5SVIB

Morc3 cw domain in complex with unmodified histone h3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
GPLGSDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5sviB00
5SVIA 2E61A 2L7PA 4O62A 5SVYA 4Z0RA 2RR4A 4QQ4A 5SVIB 4Z0OA 5SVXA
chains in the Genus database with same CATH superfamily
5LKUA 2CSVA 4GNGA 2RSDA 1Z60A 2LAUA 4I7BA 2LXPC 3E2DA 2JRJA 5G04B 2LQ6A 2YREA 2MT5A 3U5OA 5FB1A 2RR4A 3C6WA 2XB1A 2CSYA 4YADA 2E6SA 3LVRE 3O33A 4NN2A 2G6QA 5FERA 3DQVR 3MHSA 2M1RA 2VJEA 4UI9B 4AVXA 2XP0A 2PUYA 2KWOA 1IYMA 1WILA 3ZVZB 2CONA 2MNYA 3O35A 1MM3A 1ZBDB 2QJ0A 1HYJA 2VNFA 2ECVA 2MIQA 4BHWA 5KH9A 2BAYA 1VFYA 2VJFA 5SVXA 2HDPA 2I50A 3DWDA 3DDTA 2L43A 2XOYA 1E4UA 2ECWA 1WIMA 2MNZA 2MD8C 3Q1DA 3ZPV1 2K1JA 4V3LC 5H1UA 2CKLB 3PHDA 1WEOA 4MSXA 1LDJB 5C13A 2VJEB 2E6RA 3RTRB 1WEEA 3LJUX 3EB5A 4V3KC 1WEQA 1K2FA 5D1KB 4UP5A 5LCWB 3I2DA 2KWNA 5D1LB 1WEMA 4FJCA 5B79A 2YQMA 2YSJA 2K17A 4ZDTA 2KFTA 2CRRA 1HYIA 4O64A 5JG6A 2LN0A 3LRQA 1JOCA 1WEWA 4A4BA 1FBVA 2YHNA 5TRBA 3NG2A 4C9ZA 4B86C 3HCUA 4LK9A 2P57A 1X4IA 1V87A 4YC9A 2XOZA 5G05B 2QIZA 3GV4A 3GL6A 5B77A 2F42A 2ECNA 1XWHA 2OWAA 2LGLA 3LQIA 3T9KA 1MBMA 2M85A 4I7DA 5KH7A 3T6RA 5TDWA 2YQLA 5B75A 1VD4A 2KR4A 4Z0OA 2KKYA 2CSZA 3EB6A 1F62A 2FUIA 3M99A 3ZYQA 4A4CA 2IDAA 2CT2A 3PURA 2KIZA 3SUBA 4PPEA 3ZNIA 2H0DA 2L0BA 1X4UA 3HCSA 5B8DA 4QF2A 5EYAF 3SOWA 2CKLA 1N87A 2UZGA 3FANA 2KYUA 5DKAA 1WFKA 2EGMA 2L5UA 3LQJA 1VYXA 2Y1NA 3O47A 4AYCB 3N9OA 2YT5A 2F6JA 3ZPVE 2LV9A 4YAXA 4YABA 1WENA 5TBNA 4F1PA 4YBSA 3L11A 2IQJA 4O62A 2ECIA 4A49A 2LRIC 3FAOA 3MDBC 3ZTGA 4PTBA 5SVYA 1CHCA 2H0DB 2KU3A 5G0FA 2JMDA 3U5MA 4WZ2A 4H9DA 2JMIA 5D1MB 4AP4A 5H1TA 1MM2A 1WEVA 2B0OE 2KKXA 2KGGA 5J3XA 3N9QA 3LVQE 3KDEC 4L7XA 4R2YA 5B78A 4CA1A 2L7PA 3H7HA 2ECTA 2KREA 1WEPA 2YW8A 2EA6A 3M63A 2VPBA 5TABA 3L1ZB 3KQIA 5LKZA 5AITA 5AIUA 2DJAA 1WGMA 4N4FA 2C2VS 4N3WA 4XI1A 3ZVYA 3N9NA 4LADB 3N9PA 3U5NA 2D8UA 2E61A 2EODA 2LDRA 4W4UA 1WE9A 2YSMA 3RPGB 4MVTA 2YU4A 2JM3A 1RMDA 2ECGA 4R8PK 3L1XA 2ECJA 3VK6A 4AYCA 1G25A 1WEUA 3SHBA 2EGPA 2KWJA 3PUQA 4FIPA 4B7YC 1Z6UA 4ZUXU 2ZETC 1FP0A 4LJNA 3PLWA 2Y43A 3O36A 2HYED 3LDYA 