5SVIB

Morc3 cw domain in complex with unmodified histone h3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
GPLGSDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5sviB00
2L7PA 4Z0RA 5SVYA 5SVIB 4O62A 5SVXA 2E61A 4QQ4A 4Z0OA 5SVIA 2RR4A
chains in the Genus database with same CATH superfamily
1WEVA 4YABA 1WGMA 2ECWA 4GNEA 2C2LA 5J3XA 2KWJA 3PLWA 2K16A 4R7EA 2AN6A 3LQHA 1MBMA 4UP0A 1ZBDB 1VFYA 4Q6FA 4F52B 2K17A 5H1UA 2PNXA 5G05B 5H9MA 5KH7A 3JUEA 1VYXA 1X4UA 2MA6A 3O35A 4QF2A 4WZ2A 1WEUA 2L43A 2RSDA 4X3GA 2JM3A 3O7AA 4IC3A 2K4DA 3QZVA 2LXHC 3SHBA 3O37A 3HCTA 3FM8C 4FO9A 2XOZA 5TDRA 1WE9A 3KV6A 3ZVZB 3N9LA 2ECJA 1Z60A 3N9PA 2YYRA 3SUBA 4GNGA 4L58A 3U5MA 3KQIA 2CONA 5G0FA 5AITA 3M63A 2OXQC 5K3QA 4LLBA 2EGMA 2C2VS 2B0OE 1X4IA 5LKXA 2XP0A 3RTRB 3NG2A 4YC9A 5D1LB 4UP5A 3SOXA 3U5PA 2VJFB 2FSAA 2H0DA 3O33A 5I3LA 4YAXA 2VPBA 2YU4A 4A4BA 5TRBA 2I50A 2LGLA 1WEPA 2HYED 5LKUA 5H1VA 2FUIA 2UZGA 2H0DB 3RPGC 4WZ0A 1DVPA 2F6NA 2VJEB 1N87A 3PUQA 2VJEA 3DDTA 4TKPB 5B75A 5SVIB 4I7DA 1Z6UA 1JOCA 2DJAA 4ZUXU 2HDPA 2M85A 2FFWA 1DCQA 2XOCA 2JUNA 4BHWA 2LN0A 3KV5A 2BAYA 3N9NA 2LGGA 2FD4A 2KWKA 2MNYA 2EGPA 3L11A 2Y1NA 4WA6A 4AUQB 2XEUA 4AP4A 2Y1MA 3ZYQA 4ZDTA 4LJNA 2M1RA 5TABA 5B78A 2KKXA 4YBMA 3M62A 2D8SA 1FBVA 1LDKC 3FAOA 4W4UA 4S3OC 4S3OB 4QQ4A 4MVTA 5D1KB 3C5KA 2M13A 1WEQA 4LKAA 5JG6A 4WZ3B 2E6SA 4LADB 4F1PA 4PTBA 3IHPA 5TBNA 2LGKA 4MSXA 4LK9A 4YBTA 2E61A 4N4FA 2CKLA 1WEOA 2CKLB 3PHDA 3DQVR 5C13A 3V43A 2VPGA 3PURA 3ZNIA 2CSYA 2FUUA 1HYJA 2QJ0A 1G25A 2IDAA 2F42A 2MD8C 5FEYA 2QIZA 2YQMA 2MNZA 3H7HA 2LQ6A 4NN2A 4OGEA 2YUCA 3MHSA 4B86C 1U6GB 5C11A 3I2DA 2CT2A 2ECTA 4FK5A 1WILA 2JMDA 2KFTA 2YVRA 2KR4A 4N3WA 3LQJA 4A0CD 2VPEA 2VP7A 3FEHA 4IC2A 2DSMA 2L5UA 5AIUA 2MT5A 3ZPV1 2VNFA 3EB5A 1T1HA 1WEWA 1WESA 2RI7A 2M6MA 4YADA 4FJCA 2KU3A 1FP0A 4O64A 2ECGA 1K2FA 5LKTA 3DPLR 2LDRA 5KH9A 3ZTGA 3O36A 3T7LA 3O70A 4V3LC 2VPDA 1X4JA 1WFKA 5SVXA 1WEMA 2YSMA 1XWHA 3GL6A 4Z0RA 3FANA 1IYMA 2LGVA 2OWAA 2ZETC 2JMIA 3VK6A 2KGGA 2LXPC 4V3KC 1LDJB 2YW8A 5DKAA 5FB0A 2KWNA 3ASLA 4I7CA 3FJUB 4AYCB 4QF3A 2KYUA 2NAAA 4GNFA 4O62A 4CCGX 2YURA 3N9QA 5EYAF 3L1ZB 