2VJEB

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
CQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
publication title Structure of the MDM2/MDMX RING domain heterodimer reveals dimerization is required for their ubiquitylation in trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 12
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjeB00
4AUQB 3KNVA 2JMIA 4L58A 3MHHA 2VJEA 2NAAA 4ZQLA 3KV5A 4WZ3B 2H0DB 3O34A 1JOCA 4AP4A 4R8PK 2KGGA 2XEUA 1XWHA 2K4DA 5J3XA 3HCUA 3RTRB 3VK6A 1JM7B 4GNGA 5H1UA 2YSJA 3ASLA 2BAYA 3KQIA 4FK5A 2QIZA 2EODA 5LCWB 3N9LA 2CKLB 2LGGA 2KR4A 3C5KA 2YUCA 2VJEB 5B76A 4QF2A 5H1TA 3HCTA 4LJNA 2EGPA 4YBSA 1WILA 3V43A 4V3LC 5G0FA 2K17A 5KH3A 4XI1A 1X4IA 5D1MB 1FP0A 4BBQA 2ECJA 5G04B 4GB0A 5G05B 3MHSA 5TDWA 2VP7A 3N9PA 3PUQA 4A49A 4WZ2A 1WEQA 3O70A 2ECWA 2ECGA 4IC3A 3O37A 1K2FA 3LRQA 5TABA 4GNEA 1WEOA 3LQHA 3M63A 5D1LB 2DX8A 3HTKC 2FUIA 2E6RA 2OXQC 4TKPB 3DPLR 3EB6A 3O33A 2KYUA 2L43A 3ZVYA 2KIZA 4PTBA 1MM3A 2LQ6A 2M3HA 2YYRA 5FEYA 2Y43A 3ZYQA 5AITA 1WIMA 4WZ0A 2KWNA 5FERA 3N9NA 4I7CA 1WEUA 4GNDA 2K16A 2H0DA 2L80A 2F6NA 5KH7A 1RMDA 4YC9A 3O35A 5B8DA 2FUUA 1WEPA 2ZETC 1X4UA 3I2DA 4YBTA 2AN6A 2FSAA 2YQMA 4ZDTA 1E4UA 3HCSA 4CCGX 1LDJB 4R7EA 4R2YA 1BORA 2CKLA 2KU3A 2VPBA 2M1RA 2RI7A 1X4JA 2MT5A 2L0BA 4IC2A 4C9ZA 3LQJA 2PUYA 5LKTA 5AIUA 2YHOA 1HYIA 3N9QA 3M62A 4S3OC 4LADB 2YT5A 4YAXA 4V3KC 4YATA 5FB0A 5TDRA 2VNFA 4S3OB 4QF3A 2JRJA 2HDPA 4Q6FA 3LQIA 4W4UA 2ECIA 2LRIC 2G45A 2C2VS 3U5PA 4O64A 3FL2A 5LKXA 3C6WA 3DQVR 5H1VA 2KWJA 2LGKA 4FO9A 4GNFA 2RSDA 1WEEA 2QICA 5KH9A 4UP5A 5DINA 2LN0A 3EB5A 2C2LA 2LDRA 5DKAA 2UZGA 2LXPC 4B7YC 2D8SA 2KWKA 2ECNA 2LXHC 4CA1A 1Z60A 3T6RA 4AYCA 4LK9A 4B86C 2F6JA 5D1KB 1WEMA 4X3GA 2E6SA 1N87A 1ZBDB 1VYXA 1WENA 3KV6A 2ECTA 3RPGB 1WE9A 5LKZA 1MM2A 2G6QA 3M99A 1G25A 5B75A 1WESA 3PURA 5B78A 2MD7B 4YADA 2YURA 4AYCB 2K1JA 2KFTA 2KWOA 5C13A 3ZTGA 3ZVZB 2MNYA 2KE1A 3U5OA 3QZVA 3SOXA 4YABA 1WFKA 5EYAF 4A0CD 1WEWA 1VD4A 4A4CA 2MA6A 3GV4A 2YSMA 2F42A 4ZUXU 3ZPVE 1Z6UA 1CHCA 3PHDA 2LGVA 3L1ZB 2YHNA 1Z2QA 5H9MA 4FJCA 2M85A 1IYMA 4MVTA 2MD8C 3GL6A 4F52B 2LGLA 4I7DA 2VJFB 5JG6A 3SOUA 2CSZA 4UP0A 5FB1A 3L11A 2YW8A 3O7AA 2CSYA 1WGMA 5B79A 2MUMA 3L1XA 4LKAA 2VPEA 3SOWA 1VFYA 2MIQA 3NG2A 2HYED 2EA6A 2KREA 4MSXA 2PNXA 4A4BA 4WA6A 1U6GB 4N3WA 4P5OB 2YU4A 2M6MA 1V87A 3IHPA 4BHWA 2IDAA 2VPDA 3O36A 2VPGA 3N9MA 1WEVA 4N4FA 3ZPV1 2XB1A 2JMJA 5C11A 3SHBA 2L75A 2Y1MA 2JMDA 2KGIA 2I50A 3RPGC 1FBVA 2Y1NA 2MA5A 3T7LA 2CT2A 1DVPA 5TRBA 2YREA 1LDKC 2LV9A 4L7XA 4YBMA 3N9OA 2QJ0A 5B77A 4LLBA 2YQLA 5TBNA 3ZNIA 1HYJA 5LKUA 2L5UA 3U5MA 4FIPA 4PPEA 1T1HA 4AVXA 4UI9B 2VJFA 4NN2A 1F62A 2G43A 1JM7A 3U5NA 5I3LA 2MNZA 2ECVA 4I7BA
