5SVIB

Morc3 cw domain in complex with unmodified histone h3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
b'GPLGSDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5sviB00
4O62A 2E61A 2RR4A 5SVIB 4Z0OA 4QQ4A 4Z0RA 5SVXA 5SVYA 2L7PA 5SVIA
chains in the Genus database with same CATH superfamily
3EB5A 1N87A 3LRQA 2MUMA 1FP0A 4YBSA 4UP0A 4ZUXU 2YW8A 4AUQB 2CONA 1Z2QA 1WEEA 2VJEA 5B76A 4S3OC 3EB6A 2L5UA 2ECIA 2D8UA 2JMJA 2YT5A 2Y43A 5JG6A 4WA6A 4YAXA 3U5MA 4FJCA 4I7BA 1G25A 5KH3A 5TDWA 3L11A 3U5OA 2VPGA 1FBVA 2IDAA 2LGKA 2F6JA 1MM3A 2M3HA 5FB0A 3ZYQA 3DQVR 2KYUA 5AITA 3SOXA 4QQ4A 3T7LA 3KQIA 2FUIA 4YC9A 5B8DA 4YBMA 2KWKA 3MHHA 3LQHA 2RR4A 3ASLA 2E6RA 4LK9A 2EGMA 5D1KB 4W4UA 3ZPVE 2LQ6A 3U5NA 3GV4A 1CHCA 4UP5A 2EGPA 2D8SA 2JRJA 3KV6A 2CSYA 3ZNIA 3O47A 1WIMA 2E6SA 5SVYA 5TABA 2RI7A 1WEOA 4YATA 4CA1A 3RPGC 3MDBC 1WENA 3NG2A 2PUYA 3H7HA 3FEHA 3SHBA 3DPLR 5KH7A 2M1RA 1WE9A 4I7CA 1U6GB 5TBNA 4ZDTA 3KDEC 3PUQA 2FUUA 4YADA 2KE1A 2LGGA 4N4FA 2BAYA 2KREA 2FFWA 1X4IA 4F52B 1HYJA 3SOUA 4V3LC 4QF3A 2YUCA 5LKUA 4A0CD 2YSJA 1WGMA 2LGLA 3O35A 5B79A 2MNYA 2LDRA 3N9LA 5FERA 2MKEA 2ECJA 2K4DA 1X4JA 2VPDA 3LVRE 4BHWA 2FD4A 3GL6A 2MIQA 4GNFA 4LLBA 2JMIA 3MHSA 3T6RA 5AIUA 3FL2A 2YURA 4QF2A 3DDTA 5FB1A 1WEUA 2DX8A 5DINA 1DVPA 2L43A 2CRRA 2CRWA 2MNZA 4TKPB 4IC2A 3LDYA 4A4CA 3DWDA 2KWNA 2YYRA 3HTKC 3T9KA 1WEVA 3N9OA 2KGGA 2I50A 5LKTA 5SVIB 4LADB 3LQIA 4A4BA 2CSVA 2YQMA 2L75A 4B86C 2LXHC 3O37A 2ECNA 1WEWA 5G05B 3LJUX 3M7KA 1E4UA 5H1UA 2VJFB 2Y1NA 2LAUA 4O62A 4O64A 2ZETC 3O36A 5TRBA 4Z0RA 2XB1A 5G0FA 3ZVYA 4FK5A 5B78A 2QIZA 5C11A 2YVRA 2KGIA 2AN6A 4GNGA 2F42A 4X3GA 5B77A 4H9DA 4B7YC 2ECTA 4L7XA 1DCQA 2JUNA 2YHOA 2IQJA 2LV9A 3VK6A 2K1JA 1JOCA 2YREA 2KWOA 4OGEA 5C13A 3LVQE 3N9PA 3M63A 2E61A 2NAAA 1MM2A 3PURA 1F62A 3L1ZB 4Q6FA 2M13A 5LKZA 3QZVA 4MSXA 4AP4A 3U5PA 3FANA 4WZ0A 2KKXA 4OGCA 2MD8C 1WEQA 3KNVA 2XOZA 1JM7B 1MBMA 3HCTA 2F6NA 2L80A 2M6MA 3N9NA 2B0OE 2C2LA 5SVIA 3ZVZB 5LCWB 3ZPV1 3FM8C 3KV5A 5SVXA 3SOWA 3V43A 3IHPA 4IC3A 5EYAF 2M85A 2XEUA 3C5KA 1LDJB 1VD4A 2VJFA 1HYIA 2H0DB 2UZGA 3HCUA 2JM3A 1WFKA 2LRIC 2KWJA 2XOCA 5H1TA 2C2VS 5FEYA 