4I7BA 4R2YA 2YQLA 4ZQLA 2MIQA 4P5OB 4Z0OA 4A49A 2JMJA 2XB1A 1E4UA 3LRQA 2D8UA 1V87A 2KWOA 5B76A 4UI9B 4PPEA 5LCWB 5H1TA 2CRWA 3GV4A 4C9ZA 5FB1A 3DWDA 4BBQA 2L80A 2MA5A 2MUMA 2CSZA 5B79A 4R8PK 1WIMA 2PUYA 2KREA 4YATA 2ECNA 5B77A 2MD7B 4AVXA 3Q1DA 3LVQE 3L1XA 2L75A 4XI1A 1Z2QA 5DINA 2M3HA 1VD4A 2CRRA 3O47A 2LRIC 1MM2A 3HTKC 5LKZA 3T9KA 4GNDA 2CSVA 3N9MA 2L7PA 2VJFA 2MKEA 1JM7B 2KE1A 2G43A 2ECVA 2YSJA 3LJUX 3T6RA 2EXUA 3N9OA 4YBSA 2KGIA 3HCSA 4A4CA 2LAUA 4FIPA 2Y43A 2G45A 2KKYA 2XOYA 2YHNA 3LDYA 5KH3A 2LV9A 5FERA 3LVRE 3MDBC 3SOWA 3M7KA 1WENA 3KNVA 2KIZA 3RPGB 1CHCA 2YT5A 4H9DA 3O34A 2P57A 4CA1A 1HYIA 3LQIA 3U5NA 3U5OA 2K1JA 2L0BA 3HCUA 2JRJA 5SVYA 1WEEA 3ZVYA 2YREA 3FL2A 5TDWA 5D1MB 2EA6A 3MHHA 3C6WA 3M99A 1F62A 1MM3A 5G04B 2EODA 2DX8A 1JM7A 4OGCA 4L7XA 3SOUA 2ECIA 5B8DA 5SVIA 4B7YC 2QICA 3KDEC 2YHOA 4AYCA 2G6QA 1RMDA 1BORA 3EB6A 2E6RA 3E2DA 3ZPVE 2IQJA 2F6JA 2RR4A 4GB0A
chains in the Genus database with same CATH topology
3FM8C 2D8UA 2XP0A 3LVQE 2FD4A 3Q1DA 2XOZA 3FJUB 4OGCA 3DDTA 2LAUA 4F1PA 2CRRA 3O47A 3SUBA 5SVIB 5SVYA 4O62A 5SVXA 2KKYA 3H7HA 2CRWA 2XOYA 3LDYA 4OGEA 2JM3A 5SVIA 3T9KA 2DJAA 2CSVA 2KKXA 3LVRE 3PLWA 3KDEC 2CONA 3MDBC 2L7PA 2FFWA 4Z0RA 3DWDA 1DCQA 2E61A 2XOCA 2YVRA 3M7KA 2MKEA 2OWAA 2JUNA 2YREA 3E2DA 3LJUX 5K3QA 3FEHA 2EXUA 2EGMA 2IQJA 4QQ4A 2B0OE 3JUEA 4Z0OA 4H9DA 2RR4A 2P57A 2M13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7P A;  4Z0R A;  5SVY A;  5SVI B;  4O62 A;  5SVX A;  2E61 A;  4QQ4 A;  4Z0O A;  5SVI A;  2RR4 A; 
#chains in the Genus database with same CATH topology
 1WEV A;  4YAB A;  1WGM A;  2ECW A;  4GNE A;  2C2L A;  5J3X A;  2KWJ A;  3PLW A;  2K16 A;  4R7E A;  2AN6 A;  3LQH A;  1MBM A;  4UP0 A;  1ZBD B;  1VFY A;  4Q6F A;  4F52 B;  2K17 A;  5H1U A;  2PNX A;  5G05 B;  5H9M A;  5KH7 A;  3JUE A;  1VYX A;  1X4U A;  2MA6 A;  3O35 A;  4QF2 A;  4WZ2 A;  1WEU A;  2L43 A;  2RSD A;  4X3G A;  2JM3 A;  3O7A A;  4IC3 A;  2K4D A;  3QZV A;  2LXH C;  3SHB A;  3O37 A;  3HCT A;  3FM8 C;  4FO9 A;  2XOZ A;  5TDR A;  1WE9 A;  3KV6 A;  3ZVZ B;  3N9L A;  2ECJ A;  1Z60 A;  3N9P A;  2YYR A;  3SUB A;  4GNG