chains in the Genus database with same CATH superfamily
4AUQB 3KNVA 2JMIA 4L58A 3MHHA 2B0OE 2VJEA 2NAAA 4ZQLA 3KV5A 4WZ3B 2H0DB 3O34A 1JOCA 4AP4A 4R8PK 4H9DA 2KGGA 2XEUA 1XWHA 2K4DA 5J3XA 2LAUA 3HCUA 3RTRB 3VK6A 1JM7B 4GNGA 5H1UA 2YSJA 3ASLA 2BAYA 3KQIA 4FK5A 2QIZA 2EODA 5LCWB 3N9LA 2CKLB 2LGGA 2KR4A 3C5KA 2YUCA 2VJEB 5B76A 4QF2A 5H1TA 3HCTA 4LJNA 2EGPA 4YBSA 1WILA 3V43A 4V3LC 5G0FA 2K17A 5KH3A 3H7HA 4XI1A 1X4IA 5D1MB 1FP0A 4BBQA 2ECJA 5G04B 4GB0A 5G05B 3MHSA 5TDWA 2VP7A 3O47A 3N9PA 3PUQA 4A49A 4WZ2A 1WEQA 3O70A 2ECWA 2ECGA 4IC3A 3O37A 1K2FA 3LRQA 5TABA 4GNEA 1WEOA 3LQHA 3M63A 5D1LB 2DX8A 3HTKC 2E6RA 2FUIA 2OXQC 4TKPB 3DPLR 3EB6A 3O33A 3SUBA 2KYUA 2L43A 3ZVYA 2KIZA 4PTBA 2RR4A 1MM3A 2LQ6A 2M3HA 2YYRA 5FEYA 2Y43A 3ZYQA 5AITA 1WIMA 4WZ0A 2KWNA 2XOYA 5FERA 3N9NA 3LDYA 4I7CA 3M7KA 1MBMA 3T9KA 1WEUA 2KKXA 4GNDA 2K16A 2H0DA 2L80A 2FD4A 2F6NA 5KH7A 1RMDA 4YC9A 3O35A 5B8DA 3LVRE 2CONA 2FUUA 1WEPA 2ZETC 1X4UA 3I2DA 4YBTA 2AN6A 2FSAA 2YQMA 4ZDTA 1E4UA 2XOCA 3HCSA 4CCGX 1LDJB 4R7EA 4R2YA 1BORA 2CKLA 2KU3A 2VPBA 2M1RA 2RI7A 1X4JA 2XOZA 2MT5A 2L0BA 4IC2A 4OGCA 4C9ZA 3LQJA 2PUYA 4Z0RA 5LKTA 5AIUA 2YHOA 1HYIA 3N9QA 3M62A 4S3OC 4LADB 2YT5A 4YAXA 4V3KC 4OGEA 4YATA 5FB0A 3LJUX 5TDRA 2DJAA 2VNFA 4S3OB 4QF3A 2JRJA 2HDPA 3Q1DA 4Q6FA 3LQIA 4W4UA 2ECIA 2LRIC 2G45A 2C2VS 3U5PA 4O64A 3FL2A 5LKXA 3C6WA 3DQVR 5H1VA 2KWJA 2LGKA 4FO9A 3FM8C 4GNFA 2RSDA 1WEEA 2QICA 5KH9A 4UP5A 5DINA 2LN0A 3EB5A 2KKYA 2C2LA 2LDRA 2UZGA 5DKAA 2LXPC 4B7YC 2D8SA 2YVRA 2KWKA 2ECNA 2LXHC 2XP0A 4CA1A 2JM3A 1Z60A 4O62A 3T6RA 4AYCA 4LK9A 2JUNA 2CRWA 2IQJA 2M13A 4B86C 2F6JA 5D1KB 3FEHA 2EXUA 1WEMA 4X3GA 2E6SA 1N87A 1ZBDB 1VYXA 1WENA 3KV6A 2ECTA 3RPGB 1WE9A 5LKZA 1MM2A 2G6QA 3M99A 1G25A 5B75A 4Z0OA 1WESA 3PURA 5B78A 2MD7B 4YADA 2YURA 4AYCB 2K1JA 3E2DA 2KFTA 2KWOA 5C13A 3ZTGA 3ZVZB 2MNYA 2KE1A 3U5OA 3QZVA 3SOXA 4YABA 1WFKA 5EYAF 4A0CD 2P57A 1WEWA 1VD4A 3PLWA 4A4CA 5SVYA 2MA6A 3GV4A 2YSMA 5SVIA 2F42A 2MKEA 4ZUXU 3ZPVE 1Z6UA 1CHCA 3PHDA 2LGVA 3L1ZB 2YHNA 1Z2QA 3KDEC 5H9MA 2CSVA 4FJCA 2M85A 1IYMA 4MVTA 2MD8C 3GL6A 4F52B 2LGLA 5SVXA 