3PLWA 4L58A 3O33A 4YABA 4GNDA 4LKAA 1VYXA 3SUBA 2VPBA 4MVTA 4WZ2A 3M99A 2L0BA 3HCSA 3L1XA 2KIZA 2RSDA 2ECVA 2JMDA 3JUEA 3PHDA 4AYCB 1T1HA 2Y1MA 1Z6UA 3E2DA 5H1VA 1ZBDB 4S3OB 3FJUB 2LN0A 2KFTA 1WEMA 1XWHA 1Z60A 2DSMA 3RTRB 4XI1A 5LKXA 4BBQA 4I7DA 4ZQLA 2KKYA 3O70A 2QICA 4LJNA 1JM7A 2YQLA 1V87A 2DJAA 2HYED 2HDPA 1WEPA 1WESA 2G45A 2OXQC 2G43A 4CCGX 5B75A 2PNXA 5D1LB 4Z0OA 2OWAA 4GNEA 2G6QA 2CKLB 2VP7A 2VPEA 1VFYA 4FIPA 5J3XA 3O7AA 2MT5A 2H0DA 4UI9B 4F1PA 2KR4A 5I3LA 3FAOA 2VJEB 5D1MB 2XP0A 5TDRA 3N9QA 4R7EA 5H9MA 2EA6A 2CT2A 2YHNA 2YSMA 2L7PA 2K16A 5G04B 2FSAA 4R2YA 1LDKC 5DKAA 2XOYA 1RMDA 4AYCA 5KH9A 2EODA 2ECGA 4YBTA 4N3WA 1X4UA 2LXPC 2LGVA 2YU4A 5K3QA 1BORA 2MD7B 3RPGB 1IYMA 4PTBA 2CSZA 3O34A 2ECWA 3Q1DA 4AVXA 2QJ0A 4PPEA 4FO9A 2KU3A 2EXUA 4V3KC 4GB0A 1WILA 2P57A 3ZTGA 2VNFA 3N9MA 2MA6A 4C9ZA 4WZ3B 3C6WA 2MA5A 4NN2A 3M62A 4P5OB 2CKLA 3LQJA 4A49A 3I2DA 2K17A 4R8PK 1K2FA
chains in the Genus database with same CATH topology
3LVQE 2E61A 3DDTA 3O47A 3Q1DA 5SVYA 2M13A 2CRRA 3LJUX 3M7KA 2XOYA 2CONA 2CRWA 2KKYA 2EXUA 4H9DA 3KDEC 4F1PA 2RR4A 2P57A 2KKXA 3JUEA 4OGCA 3LDYA 1DCQA 2DJAA 5SVXA 2MKEA 2JUNA 2JM3A 2LAUA 2XOZA 2YVRA 3DWDA 3MDBC 4O62A 2IQJA 2XOCA 2EGMA 2D8UA 2XP0A 4Z0RA 3T9KA 3PLWA 3LVRE 2B0OE 5SVIA 2FD4A 3E2DA 5K3QA 2YREA 3H7HA 3FM8C 4Z0OA 5SVIB 4QQ4A 2OWAA 3SUBA 4OGEA 3FEHA 3FJUB 2FFWA 2L7PA 2CSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O62 A;  2E61 A;  2RR4 A;  5SVI B;  4Z0O A;  4QQ4 A;  4Z0R A;  5SVX A;  5SVY A;  2L7P A;  5SVI A; 
#chains in the Genus database with same CATH topology
 3EB5 A;  1N87 A;  3LRQ A;  2MUM A;  1FP0 A;  4YBS A;  4UP0 A;  4ZUX U;  2YW8 A;  4AUQ B;  2CON A;  1Z2Q A;  1WEE A;  2VJE A;  5B76 A;  4S3O C;  3EB6 A;  2L5U A;  2ECI A;  2D8U A;  2JMJ A;  2YT5 A;  2Y43 A;  5JG6 A;  4WA6 A;  4YAX A;  3U5M A;  4FJC A;  4I7B A;  1G25 A;  5KH3 A;  5TDW A;  3L11 A;  3U5O A;  2VPG A;  1FBV A;  2IDA A;  2LGK A;  2F6J A;  1MM3 A;  2M3H A;  5FB0 A;  3ZYQ A;  3DQV R;  2KYU A;  5AIT A;  3SOX A;  4QQ4 A;  3T7L A;  3KQI A;  2FUI A;  4YC9 A;  5B8D A;  4YBM A;  2KWK A;  3MHH A;  3LQH A;  2RR4 A;  3ASL