A;  4L58 A;  3U5M A;  3KQI A;  2CON A;  5G0F A;  5AIT A;  3M63 A;  2OXQ C;  5K3Q A;  4LLB A;  2EGM A;  2C2V S;  2B0O E;  1X4I A;  5LKX A;  2XP0 A;  3RTR B;  3NG2 A;  4YC9 A;  5D1L B;  4UP5 A;  3SOX A;  3U5P A;  2VJF B;  2FSA A;  2H0D A;  3O33 A;  5I3L A;  4YAX A;  2VPB A;  2YU4 A;  4A4B A;  5TRB A;  2I50 A;  2LGL A;  1WEP A;  2HYE D;  5LKU A;  5H1V A;  2FUI A;  2UZG A;  2H0D B;  3RPG C;  4WZ0 A;  1DVP A;  2F6N A;  2VJE B;  1N87 A;  3PUQ A;  2VJE A;  3DDT A;  4TKP B;  5B75 A;  5SVI B;  4I7D A;  1Z6U A;  1JOC A;  2DJA A;  4ZUX U;  2HDP A;  2M85 A;  2FFW A;  1DCQ A;  2XOC A;  2JUN A;  4BHW A;  2LN0 A;  3KV5 A;  2BAY A;  3N9N A;  2LGG A;  2FD4 A;  2KWK A;  2MNY A;  2EGP A;  3L11 A;  2Y1N A;  4WA6 A;  4AUQ B;  2XEU A;  4AP4 A;  2Y1M A;  3ZYQ A;  4ZDT A;  4LJN A;  2M1R A;  5TAB A;  5B78 A;  2KKX A;  4YBM A;  3M62 A;  2D8S A;  1FBV A;  1LDK C;  3FAO A;  4W4U A;  4S3O C;  4S3O B;  4QQ4 A;  4MVT A;  5D1K B;  3C5K A;  2M13 A;  1WEQ A;  4LKA A;  5JG6 A;  4WZ3 B;  2E6S A;  4LAD B;  4F1P A;  4PTB A;  3IHP A;  5TBN A;  2LGK A;  4MSX A;  4LK9 A;  4YBT A;  2E61 A;  4N4F A;  2CKL A;  1WEO A;  2CKL B;  3PHD A;  3DQV R;  5C13 A;  3V43 A;  2VPG A;  3PUR A;  3ZNI A;  2CSY A;  2FUU A;  1HYJ A;  2QJ0 A;  1G25 A;  2IDA A;  2F42 A;  2MD8 C;  5FEY A;  2QIZ A;  2YQM A;  2MNZ A;  3H7H A;  2LQ6 A;  4NN2 A;  4OGE A;  2YUC A;  3MHS A;  4B86 C;  1U6G B;  5C11 A;  3I2D A;  2CT2 A;  2ECT A;  4FK5 A;  1WIL A;  2JMD A;  2KFT A;  2YVR A;  2KR4 A;  4N3W A;  3LQJ A;  4A0C D;  2VPE A;  2VP7 A;  3FEH A;  4IC2 A;  2DSM A;  2L5U A;  5AIU A;  2MT5 A;  3ZPV 1;  2VNF A;  3EB5 A;  1T1H A;  1WEW A;  1WES A;  2RI7 A;  2M6M A;  4YAD A;  4FJC A;  2KU3 A;  1FP0 A;  4O64 A;  2ECG A;  1K2F A;  5LKT A;  3DPL R;  2LDR A;  5KH9 A;  3ZTG A;  3O36 A;  3T7L A;  3O70 A;  4V3L C;  2VPD A;  1X4J A;  1WFK A;  5SVX A;  1WEM A;  2YSM A;  1XWH A;  3GL6 A;  4Z0R A;  3FAN A;  1IYM A;  2LGV A;  2OWA A;  2ZET C;  2JMI A;  3VK6 A;  2KGG A;  2LXP C;  4V3K C;  1LDJ B;  2YW8 A;  5DKA A;  5FB0 A;  2KWN A;  3ASL A;  4I7C A;  3FJU B;  4AYC B;  4QF3 A;  2KYU A;  2NAA A;  4GNF A;  4O62 A;  