4I7DA 2E61A 2VJFB 5SVIB 5JG6A 3DDTA 3SOUA 2CSZA 2EGMA 4UP0A 5FB1A 3LVQE 3L11A 2YW8A 3O7AA 2CSYA 1WGMA 5B79A 3FJUB 2MUMA 3L1XA 4LKAA 2VPEA 3SOWA 1VFYA 2MIQA 3NG2A 2HYED 2EA6A 2KREA 4MSXA 2PNXA 4A4BA 1U6GB 4WA6A 4N3WA 2OWAA 4P5OB 2YU4A 2M6MA 1V87A 3IHPA 4BHWA 3MDBC 2IDAA 4QQ4A 2VPDA 3O36A 2VPGA 3N9MA 1WEVA 4N4FA 3ZPV1 2XB1A 2JMJA 5C11A 3SHBA 2L75A 2Y1MA 2JMDA 2KGIA 2I50A 3RPGC 1FBVA 2Y1NA 2MA5A 5K3QA 3T7LA 3FAOA 2L7PA 2FFWA 1DCQA 2CT2A 1DVPA 5TRBA 2YREA 1LDKC 3JUEA 2LV9A 4L7XA 4YBMA 3N9OA 2QJ0A 5B77A 4LLBA 2YQLA 5TBNA 4F1PA 2D8UA 3ZNIA 1HYJA 5LKUA 2L5UA 3U5MA 4FIPA 4PPEA 1T1HA 4AVXA 3DWDA 2CRRA 4UI9B 3FANA 2VJFA 2DSMA 4NN2A 1F62A 2G43A 1JM7A 3U5NA 5I3LA 2MNZA 2ECVA 4I7BA
chains in the Genus database with same CATH topology
4AUQB 3KNVA 2JMIA 4L58A 3MHHA 2VJEA 2NAAA 4ZQLA 3KV5A 4WZ3B 2H0DB 3O34A 1JOCA 4AP4A 4R8PK 2KGGA 2XEUA 1XWHA 2K4DA 5J3XA 3HCUA 3RTRB 3VK6A 1JM7B 4GNGA 5H1UA 2YSJA 3ASLA 2BAYA 3KQIA 4FK5A 2QIZA 2EODA 5LCWB 3N9LA 2CKLB 2LGGA 2KR4A 3C5KA 2YUCA 2VJEB 5B76A 4QF2A 5H1TA 3HCTA 4LJNA 2EGPA 4YBSA 1WILA 3V43A 4V3LC 5G0FA 2K17A 5KH3A 4XI1A 1X4IA 5D1MB 1FP0A 4BBQA 2ECJA 5G04B 4GB0A 5G05B 3MHSA 5TDWA 2VP7A 3N9PA 3PUQA 4A49A 4WZ2A 1WEQA 3O70A 2ECWA 2ECGA 4IC3A 3O37A 1K2FA 3LRQA 5TABA 4GNEA 1WEOA 3LQHA 3M63A 5D1LB 2DX8A 3HTKC 2FUIA 2E6RA 2OXQC 4TKPB 3DPLR 3EB6A 3O33A 2KYUA 2L43A 3ZVYA 2KIZA 4PTBA 1MM3A 2LQ6A 2M3HA 2YYRA 5FEYA 2Y43A 3ZYQA 5AITA 1WIMA 4WZ0A 2KWNA 5FERA 3N9NA 4I7CA 1WEUA 4GNDA 2K16A 2H0DA 2L80A 2F6NA 5KH7A 1RMDA 4YC9A 3O35A 5B8DA 2FUUA 1WEPA 2ZETC 1X4UA 3I2DA 4YBTA 2AN6A 2FSAA 2YQMA 4ZDTA 1E4UA 3HCSA 4CCGX 1LDJB 4R7EA 4R2YA 1BORA 2CKLA 2KU3A 2VPBA 2M1RA 2RI7A 1X4JA 2MT5A 2L0BA 4IC2A 4C9ZA 3LQJA 2PUYA 5LKTA 5AIUA 2YHOA 1HYIA 3N9QA 3M62A 4S3OC 4LADB 2YT5A 4YAXA 4V3KC 4YATA 5FB0A 5TDRA 2VNFA 4S3OB 4QF3A 2JRJA 2HDPA 4Q6FA 3LQIA 4W4UA 2ECIA 2LRIC 2G45A 2C2VS 3U5PA 4O64A 3FL2A 5LKXA 3C6WA 3DQVR 5H1VA 2KWJA 2LGKA 4FO9A 4GNFA 2RSDA 1WEEA 2QICA 5KH9A 4UP5A 5DINA 2LN0A 3EB5A 2C2LA 2LDRA 5DKAA 2UZGA 2LXPC 4B7YC 2D8SA 2KWKA 2ECNA 2LXHC 4CA1A 1Z60A 3T6RA 4AYCA 4LK9A 4B86C 2F6JA 5D1KB 1WEMA 4X3GA 2E6SA 1N87A 1ZBDB 1VYXA 1WENA 3KV6A 2ECTA 3RPGB 1WE9A 5LKZA 1MM2A 2G6QA 3M99A 1G25A 5B75A 1WESA 3PURA 5B78A 2MD7B 4YADA 2YURA 4AYCB 2K1JA 2KFTA 2KWOA 5C13A 3ZTGA 3ZVZB 2MNYA 2KE1A 3U5OA 3QZVA 3SOXA 4YABA 1WFKA 5EYAF 4A0CD 1WEWA 1VD4A 4A4CA 2MA6A 3GV4A 2YSMA 2F42A 