2VJEB

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
b'CQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
publication title Structure of the MDM2/MDMX RING domain heterodimer reveals dimerization is required for their ubiquitylation in trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 12
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjeB00
3N9MA 4A4BA 3QZVA 3N9OA 2MA6A 1WEMA 5H1VA 4LK9A 2I50A 2E6SA 2KWKA 2D8SA 2MUMA 2NAAA 5DKAA 3N9LA 4LLBA 2KU3A 4R7EA 3SOXA 2G43A 4YBMA 2F6NA 2M3HA 2ZETC 5TDWA 3FL2A 4I7BA 5B8DA 2BAYA 2ECIA 1LDKC 2ECGA 2LGLA 1HYIA 2L5UA 5B79A 3SHBA 3ZPVE 1Z60A 4NN2A 2E6RA 1Z6UA 2RSDA 2YU4A 5C13A 3PHDA 2VPEA 3HCTA 5G0FA 4PTBA 1JM7A 5KH7A 2M85A 1F62A 1VD4A 2H0DA 2L0BA 3L1ZB 4IC2A 2Y1NA 4A49A 3U5NA 4LJNA 3O35A 5FB1A 1FBVA 3M99A 5TABA 2MD7B 1DVPA 3EB5A 2QJ0A 5H1TA 1JM7B 3VK6A 4AUQB 1WILA 2YHNA 1WEUA 3L1XA 2H0DB 4YABA 4LADB 2VJEA 4ZDTA 3O70A 3NG2A 3KQIA 2XB1A 5B77A 4BHWA 1WE9A 1WEPA 2FSAA 3L11A 2Y43A 3MHSA 3U5MA 2KWOA 3U5PA 3N9NA 2VJEB 2LQ6A 4YATA 5J3XA 2MIQA 2HDPA 2K16A 4W4UA 2AN6A 2XEUA 5D1LB 3LQJA 4QF2A 3LQHA 2C2VS 2Y1MA 2L75A 2CSYA 4GNEA 4F52B 4IC3A 4GNDA 2KWJA 5B76A 2MNYA 5FERA 2G45A 4YBTA 2YQLA 1WIMA 2LXPC 3GV4A 2LXHC 2EGPA 4FJCA 2ECJA 1U6GB 1ZBDB 1WENA 4WZ3B 4YBSA 3HCSA 5B78A 1MM2A 2L80A 3EB6A 4P5OB 4WA6A 5LKUA 2VP7A 2JMJA 2JMIA 2KE1A 1WEWA 1WESA 4XI1A 5G05B 2CT2A 5FB0A 3HTKC 2MT5A 3PUQA 1T1HA 4V3KC 5C11A 3RTRB 3KV5A 5LCWB 2MA5A 3LRQA 3HCUA 4WZ0A 1MM3A 2ECTA 4AYCA 1JOCA 4R2YA 4I7CA 1VYXA 1RMDA 2F42A 3SOUA 3KV6A 2LGKA 4QF3A 1G25A 2MNZA 4FK5A 3ZVYA 5LKTA 5DINA 4C9ZA 5FEYA 5TDRA 2CSZA 2EODA 5LKZA 2LGGA 4N4FA 2LV9A 3O33A 3DQVR 4BBQA 3IHPA 2YYRA 2YREA 2ECNA 1WEEA 1X4UA 3GL6A 3ZNIA 2VJFA 3N9PA 5LKXA 2OXQC 1X4JA 1K2FA 4FO9A 1N87A 2KWNA 2KYUA 3N9QA 2EA6A 2K4DA 1WGMA 3T6RA 2FUUA 4N3WA 1V87A 5H1UA 3LQIA 2HYED 4TKPB 2VJFB 2YW8A 