4CCG X;  2YUR A;  3N9Q A;  5EYA F;  3L1Z B;  4I7B A;  4R2Y A;  2YQL A;  4ZQL A;  2MIQ A;  4P5O B;  4Z0O A;  4A49 A;  2JMJ A;  2XB1 A;  1E4U A;  3LRQ A;  2D8U A;  1V87 A;  2KWO A;  5B76 A;  4UI9 B;  4PPE A;  5LCW B;  5H1T A;  2CRW A;  3GV4 A;  4C9Z A;  5FB1 A;  3DWD A;  4BBQ A;  2L80 A;  2MA5 A;  2MUM A;  2CSZ A;  5B79 A;  4R8P K;  1WIM A;  2PUY A;  2KRE A;  4YAT A;  2ECN A;  5B77 A;  2MD7 B;  4AVX A;  3Q1D A;  3LVQ E;  3L1X A;  2L75 A;  4XI1 A;  1Z2Q A;  5DIN A;  2M3H A;  1VD4 A;  2CRR A;  3O47 A;  2LRI C;  1MM2 A;  3HTK C;  5LKZ A;  3T9K A;  4GND A;  2CSV A;  3N9M A;  2L7P A;  2VJF A;  2MKE A;  1JM7 B;  2KE1 A;  2G43 A;  2ECV A;  2YSJ A;  3LJU X;  3T6R A;  2EXU A;  3N9O A;  4YBS A;  2KGI A;  3HCS A;  4A4C A;  2LAU A;  4FIP A;  2Y43 A;  2G45 A;  2KKY A;  2XOY A;  2YHN A;  3LDY A;  5KH3 A;  2LV9 A;  5FER A;  3LVR E;  3MDB C;  3SOW A;  3M7K A;  1WEN A;  3KNV A;  2KIZ A;  3RPG B;  1CHC A;  2YT5 A;  4H9D A;  3O34 A;  2P57 A;  4CA1 A;  1HYI A;  3LQI A;  3U5N A;  3U5O A;  2K1J A;  2L0B A;  3HCU A;  2JRJ A;  5SVY A;  1WEE A;  3ZVY A;  2YRE A;  3FL2 A;  5TDW A;  5D1M B;  2EA6 A;  3MHH A;  3C6W A;  3M99 A;  1F62 A;  1MM3 A;  5G04 B;  2EOD A;  2DX8 A;  1JM7 A;  4OGC A;  4L7X A;  3SOU A;  2ECI A;  5B8D A;  5SVI A;  4B7Y C;  2QIC A;  3KDE C;  2YHO A;  4AYC A;  2G6Q A;  1RMD A;  1BOR A;  3EB6 A;  2E6R A;  3E2D A;  3ZPV E;  2IQJ A;  2F6J A;  2RR4 A;  4GB0 A; 
#chains in the Genus database with same CATH homology
 3FM8 C;  2D8U A;  2XP0 A;  3LVQ E;  2FD4 A;  3Q1D A;  2XOZ A;  3FJU B;  4OGC A;  3DDT A;  2LAU A;  4F1P A;  2CRR A;  3O47 A;  3SUB A;  5SVI B;  5SVY A;  4O62 A;  5SVX A;  2KKY A;  3H7H A;  2CRW A;  2XOY A;  3LDY A;  4OGE A;  2JM3 A;  5SVI A;  3T9K A;  2DJA A;  2CSV A;  2KKX A;  3LVR E;  3PLW A;  3KDE C;  2CON A;  3MDB C;  2L7P A;  2FFW A;  4Z0R A;  3DWD A;  1DCQ A;  2E61 A;  2XOC A;  2YVR A;  3M7K A;  2MKE A;  2OWA A;  2JUN A;  2YRE A;  3E2D A;  3LJU X;  5K3Q A;  3FEH A;  2EXU A;  2EGM A;  2IQJ A;  4QQ4 A;  2B0O E;  3JUE A;  4Z0O A;  4H9D A;  2RR4 A;  2P57 A;  2M13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...