4AYCB

Rnf8 ring domain structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
126
Chain Sequence
KDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNINKMVNNLSSEVKERRIVLIRERKAKRLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE RNF8
publication title Rnf168 Ubiquitinates K13-15 on H2A/H2Ax to Drive DNA Damage Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 42
structure length 126
sequence length 127
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4aycB02
2ECVA 3SOWA 5G0FA 5TDWA 2OXQC 4R8PK 1JM7B 2L43A 5KH3A 3ZPV1 3EB5A 3I2DA 5KH9A 3PUQA 4YABA 4A49A 4PTBA 3IHPA 4FK5A 2KYUA 4A0CD 4FIPA 1XWHA 4F52B 1JM7A 5AIUA 3M62A 5TABA 2F6JA 3HCUA 3N9PA 2VP7A 3ZVZB 4S3OC 2F6NA 2K1JA 3N9OA 4W4UA 2D8SA 4QF2A 2JMIA 1WIMA 2IDAA 3V43A 3ZTGA 1WE9A 4P5OB 2EA6A 4GB0A 5J3XA 4XI1A 1WEEA 4YADA 1X4IA 2ECGA 2YQMA 2MUMA 1FP0A 2VJEB 3SOXA 2ECTA 2KIZA 5C13A 2Y1NA 3HCSA 4S3OB 3ZPVE 3KV5A 5FB1A 4X3GA 2QIZA 1WEOA 5DINA 3O33A 3ASLA 2HYED 5H1VA 2KGIA 2L5UA 2VJEA 2RI7A 3O70A 2ECWA 4FO9A 2YSMA 2Y43A 4A4CA 2KR4A 5G04B 5TDRA 1E4UA 3HCTA 5D1LB 2KU3A 1WEWA 5LKZA 4B7YC 3O7AA 2NAAA 2H0DA 5FB0A 4LKAA 2F42A 2YHOA 3NG2A 3LRQA 1WEVA 2DX8A 4CA1A 5B77A 1DVPA 3HTKC 4WZ0A 2M85A 2YQLA 2LGKA 2YW8A 4GNEA 2L0BA 4LJNA 4TKPB 3DPLR 2KREA 3U5NA 3KV6A 4L7XA 3O34A 5B79A 4PPEA 3DQVR 2L75A 3ZNIA 3MHHA 5KH7A 1X4JA 4YBMA 4YAXA 2KE1A 3O35A 2QICA 3N9NA 3GV4A 2LDRA 4R2YA 4V3KC 1VFYA 2M1RA 4BHWA 1T1HA 5H1UA 3U5MA 2KWKA 5C11A 2Y1MA 4C9ZA 5H9MA 1WFKA 4ZQLA 2MD8C 3C5KA 2LV9A 2PNXA 4BBQA 4WA6A 2KWOA 1WENA 4I7BA 4NN2A 4ZUXU 2FSAA 2ECJA 2MNZA 3VK6A 2VPDA 1LDJB 1F62A 1WEQA 2MNYA 4FJCA 3SHBA 5DKAA 4MSXA 2M6MA 4GNGA 2QJ0A 2UZGA 2MIQA 4AVXA 4MVTA 4UI9B 2LGLA 1Z2QA 1ZBDB 2MA6A 4YATA 4N3WA 3L1ZB 2XEUA 2E6SA 5D1KB 2YHNA 2M3HA 2L80A 3O37A 3QZVA 4N4FA 4AYCB 2K17A 2KGGA 3M99A 4YBSA 4LLBA 5B8DA 2YSJA 2VPEA 2LGGA 5B75A 1N87A 5AITA 4IC3A 4AYCA 1JOCA 2YYRA 2G43A 5TBNA 4R7EA 3L11A 4GNFA 2VNFA 4YBTA 1Z6UA 5JG6A 1X4UA 3RPGC 2FUUA 2JRJA 3N9QA 1WEUA 2G6QA 2CKLB 2YUCA 1LDKC 2YREA 2CT2A 5TRBA 3EB6A 2JMDA 4L58A 4WZ2A 2JMJA 4UP5A 1VD4A 3N9LA 3U5PA 3PURA 2KWNA 2ECNA 4CCGX 3ZYQA 1FBVA 2CSYA 3MHSA 2LXPC 3KNVA 2CKLA 3RPGB 5FERA 2YU4A 1G25A 1MM2A 1MM3A 3U5OA 2C2LA 1WEPA 2K4DA 2RSDA 3LQHA 5FEYA 2MD7B 1V87A 1K2FA 5B78A 5G05B 1Z60A 4GNDA 2MA5A 4ZDTA 4YC9A 3C6WA 5H1TA 1WEMA 2XB1A 2LRIC 5EYAF 4AUQB 2YURA 2PUYA 2VJFB 2E6RA 3KQIA 3N9MA 4LADB 2ECIA 2EODA 2MT5A 