4ZUXU 3ZPVE 1Z6UA 1CHCA 3PHDA 2LGVA 3L1ZB 2YHNA 1Z2QA 5H9MA 4FJCA 2M85A 1IYMA 4MVTA 2MD8C 3GL6A 4F52B 2LGLA 4I7DA 2VJFB 5JG6A 3SOUA 2CSZA 4UP0A 5FB1A 3L11A 2YW8A 3O7AA 2CSYA 1WGMA 5B79A 2MUMA 3L1XA 4LKAA 2VPEA 3SOWA 1VFYA 2MIQA 3NG2A 2HYED 2EA6A 2KREA 4MSXA 2PNXA 4A4BA 4WA6A 1U6GB 4N3WA 4P5OB 2YU4A 2M6MA 1V87A 3IHPA 4BHWA 2IDAA 2VPDA 3O36A 2VPGA 3N9MA 1WEVA 4N4FA 3ZPV1 2XB1A 2JMJA 5C11A 3SHBA 2L75A 2Y1MA 2JMDA 2KGIA 2I50A 3RPGC 1FBVA 2Y1NA 2MA5A 3T7LA 2CT2A 1DVPA 5TRBA 2YREA 1LDKC 2LV9A 4L7XA 4YBMA 3N9OA 2QJ0A 5B77A 4LLBA 2YQLA 5TBNA 3ZNIA 1HYJA 5LKUA 2L5UA 3U5MA 4FIPA 4PPEA 1T1HA 4AVXA 4UI9B 2VJFA 4NN2A 1F62A 2G43A 1JM7A 3U5NA 5I3LA 2MNZA 2ECVA 4I7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUQ B;  3KNV A;  2JMI A;  4L58 A;  3MHH A;  2VJE A;  2NAA A;  4ZQL A;  3KV5 A;  4WZ3 B;  2H0D B;  3O34 A;  1JOC A;  4AP4 A;  4R8P K;  2KGG A;  2XEU A;  1XWH A;  2K4D A;  5J3X A;  3HCU A;  3RTR B;  3VK6 A;  1JM7 B;  4GNG A;  5H1U A;  2YSJ A;  3ASL A;  2BAY A;  3KQI A;  4FK5 A;  2QIZ A;  2EOD A;  5LCW B;  3N9L A;  2CKL B;  2LGG A;  2KR4 A;  3C5K A;  2YUC A;  2VJE B;  5B76 A;  4QF2 A;  5H1T A;  3HCT A;  4LJN A;  2EGP A;  4YBS A;  1WIL A;  3V43 A;  4V3L C;  5G0F A;  2K17 A;  5KH3 A;  4XI1 A;  1X4I A;  5D1M B;  1FP0 A;  4BBQ A;  2ECJ A;  5G04 B;  4GB0 A;  5G05 B;  3MHS A;  5TDW A;  2VP7 A;  3N9P A;  3PUQ A;  4A49 A;  4WZ2 A;  1WEQ A;  3O70 A;  2ECW A;  2ECG A;  4IC3 A;  3O37 A;  1K2F A;  3LRQ A;  5TAB A;  4GNE A;  1WEO A;  3LQH A;  3M63 A;  5D1L B;  2DX8 A;  3HTK C;  2FUI A;  2E6R A;  2OXQ C;  4TKP B;  3DPL R;  3EB6 A;  3O33 A;  2KYU A;  2L43 A;  3ZVY A;  2KIZ A;  4PTB A;  1MM3 A;  2LQ6 A;  2M3H A;  2YYR A;  5FEY A;  2Y43 A;  3ZYQ A;  5AIT A;  1WIM A;  4WZ0 A;  2KWN A;  5FER A;  3N9N A;  4I7C A;  1WEU A;  4GND A;  2K16 A;  2H0D A;  2L80 A;  2F6N A;  5KH7 A;  1RMD A;  4YC9 A;  3O35 A;  5B8D A;  2FUU A;  1WEP A;  2ZET C;  1X4U A;  3I2D A;  4YBT A;  2AN6 A;  2FSA A;  2YQM A;  4ZDT A;  1E4U A;  3HCS A;  4CCG X;  1LDJ B;  4R7E A;  4R2Y A;  1BOR A;  2CKL A;  2KU3 A;  2VPB A;  2M1R A;  2RI7 A;  1X4J A;  2MT5 A;  2L0B A;  4IC2 A;  4C9Z A;  3LQJ A;  2PUY A;  5LKT A;  5AIU A;  2YHO A;  1HYI A;  3N9Q A;  3M62 A;  4S3O C;  4LAD B;  2YT5 A;  4YAX A;  4V3K C;  4YAT A;  5FB0 A;  5TDR A;  2VNF A;  4S3O B;  4QF3 A;  2JRJ A;  2HDP A;  4Q6F A;  3LQI A;  4W4U A;  2ECI A;  2LRI C;  2G45 