A;  2E6R A;  4LK9 A;  2EGM A;  5D1K B;  4W4U A;  3ZPV E;  2LQ6 A;  3U5N A;  3GV4 A;  1CHC A;  4UP5 A;  2EGP A;  2D8S A;  2JRJ A;  3KV6 A;  2CSY A;  3ZNI A;  3O47 A;  1WIM A;  2E6S A;  5SVY A;  5TAB A;  2RI7 A;  1WEO A;  4YAT A;  4CA1 A;  3RPG C;  3MDB C;  1WEN A;  3NG2 A;  2PUY A;  3H7H A;  3FEH A;  3SHB A;  3DPL R;  5KH7 A;  2M1R A;  1WE9 A;  4I7C A;  1U6G B;  5TBN A;  4ZDT A;  3KDE C;  3PUQ A;  2FUU A;  4YAD A;  2KE1 A;  2LGG A;  4N4F A;  2BAY A;  2KRE A;  2FFW A;  1X4I A;  4F52 B;  1HYJ A;  3SOU A;  4V3L C;  4QF3 A;  2YUC A;  5LKU A;  4A0C D;  2YSJ A;  1WGM A;  2LGL A;  3O35 A;  5B79 A;  2MNY A;  2LDR A;  3N9L A;  5FER A;  2MKE A;  2ECJ A;  2K4D A;  1X4J A;  2VPD A;  3LVR E;  4BHW A;  2FD4 A;  3GL6 A;  2MIQ A;  4GNF A;  4LLB A;  2JMI A;  3MHS A;  3T6R A;  5AIU A;  3FL2 A;  2YUR A;  4QF2 A;  3DDT A;  5FB1 A;  1WEU A;  2DX8 A;  5DIN A;  1DVP A;  2L43 A;  2CRR A;  2CRW A;  2MNZ A;  4TKP B;  4IC2 A;  3LDY A;  4A4C A;  3DWD A;  2KWN A;  2YYR A;  3HTK C;  3T9K A;  1WEV A;  3N9O A;  2KGG A;  2I50 A;  5LKT A;  5SVI B;  4LAD B;  3LQI A;  4A4B A;  2CSV A;  2YQM A;  2L75 A;  4B86 C;  2LXH C;  3O37 A;  2ECN A;  1WEW A;  5G05 B;  3LJU X;  3M7K A;  1E4U A;  5H1U A;  2VJF B;  2Y1N A;  2LAU A;  4O62 A;  4O64 A;  2ZET C;  3O36 A;  5TRB A;  4Z0R A;  2XB1 A;  5G0F A;  3ZVY A;  4FK5 A;  5B78 A;  2QIZ A;  5C11 A;  2YVR A;  2KGI A;  2AN6 A;  4GNG A;  2F42 A;  4X3G A;  5B77 A;  4H9D A;  4B7Y C;  2ECT A;  4L7X A;  1DCQ A;  2JUN A;  2YHO A;  2IQJ A;  2LV9 A;  3VK6 A;  2K1J A;  1JOC A;  2YRE A;  2KWO A;  4OGE A;  5C13 A;  3LVQ E;  3N9P A;  3M63 A;  2E61 A;  2NAA A;  1MM2 A;  3PUR A;  1F62 A;  3L1Z B;  4Q6F A;  2M13 A;  5LKZ A;  3QZV A;  4MSX A;  4AP4 A;  3U5P A;  3FAN A;  4WZ0 A;  2KKX A;  4OGC A;  2MD8 C;  1WEQ A;  3KNV A;  2XOZ A;  1JM7 B;  1MBM A;  3HCT A;  2F6N A;  2L80 A;  2M6M A;  3N9N A;  2B0O E;  2C2L A;  5SVI A;  3ZVZ B;  5LCW B;  3ZPV 1;  3FM8 C;  3KV5 A;  5SVX A;  3SOW A;  3V43 A;  3IHP A;  4IC3 A;  5EYA F;  2M85 A;  2XEU A;  3C5K A;  1LDJ B;  1VD4 A;  2VJF A;  1HYI A;  2H0D B;  2UZG A;  3HCU A;  2JM3 A;  1WFK A;  2LRI C;  