2YURA 2FUIA 2JMDA 4PPEA 2VPDA 2G6QA 2LN0A 4LKAA 2YT5A 2YQMA 4YAXA 2KR4A 1IYMA 3RPGC 3I2DA 4AP4A 2RI7A 4UP5A 3ZYQA 4CA1A 4Q6FA 2QIZA 4YADA 2F6JA 4AVXA 4S3OC 5TRBA 2YHOA 1Z2QA 3O34A 3M63A 4FIPA 3C6WA 3O37A 2KFTA 2KGIA 3V43A 1BORA 2C2LA 5I3LA 3PURA 2VPBA 4V3LC 3ASLA 3MHHA 4A0CD 2LRIC 4I7DA 1WEVA 1LDJB 2L43A 2YUCA 5EYAF 4YC9A 3ZTGA 4L58A 1HYJA 3KNVA 4CCGX 2ECWA 2IDAA 4WZ2A 5D1KB 2M1RA 3O7AA 2PUYA 4ZUXU 4A4CA 2K1JA 5H9MA 2KIZA 4MVTA 4B86C 1CHCA 2KGGA 2UZGA 4X3GA 3DPLR 4O64A 1X4IA 1FP0A 5AIUA 1VFYA 2JRJA 4AYCB 4GB0A 2QICA 2KREA 3U5OA 3SOWA 2YSJA 3T7LA 2YSMA 5KH9A 3M62A 2VPGA 4GNGA 2CKLA 5KH3A 5JG6A 1WFKA 2M6MA 1XWHA 5D1MB 4ZQLA 2PNXA 2ECVA 4UP0A 4GNFA 5AITA 2K17A 3O36A 3ZPV1 1WEOA 4R8PK 4B7YC 2CKLB 3RPGB 2LGVA 5TBNA 2MD8C 2LDRA 1E4UA 2DX8A 5G04B 5B75A 3ZVZB 4L7XA 1WEQA 4MSXA 3C5KA 4S3OB 2VNFA 4UI9B
chains in the Genus database with same CATH superfamily
3N9MA 4A4BA 3QZVA 3N9OA 2XOYA 2MA6A 3LDYA 1WEMA 5H1VA 4LK9A 2I50A 3M7KA 3O47A 2E6SA 2KWKA 2D8SA 2MUMA 2NAAA 5DKAA 3N9LA 4LLBA 2KU3A 4R7EA 3SOXA 2G43A 4YBMA 2F6NA 2M3HA 2CRRA 2ZETC 5TDWA 3FL2A 4I7BA 4OGCA 5B8DA 2BAYA 2ECIA 1LDKC 2ECGA 2EGMA 2LGLA 1HYIA 2L5UA 5B79A 3SHBA 2XOCA 3ZPVE 2CSVA 1Z60A 4NN2A 2E6RA 1Z6UA 2RSDA 2YU4A 5C13A 3PHDA 3HCTA 5SVIA 5G0FA 2D8UA 4PTBA 1JM7A 5KH7A 2M85A 1F62A 1VD4A 2H0DA 2L0BA 3L1ZB 4IC2A 2Y1NA 4A49A 2FD4A 3U5NA 4LJNA 3O35A 2KKXA 5FB1A 1FBVA 3M99A 5TABA 2MD7B 1DVPA 3EB5A 2QJ0A 5H1TA 1JM7B 3VK6A 4AUQB 1WILA 2YHNA 1WEUA 3L1XA 2H0DB 4YABA 4LADB 2VJEA 4ZDTA 3O70A 3NG2A 3KQIA 5SVYA 2XB1A 5B77A 4BHWA 1WE9A 1WEPA 2FSAA 2DJAA 3L11A 4S3OB 3LVQE 2Y43A 3MHSA 3U5MA 2KWOA 3U5PA 3N9NA 2VJEB 2LQ6A 4YATA 5J3XA 2MIQA 2HDPA 2K16A 4W4UA 2AN6A 2XEUA 2CRWA 5D1LB 2CONA 3LQJA 4QF2A 3LQHA 2C2VS 2Y1MA 2L75A 2CSYA 4GNEA 4F52B 4IC3A 4GNDA 2KWJA 5B76A 3FAOA 2MNYA 5FERA 2G45A 4YBTA 2YQLA 1WIMA 2E61A 2LXPC 3GV4A 2LXHC 