3KNVA 2MUMA 5SVIA 2C2LA 3FM8C 2NAAA 4FK5A 3M7KA 4CCGX 2G45A 3RPGC 1DVPA 1LDKC 3O37A 2XOCA 5B76A 5LKXA 2MA6A 1DCQA 2LGVA 4WA6A 2QICA 1WESA 2FD4A 4ZQLA 2VPEA 4GB0A 3MHHA 2FFWA 4IC2A 5H1VA 5K3QA 3O70A 2F6NA 4GNEA 4FO9A 4GNDA 3LQHA 2OXQC 2YYRA 4YBTA 3N9LA 1JM7A 4WZ3B 5SVIB 2JUNA 2M3HA 2JMJA 2DSMA 2MA5A 2YUCA 2L75A 3T7LA 3HTKC 4YBMA 2VPDA 4LLBA 1X4JA 2MD7B 4S3OB 5I3LA 4Z0RA 2VP7A 2DX8A 4QQ4A 3V43A 2CRWA 4GNFA 2LGGA 2RI7A 4X3GA 3SOUA 5KH3A 2L80A 2D8SA 4R7EA 4IC3A 3IHPA 2MKEA 3SOXA 3QZVA 1BORA 5DINA 4WZ0A 3U5PA 1T1HA 2LGKA 3ASLA 2EXUA 2FUUA 2KWKA 5LKTA 2KE1A 3O7AA 1JM7B 2YVRA 5C11A 3M62A 2Y1MA 4F52B 4S3OC 3DPLR 4I7CA 3JUEA 4YATA 2G43A 4AUQB 4P5OB 3FEHA 2XEUA 2YHOA 1U6GB 4OGEA 2VJFB 5FB0A 4L58A 2YURA 2M6MA 4OGCA 2VPGA 3KV5A 2FSAA 4TKPB 4QF3A 2AN6A 2KGIA 4A0CD 4UP0A 2LXHC 3FJUB 3HCTA 2PNXA 2K4DA 3KV6A 1Z2QA 2K16A 3O34A 3C5KA 3N9MA 4BBQA 2M13A 5TDRA 3FL2A 4Q6FA 5FEYA 5H9MA 4LKAA
chains in the Genus database with same CATH topology
5SVIA 2KKYA 4H9DA 2JM3A 3LJUX 3LVRE 2CSVA 3FJUB 3FM8C 3M7KA 3SUBA 3JUEA 4F1PA 5SVXA 3DWDA 3DDTA 2B0OE 2LAUA 2XOYA 2IQJA 4O62A 2DJAA 2KKXA 2MKEA 2XOCA 2OWAA 5SVIB 3FEHA 3T9KA 2JUNA 3LDYA 3E2DA 2XP0A 3MDBC 3Q1DA 2YREA 2M13A 4OGEA 1DCQA 5SVYA 3LVQE 2RR4A 3KDEC 2EGMA 4OGCA 2CONA 2CRRA 2EXUA 2D8UA 2E61A 2FD4A 2L7PA 2P57A 3H7HA 3PLWA 2XOZA 2FFWA 3O47A 2YVRA 4Z0RA 4QQ4A 5K3QA 4Z0OA 2CRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVI A;  2E61 A;  2L7P A;  4O62 A;  5SVY A;  4Z0R A;  2RR4 A;  4QQ4 A;  5SVI B;  4Z0O A;  5SVX A; 
#chains in the Genus database with same CATH topology
 5LKU A;  2CSV A;  4GNG A;  2RSD A;  1Z60 A;  2LAU A;  4I7B A;  2LXP C;  3E2D A;  2JRJ A;  5G04 B;  2LQ6 A;  2YRE A;  2MT5 A;  3U5O A;  5FB1 A;  2RR4 A;  3C6W A;  2XB1 A;  2CSY A;  4YAD A;  2E6S A;  3LVR E;  3O33 A;  4NN2 A;  2G6Q A;  5FER A;  3DQV R;  3MHS A;  2M1R A;  2VJE A;  4UI9 B;  4AVX A;  2XP0 A;  2PUY A;  2KWO A;  1IYM A;  1WIL A;  3ZVZ B;  2CON A;  2MNY A;  3O35 A;  1MM3 A;  1ZBD B;  2QJ0 A;  1HYJ A;  2VNF A;  2ECV A;  2MIQ A;  4BHW A;  5KH9 A;  2BAY A;  1VFY A;  2VJF A;  5SVX A;  2HDP A;  2I50 A;  3DWD A;  3DDT