2CSZA 2HDPA 3LQIA 2ZETC 2AN6A 5LKUA 4I7DA 2G45A 1RMDA 1CHCA 1BORA 2VPBA 2VPGA 2I50A 2K16A 2KFTA 4Q6FA 2VJFA 3L1XA 1VYXA 2LGVA 2YT5A 4LK9A 1WGMA 3T6RA 1U6GB 2EGPA 3T7LA 3FL2A 1IYMA 2BAYA 5LCWB 3O36A 2H0DB 5I3LA 1HYIA 2LQ6A 2LXHC 1WILA 3LQJA 4IC2A 3PHDA 5LKTA 3M63A 3SOUA 4WZ3B 2C2VS 3RTRB 1WESA 4V3LC 2LN0A 4AP4A 4O64A 1HYJA 3GL6A 5D1MB 4QF3A 4A4BA 3ZVYA 4B86C 4I7CA 5B76A 2KWJA 2FUIA 5LKXA 4UP0A
chains in the Genus database with same CATH superfamily
2ECVA 3SOWA 5G0FA 5TDWA 2OXQC 4R8PK 1JM7B 2L43A 5KH3A 3ZPV1 3EB5A 3FM8C 3I2DA 5KH9A 3MDBC 3PUQA 4YABA 5SVYA 4A49A 4PTBA 3IHPA 4FK5A 2KYUA 4A0CD 3H7HA 4FIPA 1XWHA 4F52B 1JM7A 5AIUA 3M62A 3T9KA 5TABA 3DDTA 2F6JA 2CRWA 3HCUA 3N9PA 2VP7A 3ZVZB 4S3OC 2F6NA 2K1JA 3N9OA 4W4UA 2D8SA 4QF2A 2JMIA 1WIMA 2IDAA 3V43A 2KKYA 3ZTGA 1WE9A 2MKEA 4P5OB 2EA6A 4GB0A 2E61A 5J3XA 4XI1A 1WEEA 2XP0A 4YADA 1X4IA 2ECGA 2YQMA 2MUMA 2XOYA 1FP0A 2VJEB 5K3QA 3KDEC 3SOXA 2ECTA 2EXUA 2KIZA 5C13A 2Y1NA 3HCSA 4S3OB 3ZPVE 3KV5A 5FB1A 4X3GA 2QIZA 1WEOA 5DINA 3O33A 3ASLA 2HYED 5H1VA 3SUBA 3DWDA 2KGIA 2L5UA 2VJEA 2M13A 2RI7A 3O70A 3PLWA 2ECWA 4FO9A 2YSMA 2Y43A 4A4CA 2KR4A 2CSVA 5G04B 5TDRA 1E4UA 3HCTA 5D1LB 2CONA 2KU3A 2CRRA 1WEWA 5LKZA 4B7YC 3O7AA 2NAAA 2H0DA 1MBMA 5FB0A 4LKAA 2F42A 3LDYA 2FD4A 2YHOA 3NG2A 3LRQA 1WEVA 2DX8A 4CA1A 5B77A 1DVPA 3HTKC 4WZ0A 2M85A 2YQLA 2LGKA 2YW8A 4GNEA 2L0BA 4LJNA 4TKPB 1DCQA 3DPLR 2KREA 3U5NA 2B0OE 2XOCA 3KV6A 4L7XA 3O34A 5B79A 4PPEA 3LJUX 3DQVR 2L75A 4O62A 3ZNIA 3MHHA 5KH7A 1X4JA 4YBMA 4YAXA 2KE1A 3O35A 3Q1DA 2QICA 2YVRA 3N9NA 2LAUA 3GV4A 2LDRA 4R2YA 4V3KC 1VFYA 2M1RA 3FAOA 3FJUB 4BHWA 2D8UA 1T1HA 5H1UA 3U5MA 2KWKA 5C11A 2Y1MA 4C9ZA 5H9MA 3FEHA 3JUEA 3M7KA 1WFKA 4ZQLA 2MD8C 3C5KA 2L7PA 2LV9A 2PNXA 4H9DA 4BBQA 2JM3A 4WA6A 2RR4A 2KWOA 1WENA 4I7BA 4NN2A 4ZUXU 2FSAA 2ECJA 2MNZA 3VK6A 2VPDA 1LDJB 1F62A 1WEQA 3E2DA 2MNYA 4FJCA 3SHBA 5DKAA 4MSXA 3LVRE 4OGCA 2M6MA 4GNGA 2QJ0A 2UZGA 2MIQA 4AVXA 4MVTA 4UI9B 2LGLA 1Z2QA 1ZBDB 2MA6A 4YATA 4N3WA 2OWAA 3L1ZB 2XEUA 2E6SA 2KKXA 5D1KB 2YHNA 2IQJA 2M3HA 2L80A 3O37A 2JUNA 2EGMA 3QZVA 4N4FA 4AYCB 2K17A 2KGGA 3M99A 4YBSA 3LVQE 4LLBA 5B8DA 2YSJA 2VPEA 2DSMA 2LGGA 5B75A 1N87A 5AITA 2FFWA 2XOZA 4IC3A 4AYCA 1JOCA 2YYRA 2G43A 5TBNA 4R7EA 3L11A 4GNFA 2VNFA 4YBTA 4F1PA 1Z6UA 5JG6A 1X4UA 3RPGC 2FUUA 2JRJA 3N9QA 1WEUA 2G6QA 2CKLB 2YUCA 1LDKC 2YREA 2CT2A 5SVXA 5TRBA 3EB6A 2JMDA 4L58A 4WZ2A 2JMJA 4UP5A 1VD4A 3N9LA 