2EGPA 4FJCA 2ECJA 3FEHA 3LJUX 1U6GB 1ZBDB 1WENA 3T9KA 4WZ3B 4YBSA 3HCSA 5B78A 2XOZA 1MBMA 1MM2A 2L80A 3EB6A 4P5OB 4WA6A 5LKUA 2VP7A 2JMJA 2JMIA 2KE1A 1WEWA 1WESA 4XI1A 5G05B 2CT2A 4O62A 5FB0A 3HTKC 2MT5A 3PUQA 1T1HA 4V3KC 5C11A 3RTRB 3KV5A 5LCWB 2MA5A 3LRQA 2M13A 3HCUA 4WZ0A 1MM3A 2ECTA 4AYCA 1JOCA 4R2YA 3Q1DA 4I7CA 3DWDA 1VYXA 1RMDA 2F42A 3KDEC 2JM3A 3SOUA 3KV6A 2LGKA 2YVRA 5K3QA 4QF3A 1G25A 2MNZA 4FK5A 3ZVYA 5LKTA 5DINA 4C9ZA 2CSZA 5FEYA 5TDRA 2MKEA 2EODA 5SVIB 5LKZA 2LGGA 3E2DA 1DCQA 2LV9A 3O33A 4N4FA 3DQVR 4BBQA 3FJUB 3IHPA 2YYRA 2YREA 2ECNA 1WEEA 1X4UA 3GL6A 3ZNIA 2VJFA 3N9PA 5LKXA 2OXQC 1X4JA 1K2FA 4FO9A 1N87A 2KWNA 2RR4A 2KYUA 2B0OE 3N9QA 2EA6A 2K4DA 1WGMA 2IQJA 3T6RA 2FUUA 4N3WA 1V87A 5H1UA 3LQIA 2HYED 4TKPB 2VJFB 2YW8A 2YURA 2FUIA 2JMDA 4PPEA 2VPDA 2G6QA 2LN0A 4LKAA 2YT5A 2YQMA 4YAXA 2KR4A 1IYMA 3RPGC 3I2DA 4AP4A 2RI7A 4UP5A 3ZYQA 4CA1A 4Q6FA 2P57A 2QIZA 4YADA 2F6JA 2DSMA 4AVXA 5SVXA 4S3OC 5TRBA 2YHOA 2JUNA 2LAUA 1Z2QA 3O34A 3M63A 2FFWA 4FIPA 3C6WA 3LVRE 3O37A 2KFTA 2KGIA 3V43A 1BORA 2L7PA 2C2LA 5I3LA 3PURA 2VPBA 4V3LC 2EXUA 4Z0OA 3ASLA 3FM8C 3MHHA 4A0CD 2LRIC 4I7DA 1WEVA 1LDJB 2L43A 2YUCA 5EYAF 4YC9A 4QQ4A 3ZTGA 4L58A 1HYJA 3KNVA 3DDTA 4CCGX 3PLWA 4F1PA 2ECWA 2IDAA 4WZ2A 5D1KB 2M1RA 3O7AA 2PUYA 4ZUXU 3FANA 4A4CA 2K1JA 5H9MA 2KIZA 4MVTA 4B86C 1CHCA 2KGGA 2UZGA 4X3GA 3DPLR 4O64A 1X4IA 1FP0A 5AIUA 1VFYA 2JRJA 4AYCB 4GB0A 2QICA 2KREA 3U5OA 3SOWA 4OGEA 2YSJA 3T7LA 2YSMA 5KH9A 3M62A 2VPGA 4GNGA 2CKLA 5KH3A 5JG6A 1WFKA 2M6MA 2XP0A 1XWHA 5D1MB 3JUEA 4ZQLA 2PNXA 2ECVA 4UP0A 4GNFA 5AITA 2K17A 3O36A 3H7HA 3ZPV1 4Z0RA 1WEOA 4R8PK 4B7YC 2CKLB 2KKYA 3RPGB 2LGVA 5TBNA 2MD8C 3MDBC 2LDRA 1E4UA 2OWAA 2DX8A 5G04B 5B75A 3ZVZB 4L7XA 1WEQA 4MSXA 3C5KA 3SUBA 4H9DA 2VPEA 2VNFA 4UI9B
chains in the Genus database with same CATH topology