A;  2C2V S;  3U5P A;  4O64 A;  3FL2 A;  5LKX A;  3C6W A;  3DQV R;  5H1V A;  2KWJ A;  2LGK A;  4FO9 A;  4GNF A;  2RSD A;  1WEE A;  2QIC A;  5KH9 A;  4UP5 A;  5DIN A;  2LN0 A;  3EB5 A;  2C2L A;  2LDR A;  5DKA A;  2UZG A;  2LXP C;  4B7Y C;  2D8S A;  2KWK A;  2ECN A;  2LXH C;  4CA1 A;  1Z60 A;  3T6R A;  4AYC A;  4LK9 A;  4B86 C;  2F6J A;  5D1K B;  1WEM A;  4X3G A;  2E6S A;  1N87 A;  1ZBD B;  1VYX A;  1WEN A;  3KV6 A;  2ECT A;  3RPG B;  1WE9 A;  5LKZ A;  1MM2 A;  2G6Q A;  3M99 A;  1G25 A;  5B75 A;  1WES A;  3PUR A;  5B78 A;  2MD7 B;  4YAD A;  2YUR A;  4AYC B;  2K1J A;  2KFT A;  2KWO A;  5C13 A;  3ZTG A;  3ZVZ B;  2MNY A;  2KE1 A;  3U5O A;  3QZV A;  3SOX A;  4YAB A;  1WFK A;  5EYA F;  4A0C D;  1WEW A;  1VD4 A;  4A4C A;  2MA6 A;  3GV4 A;  2YSM A;  2F42 A;  4ZUX U;  3ZPV E;  1Z6U A;  1CHC A;  3PHD A;  2LGV A;  3L1Z B;  2YHN A;  1Z2Q A;  5H9M A;  4FJC A;  2M85 A;  1IYM A;  4MVT A;  2MD8 C;  3GL6 A;  4F52 B;  2LGL A;  4I7D A;  2VJF B;  5JG6 A;  3SOU A;  2CSZ A;  4UP0 A;  5FB1 A;  3L11 A;  2YW8 A;  3O7A A;  2CSY A;  1WGM A;  5B79 A;  2MUM A;  3L1X A;  4LKA A;  2VPE A;  3SOW A;  1VFY A;  2MIQ A;  3NG2 A;  2HYE D;  2EA6 A;  2KRE A;  4MSX A;  2PNX A;  4A4B A;  4WA6 A;  1U6G B;  4N3W A;  4P5O B;  2YU4 A;  2M6M A;  1V87 A;  3IHP A;  4BHW A;  2IDA A;  2VPD A;  3O36 A;  2VPG A;  3N9M A;  1WEV A;  4N4F A;  3ZPV 1;  2XB1 A;  2JMJ A;  5C11 A;  3SHB A;  2L75 A;  2Y1M A;  2JMD A;  2KGI A;  2I50 A;  3RPG C;  1FBV A;  2Y1N A;  2MA5 A;  3T7L A;  2CT2 A;  1DVP A;  5TRB A;  2YRE A;  1LDK C;  2LV9 A;  4L7X A;  4YBM A;  3N9O A;  2QJ0 A;  5B77 A;  4LLB A;  2YQL A;  5TBN A;  3ZNI A;  1HYJ A;  5LKU A;  2L5U A;  3U5M A;  4FIP A;  4PPE A;  1T1H A;  4AVX A;  4UI9 B;  2VJF A;  4NN2 A;  1F62 A;  2G43 A;  1JM7 A;  3U5N A;  5I3L A;  2MNZ A;  2ECV A;  4I7B A; 
#chains in the Genus database with same CATH topology
 4AUQ B;  3KNV A;  2JMI A;  4L58 A;  3MHH A;  2B0O E;  2VJE A;  2NAA A;  4ZQL A;  3KV5 A;  4WZ3 B;  2H0D B;  3O34 A;  1JOC A;  4AP4 A;  4R8P K;  4H9D A;  2KGG A;  2XEU A;  1XWH A;  2K4D A;  5J3X A;  2LAU A;  3HCU A;  3RTR B;  3VK6 A;  1JM7 B;  4GNG A;  5H1U A;  2YSJ A;  3ASL A;  2BAY A;  3KQI A;  4FK5 A;  2QIZ A;  2EOD A;  5LCW B;  3N9L A;  2CKL B;  2LGG A;  2KR4 A;  3C5K A;  2YUC A;  2VJE B;  5B76 A;  4QF2 A;  5H1T A;  3HCT A;  4LJN A;  2EGP A;  4YBS A;  1WIL A;  3V43 A;  4V3L C;  5G0F