3U5PA 3PURA 2KWNA 2ECNA 4CCGX 3ZYQA 1FBVA 2CSYA 3MHSA 2LXPC 3KNVA 2CKLA 3RPGB 5FERA 2YU4A 1G25A 1MM2A 1MM3A 4Z0RA 3U5OA 2C2LA 1WEPA 2K4DA 2RSDA 3LQHA 5FEYA 2MD7B 1V87A 4Z0OA 1K2FA 5B78A 5G05B 1Z60A 4GNDA 2MA5A 4ZDTA 4YC9A 3C6WA 5H1TA 1WEMA 2XB1A 2LRIC 5EYAF 4AUQB 2YURA 2PUYA 2VJFB 2E6RA 3KQIA 3N9MA 4LADB 2ECIA 2EODA 2MT5A 2CSZA 2HDPA 3LQIA 2ZETC 2AN6A 5LKUA 4I7DA 2G45A 1RMDA 1CHCA 5SVIB 1BORA 2VPBA 2VPGA 2I50A 2K16A 2KFTA 4Q6FA 2VJFA 3L1XA 1VYXA 2LGVA 2YT5A 4LK9A 1WGMA 3T6RA 1U6GB 2EGPA 3T7LA 3FL2A 1IYMA 4OGEA 2BAYA 4QQ4A 5LCWB 2DJAA 3O36A 5SVIA 2H0DB 5I3LA 1HYIA 2LQ6A 2LXHC 2P57A 1WILA 3LQJA 4IC2A 3O47A 3PHDA 5LKTA 3FANA 3M63A 3SOUA 4WZ3B 2C2VS 3RTRB 1WESA 4V3LC 2LN0A 4AP4A 4O64A 1HYJA 3GL6A 5D1MB 4QF3A 4A4BA 3ZVYA 4B86C 4I7CA 5B76A 2KWJA 2FUIA 5LKXA 4UP0A
chains in the Genus database with same CATH topology
2ECVA 3SOWA 5G0FA 5TDWA 2OXQC 4R8PK 1JM7B 2L43A 5KH3A 3ZPV1 3EB5A 3I2DA 5KH9A 3PUQA 4YABA 4A49A 4PTBA 3IHPA 4FK5A 2KYUA 4A0CD 4FIPA 1XWHA 4F52B 1JM7A 5AIUA 3M62A 5TABA 2F6JA 3HCUA 3N9PA 2VP7A 3ZVZB 4S3OC 2F6NA 2K1JA 3N9OA 4W4UA 2D8SA 4QF2A 2JMIA 1WIMA 2IDAA 3V43A 3ZTGA 1WE9A 4P5OB 2EA6A 4GB0A 5J3XA 4XI1A 1WEEA 4YADA 1X4IA 2ECGA 2YQMA 2MUMA 1FP0A 2VJEB 3SOXA 2ECTA 2KIZA 5C13A 2Y1NA 3HCSA 4S3OB 3ZPVE 3KV5A 5FB1A 4X3GA 2QIZA 1WEOA 5DINA 3O33A 3ASLA 2HYED 5H1VA 2KGIA 2L5UA 2VJEA 2RI7A 3O70A 2ECWA 4FO9A 2YSMA 2Y43A 4A4CA 2KR4A 5G04B 5TDRA 1E4UA 3HCTA 5D1LB 2KU3A 1WEWA 5LKZA 4B7YC 3O7AA 2NAAA 2H0DA 5FB0A 4LKAA 2F42A 2YHOA 3NG2A 3LRQA 1WEVA 2DX8A 4CA1A 5B77A 1DVPA 3HTKC 4WZ0A 2M85A 2YQLA 2LGKA 2YW8A 4GNEA 2L0BA 4LJNA 4TKPB 3DPLR 2KREA 3U5NA 3KV6A 4L7XA 3O34A 5B79A 4PPEA 3DQVR 2L75A 3ZNIA 3MHHA 5KH7A 1X4JA 4YBMA 4YAXA 2KE1A 3O35A 2QICA 3N9NA 3GV4A 2LDRA 4R2YA 4V3KC 1VFYA 2M1RA 4BHWA 1T1HA 5H1UA 3U5MA 2KWKA 5C11A 2Y1MA 4C9ZA 5H9MA 1WFKA 4ZQLA 2MD8C 3C5KA 2LV9A 2PNXA 4BBQA 4WA6A 2KWOA 1WENA 4I7BA 4NN2A 4ZUXU 2FSAA 2ECJA 2MNZA 3VK6A 2VPDA 1LDJB 1F62A 1WEQA 2MNYA 4FJCA 3SHBA 5DKAA 4MSXA 2M6MA 4GNGA 2QJ0A 2UZGA 2MIQA 4AVXA 4MVTA 4UI9B 2LGLA 1Z2QA 1ZBDB 2MA6A 4YATA 4N3WA 3L1ZB 2XEUA 2E6SA 5D1KB 2YHNA 2M3HA 2L80A 3O37A 3QZVA 4N4FA 4AYCB 2K17A 2KGGA 3M99A 4YBSA 4LLBA 5B8DA 2YSJA 2VPEA 2LGGA 5B75A 1N87A 5AITA 4IC3A 4AYCA 1JOCA 2YYRA 2G43A 5TBNA 4R7EA 3L11A 4GNFA 2VNFA 4YBTA 1Z6UA 5JG6A 1X4UA 3RPGC 2FUUA 2JRJA 3N9QA 1WEUA 2G6QA 2CKLB 2YUCA 1LDKC 2YREA 2CT2A 5TRBA 3EB6A 2JMDA 4L58A 4WZ2A 