3N9MA 4A4BA 3QZVA 3N9OA 2MA6A 1WEMA 5H1VA 4LK9A 2I50A 2E6SA 2KWKA 2D8SA 2MUMA 2NAAA 5DKAA 3N9LA 4LLBA 2KU3A 4R7EA 3SOXA 2G43A 4YBMA 2F6NA 2M3HA 2ZETC 5TDWA 3FL2A 4I7BA 5B8DA 2BAYA 2ECIA 1LDKC 2ECGA 2LGLA 1HYIA 2L5UA 5B79A 3SHBA 3ZPVE 1Z60A 4NN2A 2E6RA 1Z6UA 2RSDA 2YU4A 5C13A 3PHDA 2VPEA 3HCTA 5G0FA 4PTBA 1JM7A 5KH7A 2M85A 1F62A 1VD4A 2H0DA 2L0BA 3L1ZB 4IC2A 2Y1NA 4A49A 3U5NA 4LJNA 3O35A 5FB1A 1FBVA 3M99A 5TABA 2MD7B 1DVPA 3EB5A 2QJ0A 5H1TA 1JM7B 3VK6A 4AUQB 1WILA 2YHNA 1WEUA 3L1XA 2H0DB 4YABA 4LADB 2VJEA 4ZDTA 3O70A 3NG2A 3KQIA 2XB1A 5B77A 4BHWA 1WE9A 1WEPA 2FSAA 3L11A 2Y43A 3MHSA 3U5MA 2KWOA 3U5PA 3N9NA 2VJEB 2LQ6A 4YATA 5J3XA 2MIQA 2HDPA 2K16A 4W4UA 2AN6A 2XEUA 5D1LB 3LQJA 4QF2A 3LQHA 2C2VS 2Y1MA 2L75A 2CSYA 4GNEA 4F52B 4IC3A 4GNDA 2KWJA 5B76A 2MNYA 5FERA 2G45A 4YBTA 2YQLA 1WIMA 2LXPC 3GV4A 2LXHC 2EGPA 4FJCA 2ECJA 1U6GB 1ZBDB 1WENA 4WZ3B 4YBSA 3HCSA 5B78A 1MM2A 2L80A 3EB6A 4P5OB 4WA6A 5LKUA 2VP7A 2JMJA 2JMIA 2KE1A 1WEWA 1WESA 4XI1A 5G05B 2CT2A 5FB0A 3HTKC 2MT5A 3PUQA 1T1HA 4V3KC 5C11A 3RTRB 3KV5A 5LCWB 2MA5A 3LRQA 3HCUA 4WZ0A 1MM3A 2ECTA 4AYCA 1JOCA 4R2YA 4I7CA 1VYXA 1RMDA 2F42A 3SOUA 3KV6A 2LGKA 4QF3A 1G25A 2MNZA 4FK5A 3ZVYA 5LKTA 5DINA 4C9ZA 5FEYA 5TDRA 2CSZA 2EODA 5LKZA 2LGGA 4N4FA 2LV9A 3O33A 3DQVR 4BBQA 3IHPA 2YYRA 2YREA 2ECNA 1WEEA 1X4UA 3GL6A 3ZNIA 2VJFA 3N9PA 5LKXA 2OXQC 1X4JA 1K2FA 4FO9A 1N87A 2KWNA 2KYUA 3N9QA 2EA6A 2K4DA 1WGMA 3T6RA 2FUUA 4N3WA 1V87A 5H1UA 3LQIA 2HYED 4TKPB 2VJFB 2YW8A 2YURA 2FUIA 2JMDA 4PPEA 2VPDA 2G6QA 2LN0A 4LKAA 2YT5A 2YQMA 4YAXA 2KR4A 1IYMA 3RPGC 3I2DA 4AP4A 2RI7A 4UP5A 3ZYQA 4CA1A 4Q6FA 2QIZA 4YADA 2F6JA 4AVXA 4S3OC 5TRBA 2YHOA 1Z2QA 3O34A 3M63A 4FIPA 3C6WA 3O37A 2KFTA 2KGIA 3V43A 1BORA 2C2LA 5I3LA 3PURA 2VPBA 4V3LC 3ASLA 3MHHA 4A0CD 2LRIC 4I7DA 1WEVA 1LDJB 2L43A 2YUCA 5EYAF 4YC9A 3ZTGA 4L58A 1HYJA 3KNVA 4CCGX 2ECWA 2IDAA 4WZ2A 5D1KB 2M1RA 3O7AA 2PUYA 4ZUXU 4A4CA 