECW A;  5G0F A;  4LAD B;  1VFY A;  2EGP A;  1LDJ B;  4FO9 A;  1BOR A;  2LQ6 A;  3VK6 A;  2RI7 A;  2VJE B;  3SOW A;  5LKX A;  3N9Q A;  5LKT A;  2K17 A;  2XB1 A;  2KWJ A;  2VPE A;  2VJF A;  2CKL B;  1N87 A;  4BHW A;  2YYR A;  2MA6 A;  3O33 A;  2QJ0 A;  4AYC B;  1HYI A;  1WES A;  2YQM A;  4Q6F A;  2KFT A;  2D8S A;  2HYE D;  2JMI A;  3N9O A;  4WA6 A;  2YW8 A;  3N9P A;  5DIN A;  3SOU A;  2MD7 B;  3EB6 A;  2E6S A;  2F42 A;  3O70 A;  1WEE A;  5B79 A;  2IDA A;  3O34 A;  3PUQ A;  4P5O B;  2KGI A;  2EOD A;  5TAB A;  2CSY A;  1X4J A;  4O64 A;  2BAY A;  4WZ3 B;  2KIZ A;  2YUR A;  4ZQL A;  5LKU A;  2LN0 A;  5B77 A;  4YC9 A;  1LDK C;  4AP4 A;  2VJE A;  4UP0 A;  5D1L B;  4A0C D;  1FBV A;  4GNG A;  2ECG A;  1WIM A;  1WEQ A;  4LKA A;  2MNY A;  3V43 A;  5LKZ A;  5C13 A;  4AYC A;  4B86 C;  2Y1M A;  2PUY A;  2YSM A;  3LRQ A;  2MT5 A;  2JRJ A;  2LGL A;  2JMD A;  2KRE A;  3IHP A;  1HYJ A;  2L75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...