2JMJA 4UP5A 1VD4A 3N9LA 3U5PA 3PURA 2KWNA 2ECNA 4CCGX 3ZYQA 1FBVA 2CSYA 3MHSA 2LXPC 3KNVA 2CKLA 3RPGB 5FERA 2YU4A 1G25A 1MM2A 1MM3A 3U5OA 2C2LA 1WEPA 2K4DA 2RSDA 3LQHA 5FEYA 2MD7B 1V87A 1K2FA 5B78A 5G05B 1Z60A 4GNDA 2MA5A 4ZDTA 4YC9A 3C6WA 5H1TA 1WEMA 2XB1A 2LRIC 5EYAF 4AUQB 2YURA 2PUYA 2VJFB 2E6RA 3KQIA 3N9MA 4LADB 2ECIA 2EODA 2MT5A 2CSZA 2HDPA 3LQIA 2ZETC 2AN6A 5LKUA 4I7DA 2G45A 1RMDA 1CHCA 1BORA 2VPBA 2VPGA 2I50A 2K16A 2KFTA 4Q6FA 2VJFA 3L1XA 1VYXA 2LGVA 2YT5A 4LK9A 1WGMA 3T6RA 1U6GB 2EGPA 3T7LA 3FL2A 1IYMA 2BAYA 5LCWB 3O36A 2H0DB 5I3LA 1HYIA 2LQ6A 2LXHC 1WILA 3LQJA 4IC2A 3PHDA 5LKTA 3M63A 3SOUA 4WZ3B 2C2VS 3RTRB 1WESA 4V3LC 2LN0A 4AP4A 4O64A 1HYJA 3GL6A 5D1MB 4QF3A 4A4BA 3ZVYA 4B86C 4I7CA 5B76A 2KWJA 2FUIA 5LKXA 4UP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECV A;  3SOW A;  5G0F A;  5TDW A;  2OXQ C;  4R8P K;  1JM7 B;  2L43 A;  5KH3 A;  3ZPV 1;  3EB5 A;  3I2D A;  5KH9 A;  3PUQ A;  4YAB A;  4A49 A;  4PTB A;  3IHP A;  4FK5 A;  2KYU A;  4A0C D;  4FIP A;  1XWH A;  4F52 B;  1JM7 A;  5AIU A;  3M62 A;  5TAB A;  2F6J A;  3HCU A;  3N9P A;  2VP7 A;  3ZVZ B;  4S3O C;  2F6N A;  2K1J A;  3N9O A;  4W4U A;  2D8S A;  4QF2 A;  2JMI A;  1WIM A;  2IDA A;  3V43 A;  3ZTG A;  1WE9 A;  4P5O B;  2EA6 A;  4GB0 A;  5J3X A;  4XI1 A;  1WEE A;  4YAD A;  1X4I A;  2ECG A;  2YQM A;  2MUM A;  1FP0 A;  2VJE B;  3SOX A;  2ECT A;  2KIZ A;  5C13 A;  2Y1N A;  3HCS A;  4S3O B;  3ZPV E;  3KV5 A;  5FB1 A;  4X3G A;  2QIZ A;  1WEO A;  5DIN A;  3O33 A;  3ASL A;  2HYE D;  5H1V A;  2KGI A;  2L5U A;  2VJE A;  2RI7 A;  3O70 A;  2ECW A;  4FO9 A;  2YSM A;  2Y43 A;  4A4C A;  2KR4 A;  5G04 B;  5TDR A;  1E4U A;  3HCT A;  5D1L B;  2KU3 A;  1WEW A;  5LKZ A;  4B7Y C;  3O7A A;  2NAA A;  2H0D A;  5FB0 A;  4LKA A;  2F42 A;  2YHO A;  3NG2 A;  3LRQ A;  1WEV A;  2DX8 A;  4CA1 A;  5B77 A;  1DVP A;  3HTK C;  4WZ0 A;  2M85 A;  2YQL A;  2LGK A;  2YW8 A;  4GNE A;  2L0B A;  4LJN A;  4TKP B;  3DPL R;  2KRE A;  3U5N A;  3KV6 A;  4L7X A;  3O34 A;  5B79 A;  4PPE A;  3DQV R;  2L75 A;  3ZNI A;  3MHH A;  5KH7 A;  1X4J A;  4YBM A;  4YAX A;  2KE1 A;  3O35 A;  2QIC A;  3N9N A;  3GV4 A;  2LDR A;  4R2Y A;  4V3K C;  1VFY A;  2M1R A;  4BHW A;  1T1H A;  5H1U A;  3U5M A;  2KWK A;  5C11 A;  2Y1M A;  4C9Z A;  5H9M A;  1WFK A;  4ZQL A;  2MD8 C;  3C5K A;  2LV9 A;  2PNX A;  4BBQ A;  4WA6 A;  2KWO A;  1WEN A;  4I7B A;  4NN2 A;  4ZUX U;  2FSA A;  