2K1JA 5H9MA 2KIZA 4MVTA 4B86C 1CHCA 2KGGA 2UZGA 4X3GA 3DPLR 4O64A 1X4IA 1FP0A 5AIUA 1VFYA 2JRJA 4AYCB 4GB0A 2QICA 2KREA 3U5OA 3SOWA 2YSJA 3T7LA 2YSMA 5KH9A 3M62A 2VPGA 4GNGA 2CKLA 5KH3A 5JG6A 1WFKA 2M6MA 1XWHA 5D1MB 4ZQLA 2PNXA 2ECVA 4UP0A 4GNFA 5AITA 2K17A 3O36A 3ZPV1 1WEOA 4R8PK 4B7YC 2CKLB 3RPGB 2LGVA 5TBNA 2MD8C 2LDRA 1E4UA 2DX8A 5G04B 5B75A 3ZVZB 4L7XA 1WEQA 4MSXA 3C5KA 4S3OB 2VNFA 4UI9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9M A;  4A4B A;  3QZV A;  3N9O A;  2MA6 A;  1WEM A;  5H1V A;  4LK9 A;  2I50 A;  2E6S A;  2KWK A;  2D8S A;  2MUM A;  2NAA A;  5DKA A;  3N9L A;  4LLB A;  2KU3 A;  4R7E A;  3SOX A;  2G43 A;  4YBM A;  2F6N A;  2M3H A;  2ZET C;  5TDW A;  3FL2 A;  4I7B A;  5B8D A;  2BAY A;  2ECI A;  1LDK C;  2ECG A;  2LGL A;  1HYI A;  2L5U A;  5B79 A;  3SHB A;  3ZPV E;  1Z60 A;  4NN2 A;  2E6R A;  1Z6U A;  2RSD A;  2YU4 A;  5C13 A;  3PHD A;  2VPE A;  3HCT A;  5G0F A;  4PTB A;  1JM7 A;  5KH7 A;  2M85 A;  1F62 A;  1VD4 A;  2H0D A;  2L0B A;  3L1Z B;  4IC2 A;  2Y1N A;  4A49 A;  3U5N A;  4LJN A;  3O35 A;  5FB1 A;  1FBV A;  3M99 A;  5TAB A;  2MD7 B;  1DVP A;  3EB5 A;  2QJ0 A;  5H1T A;  1JM7 B;  3VK6 A;  4AUQ B;  1WIL A;  2YHN A;  1WEU A;  3L1X A;  2H0D B;  4YAB A;  4LAD B;  2VJE A;  4ZDT A;  3O70 A;  3NG2 A;  3KQI A;  2XB1 A;  5B77 A;  4BHW A;  1WE9 A;  1WEP A;  2FSA A;  3L11 A;  2Y43 A;  3MHS A;  3U5M A;  2KWO A;  3U5P A;  3N9N A;  2VJE B;  2LQ6 A;  4YAT A;  5J3X A;  2MIQ A;  2HDP A;  2K16 A;  4W4U A;  2AN6 A;  2XEU A;  5D1L B;  3LQJ A;  4QF2 A;  3LQH A;  2C2V S;  2Y1M A;  2L75 A;  2CSY A;  4GNE A;  4F52 B;  4IC3 A;  4GND A;  2KWJ A;  5B76 A;  2MNY A;  5FER A;  2G45 A;  4YBT A;  2YQL A;  1WIM A;  2LXP C;  3GV4 A;  2LXH C;  2EGP A;  4FJC A;  2ECJ A;  1U6G B;  1ZBD B;  1WEN A;  4WZ3 B;  4YBS A;  3HCS A;  5B78 A;  1MM2 A;  2L80 A;  3EB6 A;  4P5O B;  