A;  2L43 A;  2XOY A;  1E4U A;  2ECW A;  1WIM A;  2MNZ A;  2MD8 C;  3Q1D A;  3ZPV 1;  2K1J A;  4V3L C;  5H1U A;  2CKL B;  3PHD A;  1WEO A;  4MSX A;  1LDJ B;  5C13 A;  2VJE B;  2E6R A;  3RTR B;  1WEE A;  3LJU X;  3EB5 A;  4V3K C;  1WEQ A;  1K2F A;  5D1K B;  4UP5 A;  5LCW B;  3I2D A;  2KWN A;  5D1L B;  1WEM A;  4FJC A;  5B79 A;  2YQM A;  2YSJ A;  2K17 A;  4ZDT A;  2KFT A;  2CRR A;  1HYI A;  4O64 A;  5JG6 A;  2LN0 A;  3LRQ A;  1JOC A;  1WEW A;  4A4B A;  1FBV A;  2YHN A;  5TRB A;  3NG2 A;  4C9Z A;  4B86 C;  3HCU A;  4LK9 A;  2P57 A;  1X4I A;  1V87 A;  4YC9 A;  2XOZ A;  5G05 B;  2QIZ A;  3GV4 A;  3GL6 A;  5B77 A;  2F42 A;  2ECN A;  1XWH A;  2OWA A;  2LGL A;  3LQI A;  3T9K A;  1MBM A;  2M85 A;  4I7D A;  5KH7 A;  3T6R A;  5TDW A;  2YQL A;  5B75 A;  1VD4 A;  2KR4 A;  4Z0O A;  2KKY A;  2CSZ A;  3EB6 A;  1F62 A;  2FUI A;  3M99 A;  3ZYQ A;  4A4C A;  2IDA A;  2CT2 A;  3PUR A;  2KIZ A;  3SUB A;  4PPE A;  3ZNI A;  2H0D A;  2L0B A;  1X4U A;  3HCS A;  5B8D A;  4QF2 A;  5EYA F;  3SOW A;  2CKL A;  1N87 A;  2UZG A;  3FAN A;  2KYU A;  5DKA A;  1WFK A;  2EGM A;  2L5U A;  3LQJ A;  1VYX A;  2Y1N A;  3O47 A;  4AYC B;  3N9O A;  2YT5 A;  2F6J A;  3ZPV E;  2LV9 A;  4YAX A;  4YAB A;  1WEN A;  5TBN A;  4F1P A;  4YBS A;  3L11 A;  2IQJ A;  4O62 A;  2ECI A;  4A49 A;  2LRI C;  3FAO A;  3MDB C;  3ZTG A;  4PTB A;  5SVY A;  1CHC A;  2H0D B;  2KU3 A;  5G0F A;  2JMD A;  3U5M A;  4WZ2 A;  4H9D A;  2JMI A;  5D1M B;  4AP4 A;  5H1T A;  1MM2 A;  1WEV A;  2B0O E;  2KKX A;  2KGG A;  5J3X A;  3N9Q A;  3LVQ E;  3KDE C;  4L7X A;  4R2Y A;  5B78 A;  4CA1 A;  2L7P A;  3H7H A;  2ECT A;  2KRE A;  1WEP A;  2YW8 A;  2EA6 A;  3M63 A;  2VPB A;  5TAB A;  3L1Z B;  3KQI A;  5LKZ A;  5AIT A;  5AIU A;  2DJA A;  1WGM A;  4N4F A;  2C2V S;  4N3W A;  4XI1 A;  3ZVY A;  3N9N A;  4LAD B;  3N9P A;  3U5N A;  2D8U A;  2E61 A;  2EOD A;  2LDR A;  4W4U A;  1WE9 A;  2YSM A;  3RPG B;  4MVT A;  2YU4 A;  2JM3 A;  1RMD A;  2ECG A;  4R8P K;  3L1X A;  2ECJ A;  3VK6 A;  4AYC A;  1G25 A;  1WEU A;  3SHB A;  2EGP A;  2KWJ A;  3PUQ A;  4FIP A;  4B7Y C;  1Z6U A;  4ZUX U;  2ZET C;  1FP0 A;  4LJN A;  