2ECJ A;  2MNZ A;  3VK6 A;  2VPD A;  1LDJ B;  1F62 A;  1WEQ A;  2MNY A;  4FJC A;  3SHB A;  5DKA A;  4MSX A;  2M6M A;  4GNG A;  2QJ0 A;  2UZG A;  2MIQ A;  4AVX A;  4MVT A;  4UI9 B;  2LGL A;  1Z2Q A;  1ZBD B;  2MA6 A;  4YAT A;  4N3W A;  3L1Z B;  2XEU A;  2E6S A;  5D1K B;  2YHN A;  2M3H A;  2L80 A;  3O37 A;  3QZV A;  4N4F A;  4AYC B;  2K17 A;  2KGG A;  3M99 A;  4YBS A;  4LLB A;  5B8D A;  2YSJ A;  2VPE A;  2LGG A;  5B75 A;  1N87 A;  5AIT A;  4IC3 A;  4AYC A;  1JOC A;  2YYR A;  2G43 A;  5TBN A;  4R7E A;  3L11 A;  4GNF A;  2VNF A;  4YBT A;  1Z6U A;  5JG6 A;  1X4U A;  3RPG C;  2FUU A;  2JRJ A;  3N9Q A;  1WEU A;  2G6Q A;  2CKL B;  2YUC A;  1LDK C;  2YRE A;  2CT2 A;  5TRB A;  3EB6 A;  2JMD A;  4L58 A;  4WZ2 A;  2JMJ A;  4UP5 A;  1VD4 A;  3N9L A;  3U5P A;  3PUR A;  2KWN A;  2ECN A;  4CCG X;  3ZYQ A;  1FBV A;  2CSY A;  3MHS A;  2LXP C;  3KNV A;  2CKL A;  3RPG B;  5FER A;  2YU4 A;  1G25 A;  1MM2 A;  1MM3 A;  3U5O A;  2C2L A;  1WEP A;  2K4D A;  2RSD A;  3LQH A;  5FEY A;  2MD7 B;  1V87 A;  1K2F A;  5B78 A;  5G05 B;  1Z60 A;  4GND A;  2MA5 A;  4ZDT A;  4YC9 A;  3C6W A;  5H1T A;  1WEM A;  2XB1 A;  2LRI C;  5EYA F;  4AUQ B;  2YUR A;  2PUY A;  2VJF B;  2E6R A;  3KQI A;  3N9M A;  4LAD B;  2ECI A;  2EOD A;  2MT5 A;  2CSZ A;  2HDP A;  3LQI A;  2ZET C;  2AN6 A;  5LKU A;  4I7D A;  2G45 A;  1RMD A;  1CHC A;  1BOR A;  2VPB A;  2VPG A;  2I50 A;  2K16 A;  2KFT A;  4Q6F A;  2VJF A;  3L1X A;  1VYX A;  2LGV A;  2YT5 A;  4LK9 A;  1WGM A;  3T6R A;  1U6G B;  2EGP A;  3T7L A;  3FL2 A;  1IYM A;  2BAY A;  5LCW B;  3O36 A;  2H0D B;  5I3L A;  1HYI A;  2LQ6 A;  2LXH C;  1WIL A;  3LQJ A;  4IC2 A;  3PHD A;  5LKT A;  3M63 A;  3SOU A;  4WZ3 B;  2C2V S;  3RTR B;  1WES A;  4V3L C;  2LN0 A;  4AP4 A;  4O64 A;  1HYJ A;  3GL6 A;  5D1M B;  4QF3 A;  4A4B A;  3ZVY A;  4B86 C;  4I7C A;  5B76 A;  2KWJ A;  2FUI A;  5LKX A;  4UP0 A; 
#chains in the Genus database with same CATH topology
 2ECV A;  3SOW A;  5G0F A;  5TDW A;  2OXQ C;  4R8P K;  1JM7 B;  2L43 A;  5KH3 A;  3ZPV 1;  3EB5 A;  3FM8 C;  3I2D A;  5KH9 A;  3MDB C;  3PUQ A;  4YAB A;  5SVY A;  4A49 A;  4PTB A;  3IHP A;  4FK5 A;  2KYU A;  4A0C D;  3H7H A;  4FIP A;  1XWH A;  4F52 B;  1JM7 A;  5AIU A;  3M62 A;  3T9K A;  5TAB A;  3DDT A;  2F6J A;  2CRW A;  3HCU A;  3N9P A;  2VP7 A;  3ZVZ B;  4S3O C;  2F6N A;  2K1J A;  3N9O A;  4W4U A;  2D8S A;  4QF2 A;  2JMI A;  1WIM A;  2IDA A;  