4WA6 A;  5LKU A;  2VP7 A;  2JMJ A;  2JMI A;  2KE1 A;  1WEW A;  1WES A;  4XI1 A;  5G05 B;  2CT2 A;  5FB0 A;  3HTK C;  2MT5 A;  3PUQ A;  1T1H A;  4V3K C;  5C11 A;  3RTR B;  3KV5 A;  5LCW B;  2MA5 A;  3LRQ A;  3HCU A;  4WZ0 A;  1MM3 A;  2ECT A;  4AYC A;  1JOC A;  4R2Y A;  4I7C A;  1VYX A;  1RMD A;  2F42 A;  3SOU A;  3KV6 A;  2LGK A;  4QF3 A;  1G25 A;  2MNZ A;  4FK5 A;  3ZVY A;  5LKT A;  5DIN A;  4C9Z A;  5FEY A;  5TDR A;  2CSZ A;  2EOD A;  5LKZ A;  2LGG A;  4N4F A;  2LV9 A;  3O33 A;  3DQV R;  4BBQ A;  3IHP A;  2YYR A;  2YRE A;  2ECN A;  1WEE A;  1X4U A;  3GL6 A;  3ZNI A;  2VJF A;  3N9P A;  5LKX A;  2OXQ C;  1X4J A;  1K2F A;  4FO9 A;  1N87 A;  2KWN A;  2KYU A;  3N9Q A;  2EA6 A;  2K4D A;  1WGM A;  3T6R A;  2FUU A;  4N3W A;  1V87 A;  5H1U A;  3LQI A;  2HYE D;  4TKP B;  2VJF B;  2YW8 A;  2YUR A;  2FUI A;  2JMD A;  4PPE A;  2VPD A;  2G6Q A;  2LN0 A;  4LKA A;  2YT5 A;  2YQM A;  4YAX A;  2KR4 A;  1IYM A;  3RPG C;  3I2D A;  4AP4 A;  2RI7 A;  4UP5 A;  3ZYQ A;  4CA1 A;  4Q6F A;  2QIZ A;  4YAD A;  2F6J A;  4AVX A;  4S3O C;  5TRB A;  2YHO A;  1Z2Q A;  3O34 A;  3M63 A;  4FIP A;  3C6W A;  3O37 A;  2KFT A;  2KGI A;  3V43 A;  1BOR A;  2C2L A;  5I3L A;  3PUR A;  2VPB A;  4V3L C;  3ASL A;  3MHH A;  4A0C D;  2LRI C;  4I7D A;  1WEV A;  1LDJ B;  2L43 A;  2YUC A;  5EYA F;  4YC9 A;  3ZTG A;  4L58 A;  1HYJ A;  3KNV A;  4CCG X;  2ECW A;  2IDA A;  4WZ2 A;  5D1K B;  2M1R A;  3O7A A;  2PUY A;  4ZUX U;  4A4C A;  2K1J A;  5H9M A;  2KIZ A;  4MVT A;  4B86 C;  1CHC A;  2KGG A;  2UZG A;  4X3G A;  3DPL R;  4O64 A;  1X4I A;  1FP0 A;  5AIU A;  1VFY A;  2JRJ A;  4AYC B;  4GB0 A;  2QIC A;  2KRE A;  3U5O A;  3SOW A;  2YSJ A;  3T7L A;  2YSM A;  5KH9 A;  3M62 A;  2VPG A;  4GNG A;  2CKL A;  5KH3 A;  5JG6 A;  1WFK A;  2M6M A;  1XWH A;  5D1M B;  4ZQL A;  2PNX A;  2ECV A;  4UP0 A;  4GNF A;  5AIT A;  2K17 A;  3O36 A;  3ZPV 1;  1WEO A;  4R8P K;  4B7Y C;  2CKL B;  3RPG B;  2LGV A;  5TBN A;  2MD8 C;  2LDR A;  1E4U A;  2DX8 A;  5G04 B;  5B75 A;  3ZVZ B;  4L7X A;  1WEQ A;  4MSX A;  3C5K A;  4S3O B;  2VNF A;  4UI9 B; 
