5SVIB

Morc3 cw domain in complex with unmodified histone h3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
GPLGSDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5sviB00
4Z0OA 5SVXA 2E61A 2RR4A 4Z0RA 5SVIA 4O62A 2L7PA 5SVIB 5SVYA 4QQ4A
chains in the Genus database with same CATH superfamily
3SHBA 2B0OE 5TDRA 4BHWA 3EB5A 3U5MA 1G25A 3LQJA 2CONA 4FJCA 3LDYA 2IQJA 2MNZA 3C6WA 4TKPB 1Z6UA 3N9LA 4A0CD 2OXQC 5B76A 5G0FA 2UZGA 2YREA 1WILA 3M62A 3L1XA 4O62A 2ECJA 4LK9A 2L5UA 4XI1A 2RR4A 5LCWB 2VPDA 3HCSA 4YC9A 4AYCA 4I7BA 4UP0A 5C11A 1BORA 3ZYQA 3SUBA 5B8DA 2KKXA 3DPLR 2KWKA 2LGKA 2MKEA 3LJUX 1FBVA 3M99A 4L7XA 2L75A 3FAOA 4AYCB 2PUYA 2LN0A 3LQHA 5FEYA 5H1UA 4O64A 4R8PK 4CA1A 2C2VS 2PNXA 3V43A 4N3WA 5I3LA 2LXPC 1HYIA 1WEMA 2F42A 1MM3A 2YHOA 4Z0RA 4P5OB 2DSMA 4PTBA 1V87A 1VYXA 3ZVZB 4F1PA 3KV6A 4C9ZA 5FERA 2FUUA 3KV5A 4V3KC 2VNFA 3KQIA 3O33A 3N9PA 1VD4A 2D8UA 4QF2A 4A4CA 3T6RA 2CRWA 2LAUA 1WEWA 4X3GA 2KWNA 2M13A 1T1HA 2ZETC 2E61A 4W4UA 4S3OC 2YT5A 2F6JA 4ZUXU 1WE9A 2I50A 2MT5A 2EXUA 2K1JA 4OGCA 2K17A 4YABA 1MM2A 2BAYA 1X4UA 5K3QA 2QJ0A 1FP0A 5B75A 4GNGA 2M3HA 2K4DA 3I2DA 2KFTA 3FL2A 3MHSA 5SVIA 1WFKA 2E6RA 5EYAF 2L7PA 2YHNA 2CSZA 2E6SA 2YQMA 5SVIB 3HTKC 2LDRA 2ECWA 4YADA 3SOXA 1WEEA 5H1VA 2KIZA 4FIPA 3VK6A 2QICA 2EGPA 3C5KA 1LDKC 4FO9A 2Y43A 2Y1MA 3PHDA 5AIUA 3SOWA 2M1RA 1F62A 4QQ4A 2LV9A 4WZ0A 3DDTA 4B86C 4LKAA 2HYED 2LQ6A 3HCTA 3O35A 5D1LB 4MSXA 2H0DA 1K2FA 2LGVA 5SVYA 3O70A 4I7DA 2M6MA 5KH7A 3FEHA 1DVPA 3NG2A 4L58A 4WA6A 2JMIA 2YSJA 4Z0OA 2KU3A 1IYMA 2YYRA 2H0DB 3E2DA 5B79A 2ECTA 5LKZA 3GV4A 1U6GB 3T9KA 2MIQA 4V3LC 3LVQE 2JMDA 2MNYA 1JM7A 4QF3A 2RSDA 1JOCA 2CKLA 5H1TA 2RI7A 2FFWA 5LKTA 1DCQA 1RMDA 5SVXA 1JM7B 5FB1A 3U5OA 2KGGA 2C2LA 2MUMA 3LQIA 2VPBA 2CKLB 2L43A 2KKYA 2CT2A 3N9NA 5B77A 2DX8A 5G05B 2ECIA 3KNVA 5AITA 2CRRA 3KDEC 5LKXA 1LDJB 3PLWA 1Z60A 5LKUA 3ZVYA 3RTRB 3N9OA 4UP5A 3T7LA 5TDWA 4BBQA 3O34A 3ZPV1 2FUIA 3RPGB 2G6QA 2YVRA 4YAXA 1WEUA 3PUQA 3JUEA 4AP4A 3PURA 2YQLA 2LGLA 4GNDA 4N4FA 2JMJA 4Q6FA 3ZTGA 4NN2A 5TBNA 4FK5A 5DKAA 3MDBC 3N9MA 2EODA 5B78A 3ZNIA 4OGEA 4B7YC 1X4JA 2XOCA 2XP0A 3O47A 4YBMA 2D8SA 