3V43 A;  2KKY A;  3ZTG A;  1WE9 A;  2MKE A;  4P5O B;  2EA6 A;  4GB0 A;  2E61 A;  5J3X A;  4XI1 A;  1WEE A;  2XP0 A;  4YAD A;  1X4I A;  2ECG A;  2YQM A;  2MUM A;  2XOY A;  1FP0 A;  2VJE B;  5K3Q A;  3KDE C;  3SOX A;  2ECT A;  2EXU A;  2KIZ A;  5C13 A;  2Y1N A;  3HCS A;  4S3O B;  3ZPV E;  3KV5 A;  5FB1 A;  4X3G A;  2QIZ A;  1WEO A;  5DIN A;  3O33 A;  3ASL A;  2HYE D;  5H1V A;  3SUB A;  3DWD A;  2KGI A;  2L5U A;  2VJE A;  2M13 A;  2RI7 A;  3O70 A;  3PLW A;  2ECW A;  4FO9 A;  2YSM A;  2Y43 A;  4A4C A;  2KR4 A;  2CSV A;  5G04 B;  5TDR A;  1E4U A;  3HCT A;  5D1L B;  2CON A;  2KU3 A;  2CRR A;  1WEW A;  5LKZ A;  4B7Y C;  3O7A A;  2NAA A;  2H0D A;  1MBM A;  5FB0 A;  4LKA A;  2F42 A;  3LDY A;  2FD4 A;  2YHO A;  3NG2 A;  3LRQ A;  1WEV A;  2DX8 A;  4CA1 A;  5B77 A;  1DVP A;  3HTK C;  4WZ0 A;  2M85 A;  2YQL A;  2LGK A;  2YW8 A;  4GNE A;  2L0B A;  4LJN A;  4TKP B;  1DCQ A;  3DPL R;  2KRE A;  3U5N A;  2B0O E;  2XOC A;  3KV6 A;  4L7X A;  3O34 A;  5B79 A;  4PPE A;  3LJU X;  3DQV R;  2L75 A;  4O62 A;  3ZNI A;  3MHH A;  5KH7 A;  1X4J A;  4YBM A;  4YAX A;  2KE1 A;  3O35 A;  3Q1D A;  2QIC A;  2YVR A;  3N9N A;  2LAU A;  3GV4 A;  2LDR A;  4R2Y A;  4V3K C;  1VFY A;  2M1R A;  3FAO A;  3FJU B;  4BHW A;  2D8U A;  1T1H A;  5H1U A;  3U5M A;  2KWK A;  5C11 A;  2Y1M A;  4C9Z A;  5H9M A;  3FEH A;  3JUE A;  3M7K A;  1WFK A;  4ZQL A;  2MD8 C;  3C5K A;  2L7P A;  2LV9 A;  2PNX A;  4H9D A;  4BBQ A;  2JM3 A;  4WA6 A;  2RR4 A;  2KWO A;  1WEN A;  4I7B A;  4NN2 A;  4ZUX U;  2FSA A;  2ECJ A;  2MNZ A;  3VK6 A;  2VPD A;  1LDJ B;  1F62 A;  1WEQ A;  3E2D A;  2MNY A;  4FJC A;  3SHB A;  5DKA A;  4MSX A;  3LVR E;  4OGC A;  2M6M A;  4GNG A;  2QJ0 A;  2UZG A;  2MIQ A;  4AVX A;  4MVT A;  4UI9 B;  2LGL A;  1Z2Q A;  1ZBD B;  2MA6 A;  4YAT A;  4N3W A;  2OWA A;  3L1Z B;  2XEU A;  2E6S A;  2KKX A;  5D1K B;  2YHN A;  2IQJ A;  2M3H A;  2L80 A;  3O37 A;  2JUN A;  2EGM A;  3QZV A;  4N4F A;  4AYC B;  2K17 A;  2KGG A;  3M99 A;  4YBS A;  3LVQ E;  4LLB A;  5B8D A;  2YSJ A;  2VPE A;  2DSM A;  2LGG A;  5B75 A;  1N87 A;  5AIT A;  2FFW A;  2XOZ A;  4IC3 A;  4AYC A;  1JOC A;  2YYR A;  2G43 A;  5TBN A;  4R7E A;  3L11 A;  4GNF A;  2VNF A;  4YBT A;  4F1P A;  1Z6U A;  5JG6 A;  1X4U A;  3RPG C;  2FUU A;  2JRJ A;  3N9Q A;  1WEU A;  2G6Q A;  2CKL B;  2YUC A;  1LDK C;  2YRE A;  2CT2 A;  5SVX A;  5TRB A;  3EB6 A;  2JMD A;  4L58 A;  4WZ2 A;  2JMJ A;  4UP5 A;  1VD4 A;  3N9L A;  3U5P A;  3PUR A;  2KWN A;  2ECN A;  4CCG X;  3ZYQ A;  1FBV A;  2CSY A;  3MHS A;  2LXP C;  3KNV A;  2CKL A;  3RPG B;  5FER A;  2YU4 A;  1G25 A;  1MM2 A;  1MM3 A;  4Z0R A;  3U5O A;  2C2L A;  1WEP A;  2K4D A;  2RSD A;  3LQH A;  5FEY A;  2MD7 B;  1V87 A;  4Z0O A;  1K2F A;  5B78 A;  5G05 B;  1Z60 A;  4GND A;  2MA5 A;  4ZDT A;  4YC9 A;  3C6W A;  5H1T A;  1WEM A;  2XB1 A;  2LRI C;  5EYA F;  4AUQ B;  2YUR A;  2PUY A;  2VJF B;  2E6R A;  3KQI A;  3N9M A;  4LAD B;  2ECI A;  2EOD A;  2MT5 A;  2CSZ A;  2HDP A;  3LQI A;  2ZET C;  2AN6 A;  5LKU A;  4I7D A;  2G45 A;  1RMD A;  1CHC A;  5SVI B;  1BOR A;  2VPB A;  2VPG A;  2I50 A;  2K16 A;  2KFT A;  4Q6F A;  2VJF A;  3L1X A;  1VYX A;  2LGV A;  2YT5 A;  4LK9 A;  1WGM A;  3T6R A;  1U6G B;  2EGP A;  3T7L A;  3FL2 A;  1IYM A;  4OGE A;  2BAY A;  4QQ4 A;  5LCW B;  2DJA A;  3O36 A;  5SVI A;  2H0D B;  5I3L A;  1HYI A;  2LQ6 A;  2LXH C;  2P57 A;  1WIL A;  3LQJ A;  4IC2 A;  3O47 A;  3PHD A;  5LKT A;  3FAN A;  3M63 A;  3SOU A;  4WZ3 B;  2C2V S;  3RTR B;  1WES A;  4V3L C;  2LN0 A;  4AP4 A;  4O64 A;  1HYJ A;  3GL6 A;  5D1M B;  4QF3 A;  4A4B A;  3ZVY A;  4B86 C;  4I7C A;  5B76 A;  2KWJ A;  2FUI A;  5LKX A;  4UP0 A; 
#chains in the Genus database with same CATH homology
 2ECV A;  3SOW A;  5G0F A;  5TDW A;  2OXQ C;  4R8P K;  1JM7 B;  2L43 A;  5KH3 A;  3ZPV 1;  3EB5 A;  3I2D A;  5KH9 A;  3PUQ A;  4YAB A;  4A49 A;  4PTB A;  3IHP A;  4FK5 A;  2KYU A;  4A0C D;  4FIP A;  1XWH A;  4F52 B;  1JM7 A;  5AIU A;  3M62 A;  5TAB A;  2F6J A;  3HCU A;  3N9P A;  2VP7 A;  3ZVZ B;  4S3O C;  2F6N A;  2K1J A;  3N9O A;  4W4U A;  2D8S A;  4QF2 A;  2JMI A;  1WIM A;  2IDA A;  3V43 A;  3ZTG A;  1WE9 A;  4P5O B;  2EA6 A;  4GB0 A;  5J3X A;  4XI1 A;  1WEE A;  4YAD A;  1X4I A;  2ECG A;  2YQM A;  2MUM A;  1FP0 A;  2VJE B;  3SOX A;  2ECT A;  2KIZ A;  5C13 A;  2Y1N A;  3HCS A;  4S3O B;  3ZPV E;  3KV5 A;  5FB1 A;  4X3G A;  2QIZ A;  1WEO A;  5DIN A;  3O33 A;  3ASL A;  2HYE D;  5H1V A;  2KGI A;  2L5U A;  2VJE A;  2RI7 A;  3O70 A;  2ECW A;  4FO9 A;  2YSM A;  2Y43 A;  4A4C A;  2KR4 A;  5G04 B;  5TDR A;  1E4U A;  3HCT A;  5D1L B;  2KU3 A;  1WEW A;  5LKZ A;  4B7Y C;  3O7A A;  2NAA A;  2H0D A;  5FB0 A;  4LKA A;  2F42 A;  2YHO A;  3NG2 A;  3LRQ A;  1WEV A;  2DX8 A;  4CA1 A;  5B77 A;  1DVP A;  3HTK C;  4WZ0 A;  2M85 A;  2YQL A;  2LGK A;  2YW8 A;  4GNE A;  2L0B A;  4LJN