A;  2K17 A;  5KH3 A;  3H7H A;  4XI1 A;  1X4I A;  5D1M B;  1FP0 A;  4BBQ A;  2ECJ A;  5G04 B;  4GB0 A;  5G05 B;  3MHS A;  5TDW A;  2VP7 A;  3O47 A;  3N9P A;  3PUQ A;  4A49 A;  4WZ2 A;  1WEQ A;  3O70 A;  2ECW A;  2ECG A;  4IC3 A;  3O37 A;  1K2F A;  3LRQ A;  5TAB A;  4GNE A;  1WEO A;  3LQH A;  3M63 A;  5D1L B;  2DX8 A;  3HTK C;  2E6R A;  2FUI A;  2OXQ C;  4TKP B;  3DPL R;  3EB6 A;  3O33 A;  3SUB A;  2KYU A;  2L43 A;  3ZVY A;  2KIZ A;  4PTB A;  2RR4 A;  1MM3 A;  2LQ6 A;  2M3H A;  2YYR A;  5FEY A;  2Y43 A;  3ZYQ A;  5AIT A;  1WIM A;  4WZ0 A;  2KWN A;  2XOY A;  5FER A;  3N9N A;  3LDY A;  4I7C A;  3M7K A;  1MBM A;  3T9K A;  1WEU A;  2KKX A;  4GND A;  2K16 A;  2H0D A;  2L80 A;  2FD4 A;  2F6N A;  5KH7 A;  1RMD A;  4YC9 A;  3O35 A;  5B8D A;  3LVR E;  2CON A;  2FUU A;  1WEP A;  2ZET C;  1X4U A;  3I2D A;  4YBT A;  2AN6 A;  2FSA A;  2YQM A;  4ZDT A;  1E4U A;  2XOC A;  3HCS A;  4CCG X;  1LDJ B;  4R7E A;  4R2Y A;  1BOR A;  2CKL A;  2KU3 A;  2VPB A;  2M1R A;  2RI7 A;  1X4J A;  2XOZ A;  2MT5 A;  2L0B A;  4IC2 A;  4OGC A;  4C9Z A;  3LQJ A;  2PUY A;  4Z0R A;  5LKT A;  5AIU A;  2YHO A;  1HYI A;  3N9Q A;  3M62 A;  4S3O C;  4LAD B;  2YT5 A;  4YAX A;  4V3K C;  4OGE A;  4YAT A;  5FB0 A;  3LJU X;  5TDR A;  2DJA A;  2VNF A;  4S3O B;  4QF3 A;  2JRJ A;  2HDP A;  3Q1D A;  4Q6F A;  3LQI A;  4W4U A;  2ECI A;  2LRI C;  2G45 A;  2C2V S;  3U5P A;  4O64 A;  3FL2 A;  5LKX A;  3C6W A;  3DQV R;  5H1V A;  2KWJ A;  2LGK A;  4FO9 A;  3FM8 C;  4GNF A;  2RSD A;  1WEE A;  2QIC A;  5KH9 A;  4UP5 A;  5DIN A;  2LN0 A;  3EB5 A;  2KKY A;  2C2L A;  2LDR A;  2UZG A;  5DKA A;  2LXP C;  4B7Y C;  2D8S A;  2YVR A;  2KWK A;  2ECN A;  2LXH C;  2XP0 A;  4CA1 A;  2JM3 A;  1Z60 A;  4O62 A;  3T6R A;  4AYC A;  4LK9 A;  2JUN A;  2CRW A;  2IQJ A;  2M13 A;  4B86 C;  2F6J A;  5D1K B;  3FEH A;  2EXU A;  1WEM A;  4X3G A;  2E6S A;  1N87 A;  1ZBD B;  1VYX A;  1WEN A;  3KV6 A;  2ECT A;  3RPG B;  1WE9 A;  5LKZ A;  1MM2 A;  2G6Q A;  3M99 A;  1G25 A;  5B75 A;  4Z0O A;  1WES A;  3PUR A;  5B78 A;  2MD7 B;  4YAD A;  2YUR A;  4AYC B;  2K1J A;  3E2D A;  2KFT A;  2KWO A;  5C13 A;  3ZTG A;  3ZVZ B;  2MNY A;  2KE1 A;  3U5O A;  3QZV A;  3SOX A;  4YAB A;  1WFK A;  5EYA F;  4A0C D;  2P57 A;  1WEW A;  1VD4 A;  3PLW A;  4A4C A;  5SVY A;  2MA6 A;  3GV4 A;  2YSM A;  5SVI A;  2F42 A;  2MKE A;  4ZUX U;  3ZPV E;  1Z6U A;  1CHC A;  3PHD A;  2LGV A;  