3GL6A 2MD7B 2ECVA 2YURA 1E4UA 3O36A 4ZDTA 1WEVA 5G04B 4MVTA 4R2YA 5DINA 1N87A 5D1MB 1X4IA 4PPEA 2YUCA 2KREA 4AVXA 1XWHA 4YBSA 2EGMA 1CHCA 2XEUA 3FM8C 1WGMA 3LVRE 3EB6A 1Z2QA 2KYUA 2VJEA 4WZ3B 3Q1DA 2VP7A 1HYJA 5C13A 3HCUA 2XB1A 4A49A 2G43A 2MD8C 1ZBDB 2LRIC 5J3XA 2FD4A 4LJNA 5KH3A 3DWDA 2FSAA 1WEQA 2VJEB 2Y1NA 2F6NA 2KE1A 3ASLA 2VPGA 4LLBA 2VJFA 1WEPA 3ZPVE 4R7EA 4AUQB 3U5NA 2MA6A 3M63A 2AN6A 4A4BA 5JG6A 4IC2A 1WEOA 3FANA 3LRQA 3O37A 4S3OB 3H7HA 2YSMA 1VFYA 2QIZA 2VJFB 3L1ZB 3DQVR 1WESA 4H9DA 2ECNA 2ECGA 3MHHA 3SOUA 4ZQLA 2L80A 2LGGA 4IC3A 5TABA 2M85A 5FB0A 2XOYA 2P57A 4LADB 4GNFA 3U5PA 3O7AA 2LXHC 2K16A 4GNEA 3M7KA 2L0BA 4YBTA 2KWOA 2HDPA 2MA5A 2YW8A 4WZ2A 2JM3A 4I7CA 3QZVA 4UI9B 2CSVA 4CCGX 2XOZA 2KWJA 4GB0A 2EA6A 5D1KB 5TRBA 2NAAA 1WIMA 2G45A 5H9MA 1WENA 2JUNA 2VPEA 4F52B 2KGIA 2KR4A 3N9QA 3IHPA 2CSYA 2JRJA 3L11A 3FJUB 2IDAA 1MBMA 4YATA 2DJAA 5KH9A 2YU4A 2OWAA 3RPGC
chains in the Genus database with same CATH topology
4OGCA 2B0OE 4Z0OA 3DDTA 3H7HA 2D8UA 2CRRA 3MDBC 5K3QA 2FFWA 3PLWA 3E2DA 3KDEC 2FD4A 5SVIB 2JUNA 1DCQA 3M7KA 3DWDA 2CRWA 3SUBA 4H9DA 2LAUA 5SVXA 2KKXA 2CONA 3T9KA 3LDYA 2IQJA 4Z0RA 4OGEA 2EGMA 2JM3A 2MKEA 2XOCA 3LJUX 2YVRA 3LVQE 2XP0A 2M13A 3O47A 3FM8C 2E61A 3JUEA 2KKYA 2YREA 5SVIA 3LVRE 4O62A 2CSVA 5SVYA 2XOYA 3FJUB 4F1PA 2XOZA 2P57A 3Q1DA 3FEHA 2RR4A 2DJAA 2EXUA 2L7PA 4QQ4A 2OWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0O A;  5SVX A;  2E61 A;  2RR4 A;  4Z0R A;  5SVI A;  4O62 A;  2L7P A;  5SVI B;  5SVY A;  4QQ4 A; 
#chains in the Genus database with same CATH topology
 3SHB A;  2B0O E;  5TDR A;  4BHW A;  3EB5 A;  3U5M A;  1G25 A;  3LQJ A;  2CON A;  4FJC A;  3LDY A;  2IQJ A;  2MNZ A;  3C6W A;  4TKP B;  1Z6U A;  3N9L A;  4A0C D;  2OXQ C;  5B76 A;  5G0F A;  2UZG A;  2YRE A;  1WIL A;  3M62 A;  3L1X A;  4O62 A;  2ECJ A;  4LK9 A;  2L5U A;  4XI1 A;  2RR4 A;  5LCW B;  2VPD A;  3HCS A;  4YC9 A;  4AYC A;  4I7B A;  4UP0 A;  5C11 A;  1BOR A;  3ZYQ A;  3SUB A;  5B8D A;  2KKX A;  3DPL R;  2KWK A;  2LGK A;  2MKE A;  3LJU X;  1FBV A;  3M99 A;  4L7X A;  2L75 A;  3FAO A;  4AYC B;  2PUY A;  2LN0 A;  3LQH