A;  4TKP B;  3DPL R;  2KRE A;  3U5N A;  3KV6 A;  4L7X A;  3O34 A;  5B79 A;  4PPE A;  3DQV R;  2L75 A;  3ZNI A;  3MHH A;  5KH7 A;  1X4J A;  4YBM A;  4YAX A;  2KE1 A;  3O35 A;  2QIC A;  3N9N A;  3GV4 A;  2LDR A;  4R2Y A;  4V3K C;  1VFY A;  2M1R A;  4BHW A;  1T1H A;  5H1U A;  3U5M A;  2KWK A;  5C11 A;  2Y1M A;  4C9Z A;  5H9M A;  1WFK A;  4ZQL A;  2MD8 C;  3C5K A;  2LV9 A;  2PNX A;  4BBQ A;  4WA6 A;  2KWO A;  1WEN A;  4I7B A;  4NN2 A;  4ZUX U;  2FSA A;  2ECJ A;  2MNZ A;  3VK6 A;  2VPD A;  1LDJ B;  1F62 A;  1WEQ A;  2MNY A;  4FJC A;  3SHB A;  5DKA A;  4MSX A;  2M6M A;  4GNG A;  2QJ0 A;  2UZG A;  2MIQ A;  4AVX A;  4MVT A;  4UI9 B;  2LGL A;  1Z2Q A;  1ZBD B;  2MA6 A;  4YAT A;  4N3W A;  3L1Z B;  2XEU A;  2E6S A;  5D1K B;  2YHN A;  2M3H A;  2L80 A;  3O37 A;  3QZV A;  4N4F A;  4AYC B;  2K17 A;  2KGG A;  3M99 A;  4YBS A;  4LLB A;  5B8D A;  2YSJ A;  2VPE A;  2LGG A;  5B75 A;  1N87 A;  5AIT A;  4IC3 A;  4AYC A;  1JOC A;  2YYR A;  2G43 A;  5TBN A;  4R7E A;  3L11 A;  4GNF A;  2VNF A;  4YBT A;  1Z6U A;  5JG6 A;  1X4U A;  3RPG C;  2FUU A;  2JRJ A;  3N9Q A;  1WEU A;  2G6Q A;  2CKL B;  2YUC A;  1LDK C;  2YRE A;  2CT2 A;  5TRB A;  3EB6 A;  2JMD A;  4L58 A;  4WZ2 A;  2JMJ A;  4UP5 A;  1VD4 A;  3N9L A;  3U5P A;  3PUR A;  2KWN A;  2ECN A;  4CCG X;  3ZYQ A;  1FBV A;  2CSY A;  3MHS A;  2LXP C;  3KNV A;  2CKL A;  3RPG B;  5FER A;  2YU4 A;  1G25 A;  1MM2 A;  1MM3 A;  3U5O A;  2C2L A;  1WEP A;  2K4D A;  2RSD A;  3LQH A;  5FEY A;  2MD7 B;  1V87 A;  1K2F A;  5B78 A;  5G05 B;  1Z60 A;  4GND A;  2MA5 A;  4ZDT A;  4YC9 A;  3C6W A;  5H1T A;  1WEM A;  2XB1 A;  2LRI C;  5EYA F;  4AUQ B;  2YUR A;  2PUY A;  2VJF B;  2E6R A;  3KQI A;  3N9M A;  4LAD B;  2ECI A;  2EOD A;  2MT5 A;  2CSZ A;  2HDP A;  3LQI A;  2ZET C;  2AN6 A;  5LKU A;  4I7D A;  2G45 A;  1RMD A;  1CHC A;  1BOR A;  2VPB A;  2VPG A;  2I50 A;  2K16 A;  2KFT A;  4Q6F A;  2VJF A;  3L1X A;  1VYX A;  2LGV A;  2YT5 A;  4LK9 A;  1WGM A;  3T6R A;  1U6G B;  2EGP A;  3T7L A;  3FL2 A;  1IYM A;  2BAY A;  5LCW B;  3O36 A;  2H0D B;  5I3L A;  1HYI A;  2LQ6 A;  2LXH C;  1WIL A;  3LQJ A;  4IC2 A;  3PHD A;  5LKT A;  3M63 A;  3SOU A;  4WZ3 B;  2C2V S;  3RTR B;  1WES A;  4V3L C;  2LN0 A;  4AP4 A;  4O64 A;  1HYJ A;  3GL6 A;  5D1M B;  4QF3 A;  4A4B A;  3ZVY A;  4B86 C;  4I7C A;  5B76 A;  2KWJ A;  2FUI A;  5LKX A;  4UP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...