2KWJ A;  2XOC A;  5H1T A;  2C2V S;  5FEY A;  3PLW A;  4L58 A;  3O33 A;  4YAB A;  4GND A;  4LKA A;  1VYX A;  3SUB A;  2VPB A;  4MVT A;  4WZ2 A;  3M99 A;  2L0B A;  3HCS A;  3L1X A;  2KIZ A;  2RSD A;  2ECV A;  2JMD A;  3JUE A;  3PHD A;  4AYC B;  1T1H A;  2Y1M A;  1Z6U A;  3E2D A;  5H1V A;  1ZBD B;  4S3O B;  3FJU B;  2LN0 A;  2KFT A;  1WEM A;  1XWH A;  1Z60 A;  2DSM A;  3RTR B;  4XI1 A;  5LKX A;  4BBQ A;  4I7D A;  4ZQL A;  2KKY A;  3O70 A;  2QIC A;  4LJN A;  1JM7 A;  2YQL A;  1V87 A;  2DJA A;  2HYE D;  2HDP A;  1WEP A;  1WES A;  2G45 A;  2OXQ C;  2G43 A;  4CCG X;  5B75 A;  2PNX A;  5D1L B;  4Z0O A;  2OWA A;  4GNE A;  2G6Q A;  2CKL B;  2VP7 A;  2VPE A;  1VFY A;  4FIP A;  5J3X A;  3O7A A;  2MT5 A;  2H0D A;  4UI9 B;  4F1P A;  2KR4 A;  5I3L A;  3FAO A;  2VJE B;  5D1M B;  2XP0 A;  5TDR A;  3N9Q A;  4R7E A;  5H9M A;  2EA6 A;  2CT2 A;  2YHN A;  2YSM A;  2L7P A;  2K16 A;  5G04 B;  2FSA A;  4R2Y A;  1LDK C;  5DKA A;  2XOY A;  1RMD A;  4AYC A;  5KH9 A;  2EOD A;  2ECG A;  4YBT A;  4N3W A;  1X4U A;  2LXP C;  2LGV A;  2YU4 A;  5K3Q A;  1BOR A;  2MD7 B;  3RPG B;  1IYM A;  4PTB A;  2CSZ A;  3O34 A;  2ECW A;  3Q1D A;  4AVX A;  2QJ0 A;  4PPE A;  4FO9 A;  2KU3 A;  2EXU A;  4V3K C;  4GB0 A;  1WIL A;  2P57 A;  3ZTG A;  2VNF A;  3N9M A;  2MA6 A;  4C9Z A;  4WZ3 B;  3C6W A;  2MA5 A;  4NN2 A;  3M62 A;  4P5O B;  2CKL A;  3LQJ A;  4A49 A;  3I2D A;  2K17 A;  4R8P K;  1K2F A; 
#chains in the Genus database with same CATH homology
 3LVQ E;  2E61 A;  3DDT A;  3O47 A;  3Q1D A;  5SVY A;  2M13 A;  2CRR A;  3LJU X;  3M7K A;  2XOY A;  2CON A;  2CRW A;  2KKY A;  2EXU A;  4H9D A;  3KDE C;  4F1P A;  2RR4 A;  2P57 A;  2KKX A;  3JUE A;  4OGC A;  3LDY A;  1DCQ A;  2DJA A;  5SVX A;  2MKE A;  2JUN A;  2JM3 A;  2LAU A;  2XOZ A;  2YVR A;  3DWD A;  3MDB C;  4O62 A;  2IQJ A;  2XOC A;  2EGM A;  2D8U A;  2XP0 A;  4Z0R A;  3T9K A;  3PLW A;  3LVR E;  2B0O E;  5SVI A;  2FD4 A;  3E2D A;  5K3Q A;  2YRE A;  3H7H A;  3FM8 C;  4Z0O A;  5SVI B;  4QQ4 A;  2OWA A;  3SUB A;  4OGE A;  3FEH A;  3FJU B;  2FFW A;  2L7P A;  2CSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...