A;  5FEY A;  5H1U A;  4O64 A;  4R8P K;  4CA1 A;  2C2V S;  2PNX A;  3V43 A;  4N3W A;  5I3L A;  2LXP C;  1HYI A;  1WEM A;  2F42 A;  1MM3 A;  2YHO A;  4Z0R A;  4P5O B;  2DSM A;  4PTB A;  1V87 A;  1VYX A;  3ZVZ B;  4F1P A;  3KV6 A;  4C9Z A;  5FER A;  2FUU A;  3KV5 A;  4V3K C;  2VNF A;  3KQI A;  3O33 A;  3N9P A;  1VD4 A;  2D8U A;  4QF2 A;  4A4C A;  3T6R A;  2CRW A;  2LAU A;  1WEW A;  4X3G A;  2KWN A;  2M13 A;  1T1H A;  2ZET C;  2E61 A;  4W4U A;  4S3O C;  2YT5 A;  2F6J A;  4ZUX U;  1WE9 A;  2I50 A;  2MT5 A;  2EXU A;  2K1J A;  4OGC A;  2K17 A;  4YAB A;  1MM2 A;  2BAY A;  1X4U A;  5K3Q A;  2QJ0 A;  1FP0 A;  5B75 A;  4GNG A;  2M3H A;  2K4D A;  3I2D A;  2KFT A;  3FL2 A;  3MHS A;  5SVI A;  1WFK A;  2E6R A;  5EYA F;  2L7P A;  2YHN A;  2CSZ A;  2E6S A;  2YQM A;  5SVI B;  3HTK C;  2LDR A;  2ECW A;  4YAD A;  3SOX A;  1WEE A;  5H1V A;  2KIZ A;  4FIP A;  3VK6 A;  2QIC A;  2EGP A;  3C5K A;  1LDK C;  4FO9 A;  2Y43 A;  2Y1M A;  3PHD A;  5AIU A;  3SOW A;  2M1R A;  1F62 A;  4QQ4 A;  2LV9 A;  4WZ0 A;  3DDT A;  4B86 C;  4LKA A;  2HYE D;  2LQ6 A;  3HCT A;  3O35 A;  5D1L B;  4MSX A;  2H0D A;  1K2F A;  2LGV A;  5SVY A;  3O70 A;  4I7D A;  2M6M A;  5KH7 A;  3FEH A;  1DVP A;  3NG2 A;  4L58 A;  4WA6 A;  2JMI A;  2YSJ A;  4Z0O A;  2KU3 A;  1IYM A;  2YYR A;  2H0D B;  3E2D A;  5B79 A;  2ECT A;  5LKZ A;  3GV4 A;  1U6G B;  3T9K A;  2MIQ A;  4V3L C;  3LVQ E;  2JMD A;  2MNY A;  1JM7 A;  4QF3 A;  2RSD A;  1JOC A;  2CKL A;  5H1T A;  2RI7 A;  2FFW A;  5LKT A;  1DCQ A;  1RMD A;  5SVX A;  1JM7 B;  5FB1 A;  3U5O A;  2KGG A;  2C2L A;  2MUM A;  3LQI A;  2VPB A;  2CKL B;  2L43 A;  2KKY A;  2CT2 A;  3N9N A;  5B77 A;  2DX8 A;  5G05 B;  2ECI A;  3KNV A;  5AIT A;  2CRR A;  3KDE C;  5LKX A;  1LDJ B;  3PLW A;  1Z60 A;  5LKU A;  3ZVY A;  3RTR B;  3N9O A;  4UP5 A;  3T7L A;  5TDW A;  4BBQ A;  3O34 A;  3ZPV 1;  2FUI A;  3RPG B;  2G6Q A;  2YVR A;  4YAX A;  1WEU A;  3PUQ A;  3JUE A;  4AP4 A;  3PUR A;  2YQL A;  2LGL A;  4GND A;  4N4F A;  2JMJ A;  4Q6F A;  3ZTG A;  4NN2 A;  5TBN A;  4FK5 A;  5DKA A;  3MDB C;  3N9M A;  2EOD A;  5B78 A;  3ZNI A;  4OGE A;  4B7Y C;  1X4J A;  