3PLW A;  2Y43 A;  3O36 A;  2HYE D;  3LDY A;  3KNV A;  2MUM A;  5SVI A;  2C2L A;  3FM8 C;  2NAA A;  4FK5 A;  3M7K A;  4CCG X;  2G45 A;  3RPG C;  1DVP A;  1LDK C;  3O37 A;  2XOC A;  5B76 A;  5LKX A;  2MA6 A;  1DCQ A;  2LGV A;  4WA6 A;  2QIC A;  1WES A;  2FD4 A;  4ZQL A;  2VPE A;  4GB0 A;  3MHH A;  2FFW A;  4IC2 A;  5H1V A;  5K3Q A;  3O70 A;  2F6N A;  4GNE A;  4FO9 A;  4GND A;  3LQH A;  2OXQ C;  2YYR A;  4YBT A;  3N9L A;  1JM7 A;  4WZ3 B;  5SVI B;  2JUN A;  2M3H A;  2JMJ A;  2DSM A;  2MA5 A;  2YUC A;  2L75 A;  3T7L A;  3HTK C;  4YBM A;  2VPD A;  4LLB A;  1X4J A;  2MD7 B;  4S3O B;  5I3L A;  4Z0R A;  2VP7 A;  2DX8 A;  4QQ4 A;  3V43 A;  2CRW A;  4GNF A;  2LGG A;  2RI7 A;  4X3G A;  3SOU A;  5KH3 A;  2L80 A;  2D8S A;  4R7E A;  4IC3 A;  3IHP A;  2MKE A;  3SOX A;  3QZV A;  1BOR A;  5DIN A;  4WZ0 A;  3U5P A;  1T1H A;  2LGK A;  3ASL A;  2EXU A;  2FUU A;  2KWK A;  5LKT A;  2KE1 A;  3O7A A;  1JM7 B;  2YVR A;  5C11 A;  3M62 A;  2Y1M A;  4F52 B;  4S3O C;  3DPL R;  4I7C A;  3JUE A;  4YAT A;  2G43 A;  4AUQ B;  4P5O B;  3FEH A;  2XEU A;  2YHO A;  1U6G B;  4OGE A;  2VJF B;  5FB0 A;  4L58 A;  2YUR A;  2M6M A;  4OGC A;  2VPG A;  3KV5 A;  2FSA A;  4TKP B;  4QF3 A;  2AN6 A;  2KGI A;  4A0C D;  4UP0 A;  2LXH C;  3FJU B;  3HCT A;  2PNX A;  2K4D A;  3KV6 A;  1Z2Q A;  2K16 A;  3O34 A;  3C5K A;  3N9M A;  4BBQ A;  2M13 A;  5TDR A;  3FL2 A;  4Q6F A;  5FEY A;  5H9M A;  4LKA A; 
#chains in the Genus database with same CATH homology
 5SVI A;  2KKY A;  4H9D A;  2JM3 A;  3LJU X;  3LVR E;  2CSV A;  3FJU B;  3FM8 C;  3M7K A;  3SUB A;  3JUE A;  4F1P A;  5SVX A;  3DWD A;  3DDT A;  2B0O E;  2LAU A;  2XOY A;  2IQJ A;  4O62 A;  2DJA A;  2KKX A;  2MKE A;  2XOC A;  2OWA A;  5SVI B;  3FEH A;  3T9K A;  2JUN A;  3LDY A;  3E2D A;  2XP0 A;  3MDB C;  3Q1D A;  2YRE A;  2M13 A;  4OGE A;  1DCQ A;  5SVY A;  3LVQ E;  2RR4 A;  3KDE C;  2EGM A;  4OGC A;  2CON A;  2CRR A;  2EXU A;  2D8U A;  2E61 A;  2FD4 A;  2L7P A;  2P57 A;  3H7H A;  3PLW A;  2XOZ A;  2FFW A;  3O47 A;  2YVR A;  4Z0R A;  4QQ4 A;  5K3Q A;  4Z0O A;  2CRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...