3L1Z B;  2YHN A;  1Z2Q A;  3KDE C;  5H9M A;  2CSV A;  4FJC A;  2M85 A;  1IYM A;  4MVT A;  2MD8 C;  3GL6 A;  4F52 B;  2LGL A;  5SVX A;  4I7D A;  2E61 A;  2VJF B;  5SVI B;  5JG6 A;  3DDT A;  3SOU A;  2CSZ A;  2EGM A;  4UP0 A;  5FB1 A;  3LVQ E;  3L11 A;  2YW8 A;  3O7A A;  2CSY A;  1WGM A;  5B79 A;  3FJU B;  2MUM A;  3L1X A;  4LKA A;  2VPE A;  3SOW A;  1VFY A;  2MIQ A;  3NG2 A;  2HYE D;  2EA6 A;  2KRE A;  4MSX A;  2PNX A;  4A4B A;  1U6G B;  4WA6 A;  4N3W A;  2OWA A;  4P5O B;  2YU4 A;  2M6M A;  1V87 A;  3IHP A;  4BHW A;  3MDB C;  2IDA A;  4QQ4 A;  2VPD A;  3O36 A;  2VPG A;  3N9M A;  1WEV A;  4N4F A;  3ZPV 1;  2XB1 A;  2JMJ A;  5C11 A;  3SHB A;  2L75 A;  2Y1M A;  2JMD A;  2KGI A;  2I50 A;  3RPG C;  1FBV A;  2Y1N A;  2MA5 A;  5K3Q A;  3T7L A;  3FAO A;  2L7P A;  2FFW A;  1DCQ A;  2CT2 A;  1DVP A;  5TRB A;  2YRE A;  1LDK C;  3JUE A;  2LV9 A;  4L7X A;  4YBM A;  3N9O A;  2QJ0 A;  5B77 A;  4LLB A;  2YQL A;  5TBN A;  4F1P A;  2D8U A;  3ZNI A;  1HYJ A;  5LKU A;  2L5U A;  3U5M A;  4FIP A;  4PPE A;  1T1H A;  4AVX A;  3DWD A;  2CRR A;  4UI9 B;  3FAN A;  2VJF A;  2DSM A;  4NN2 A;  1F62 A;  2G43 A;  1JM7 A;  3U5N A;  5I3L A;  2MNZ A;  2ECV A;  4I7B A; 
#chains in the Genus database with same CATH homology
 4AUQ B;  3KNV A;  2JMI A;  4L58 A;  3MHH A;  2VJE A;  2NAA A;  4ZQL A;  3KV5 A;  4WZ3 B;  2H0D B;  3O34 A;  1JOC A;  4AP4 A;  4R8P K;  2KGG A;  2XEU A;  1XWH A;  2K4D A;  5J3X A;  3HCU A;  3RTR B;  3VK6 A;  1JM7 B;  4GNG A;  5H1U A;  2YSJ A;  3ASL A;  2BAY A;  3KQI A;  4FK5 A;  2QIZ A;  2EOD A;  5LCW B;  3N9L A;  2CKL B;  2LGG A;  2KR4 A;  3C5K A;  2YUC A;  2VJE B;  5B76 A;  4QF2 A;  5H1T A;  3HCT A;  4LJN A;  2EGP A;  4YBS A;  1WIL A;  3V43 A;  4V3L C;  5G0F A;  2K17 A;  5KH3 A;  4XI1 A;  1X4I A;  5D1M B;  1FP0 A;  4BBQ A;  2ECJ A;  5G04 B;  4GB0 A;  5G05 B;  3MHS A;  5TDW A;  2VP7 A;  3N9P A;  3PUQ A;  4A49 A;  4WZ2 A;  1WEQ A;  3O70 A;  2ECW A;  2ECG A;  4IC3 A;  3O37 A;  1K2F A;  3LRQ A;  5TAB A;  4GNE A;  1WEO A;  3LQH A;  3M63 A;  5D1L B;  2DX8 A;  3HTK C;  2FUI A;  2E6R A;  2OXQ C;  4TKP B;  3DPL R;  3EB6 A;  3O33 A;  2KYU A;  2L43 A;  3ZVY A;  2KIZ A;  4PTB A;  1MM3 A;  2LQ6 A;  2M3H A;  2YYR A;  5FEY A;  2Y43 A;  3ZYQ A;  5AIT A;  1WIM A;  4WZ0 A;  2KWN A;  5FER A;  3N9N A;  4I7C A;  1WEU A;  4GND A;  2K16 A;  2H0D A;  2L80 A;  2F6N A;  5KH7 A;  1RMD A;  4YC9 A;  