2XOC A;  2XP0 A;  3O47 A;  4YBM A;  2D8S A;  3GL6 A;  2MD7 B;  2ECV A;  2YUR A;  1E4U A;  3O36 A;  4ZDT A;  1WEV A;  5G04 B;  4MVT A;  4R2Y A;  5DIN A;  1N87 A;  5D1M B;  1X4I A;  4PPE A;  2YUC A;  2KRE A;  4AVX A;  1XWH A;  4YBS A;  2EGM A;  1CHC A;  2XEU A;  3FM8 C;  1WGM A;  3LVR E;  3EB6 A;  1Z2Q A;  2KYU A;  2VJE A;  4WZ3 B;  3Q1D A;  2VP7 A;  1HYJ A;  5C13 A;  3HCU A;  2XB1 A;  4A49 A;  2G43 A;  2MD8 C;  1ZBD B;  2LRI C;  5J3X A;  2FD4 A;  4LJN A;  5KH3 A;  3DWD A;  2FSA A;  1WEQ A;  2VJE B;  2Y1N A;  2F6N A;  2KE1 A;  3ASL A;  2VPG A;  4LLB A;  2VJF A;  1WEP A;  3ZPV E;  4R7E A;  4AUQ B;  3U5N A;  2MA6 A;  3M63 A;  2AN6 A;  4A4B A;  5JG6 A;  4IC2 A;  1WEO A;  3FAN A;  3LRQ A;  3O37 A;  4S3O B;  3H7H A;  2YSM A;  1VFY A;  2QIZ A;  2VJF B;  3L1Z B;  3DQV R;  1WES A;  4H9D A;  2ECN A;  2ECG A;  3MHH A;  3SOU A;  4ZQL A;  2L80 A;  2LGG A;  4IC3 A;  5TAB A;  2M85 A;  5FB0 A;  2XOY A;  2P57 A;  4LAD B;  4GNF A;  3U5P A;  3O7A A;  2LXH C;  2K16 A;  4GNE A;  3M7K A;  2L0B A;  4YBT A;  2KWO A;  2HDP A;  2MA5 A;  2YW8 A;  4WZ2 A;  2JM3 A;  4I7C A;  3QZV A;  4UI9 B;  2CSV A;  4CCG X;  2XOZ A;  2KWJ A;  4GB0 A;  2EA6 A;  5D1K B;  5TRB A;  2NAA A;  1WIM A;  2G45 A;  5H9M A;  1WEN A;  2JUN A;  2VPE A;  4F52 B;  2KGI A;  2KR4 A;  3N9Q A;  3IHP A;  2CSY A;  2JRJ A;  3L11 A;  3FJU B;  2IDA A;  1MBM A;  4YAT A;  2DJA A;  5KH9 A;  2YU4 A;  2OWA A;  3RPG C; 
#chains in the Genus database with same CATH homology
 4OGC A;  2B0O E;  4Z0O A;  3DDT A;  3H7H A;  2D8U A;  2CRR A;  3MDB C;  5K3Q A;  2FFW A;  3PLW A;  3E2D A;  3KDE C;  2FD4 A;  5SVI B;  2JUN A;  1DCQ A;  3M7K A;  3DWD A;  2CRW A;  3SUB A;  4H9D A;  2LAU A;  5SVX A;  2KKX A;  2CON A;  3T9K A;  3LDY A;  2IQJ A;  4Z0R A;  4OGE A;  2EGM A;  2JM3 A;  2MKE A;  2XOC A;  3LJU X;  2YVR A;  3LVQ E;  2XP0 A;  2M13 A;  3O47 A;  3FM8 C;  2E61 A;  3JUE A;  2KKY A;  2YRE A;  5SVI A;  3LVR E;  4O62 A;  2CSV A;  5SVY A;  2XOY A;  3FJU B;  4F1P A;  2XOZ A;  2P57 A;  3Q1D A;  3FEH A;  2RR4 A;  2DJA A;  2EXU A;  2L7P A;  4QQ4 A;  2OWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...