3O35 A;  5B8D A;  2FUU A;  1WEP A;  2ZET C;  1X4U A;  3I2D A;  4YBT A;  2AN6 A;  2FSA A;  2YQM A;  4ZDT A;  1E4U A;  3HCS A;  4CCG X;  1LDJ B;  4R7E A;  4R2Y A;  1BOR A;  2CKL A;  2KU3 A;  2VPB A;  2M1R A;  2RI7 A;  1X4J A;  2MT5 A;  2L0B A;  4IC2 A;  4C9Z A;  3LQJ A;  2PUY A;  5LKT A;  5AIU A;  2YHO A;  1HYI A;  3N9Q A;  3M62 A;  4S3O C;  4LAD B;  2YT5 A;  4YAX A;  4V3K C;  4YAT A;  5FB0 A;  5TDR A;  2VNF A;  4S3O B;  4QF3 A;  2JRJ A;  2HDP A;  4Q6F A;  3LQI A;  4W4U A;  2ECI A;  2LRI C;  2G45 A;  2C2V S;  3U5P A;  4O64 A;  3FL2 A;  5LKX A;  3C6W A;  3DQV R;  5H1V A;  2KWJ A;  2LGK A;  4FO9 A;  4GNF A;  2RSD A;  1WEE A;  2QIC A;  5KH9 A;  4UP5 A;  5DIN A;  2LN0 A;  3EB5 A;  2C2L A;  2LDR A;  5DKA A;  2UZG A;  2LXP C;  4B7Y C;  2D8S A;  2KWK A;  2ECN A;  2LXH C;  4CA1 A;  1Z60 A;  3T6R A;  4AYC A;  4LK9 A;  4B86 C;  2F6J A;  5D1K B;  1WEM A;  4X3G A;  2E6S A;  1N87 A;  1ZBD B;  1VYX A;  1WEN A;  3KV6 A;  2ECT A;  3RPG B;  1WE9 A;  5LKZ A;  1MM2 A;  2G6Q A;  3M99 A;  1G25 A;  5B75 A;  1WES A;  3PUR A;  5B78 A;  2MD7 B;  4YAD A;  2YUR A;  4AYC B;  2K1J A;  2KFT A;  2KWO A;  5C13 A;  3ZTG A;  3ZVZ B;  2MNY A;  2KE1 A;  3U5O A;  3QZV A;  3SOX A;  4YAB A;  1WFK A;  5EYA F;  4A0C D;  1WEW A;  1VD4 A;  4A4C A;  2MA6 A;  3GV4 A;  2YSM A;  2F42 A;  4ZUX U;  3ZPV E;  1Z6U A;  1CHC A;  3PHD A;  2LGV A;  3L1Z B;  2YHN A;  1Z2Q A;  5H9M A;  4FJC A;  2M85 A;  1IYM A;  4MVT A;  2MD8 C;  3GL6 A;  4F52 B;  2LGL A;  4I7D A;  2VJF B;  5JG6 A;  3SOU A;  2CSZ A;  4UP0 A;  5FB1 A;  3L11 A;  2YW8 A;  3O7A A;  2CSY A;  1WGM A;  5B79 A;  2MUM A;  3L1X A;  4LKA A;  2VPE A;  3SOW A;  1VFY A;  2MIQ A;  3NG2 A;  2HYE D;  2EA6 A;  2KRE A;  4MSX A;  2PNX A;  4A4B A;  4WA6 A;  1U6G B;  4N3W A;  4P5O B;  2YU4 A;  2M6M A;  1V87 A;  3IHP A;  4BHW A;  2IDA A;  2VPD A;  3O36 A;  2VPG A;  3N9M A;  1WEV A;  4N4F A;  3ZPV 1;  2XB1 A;  2JMJ A;  5C11 A;  3SHB A;  2L75 A;  2Y1M A;  2JMD A;  2KGI A;  2I50 A;  3RPG C;  1FBV A;  2Y1N A;  2MA5 A;  3T7L A;  2CT2 A;  1DVP A;  5TRB A;  2YRE A;  1LDK C;  2LV9 A;  4L7X A;  4YBM A;  3N9O A;  2QJ0 A;  5B77 A;  4LLB A;  2YQL A;  5TBN A;  3ZNI A;  1HYJ A;  5LKU A;  2L5U A;  3U5M A;  4FIP A;  4PPE A;  1T1H A;  4AVX A;  4UI9 B;  2VJF A;  4NN2 A;  1F62 A;  2G43 A;  1JM7 A;  3U5N A;  5I3L A;  2MNZ A;  2ECV A;  4I7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...