#chains in the Genus database with same CATH topology
 3N9M A;  4A4B A;  3QZV A;  3N9O A;  2XOY A;  2MA6 A;  3LDY A;  1WEM A;  5H1V A;  4LK9 A;  2I50 A;  3M7K A;  3O47 A;  2E6S A;  2KWK A;  2D8S A;  2MUM A;  2NAA A;  5DKA A;  3N9L A;  4LLB A;  2KU3 A;  4R7E A;  3SOX A;  2G43 A;  4YBM A;  2F6N A;  2M3H A;  2CRR A;  2ZET C;  5TDW A;  3FL2 A;  4I7B A;  4OGC A;  5B8D A;  2BAY A;  2ECI A;  1LDK C;  2ECG A;  2EGM A;  2LGL A;  1HYI A;  2L5U A;  5B79 A;  3SHB A;  2XOC A;  3ZPV E;  2CSV A;  1Z60 A;  4NN2 A;  2E6R A;  1Z6U A;  2RSD A;  2YU4 A;  5C13 A;  3PHD A;  3HCT A;  5SVI A;  5G0F A;  2D8U A;  4PTB A;  1JM7 A;  5KH7 A;  2M85 A;  1F62 A;  1VD4 A;  2H0D A;  2L0B A;  3L1Z B;  4IC2 A;  2Y1N A;  4A49 A;  2FD4 A;  3U5N A;  4LJN A;  3O35 A;  2KKX A;  5FB1 A;  1FBV A;  3M99 A;  5TAB A;  2MD7 B;  1DVP A;  3EB5 A;  2QJ0 A;  5H1T A;  1JM7 B;  3VK6 A;  4AUQ B;  1WIL A;  2YHN A;  1WEU A;  3L1X A;  2H0D B;  4YAB A;  4LAD B;  2VJE A;  4ZDT A;  3O70 A;  3NG2 A;  3KQI A;  5SVY A;  2XB1 A;  5B77 A;  4BHW A;  1WE9 A;  1WEP A;  2FSA A;  2DJA A;  3L11 A;  4S3O B;  3LVQ E;  2Y43 A;  3MHS A;  3U5M A;  2KWO A;  3U5P A;  3N9N A;  2VJE B;  2LQ6 A;  4YAT A;  5J3X A;  2MIQ A;  2HDP A;  2K16 A;  4W4U A;  2AN6 A;  2XEU A;  2CRW A;  5D1L B;  2CON A;  3LQJ A;  4QF2 A;  3LQH A;  2C2V S;  2Y1M A;  2L75 A;  2CSY A;  4GNE A;  4F52 B;  4IC3 A;  4GND A;  2KWJ A;  5B76 A;  3FAO A;  2MNY A;  5FER A;  2G45 A;  4YBT A;  2YQL A;  1WIM A;  2E61 A;  2LXP C;  3GV4 A;  2LXH C;  2EGP A;  4FJC A;  2ECJ A;  3FEH A;  3LJU X;  1U6G B;  1ZBD B;  1WEN A;  3T9K A;  4WZ3 B;  4YBS A;  3HCS A;  5B78 A;  2XOZ A;  1MBM A;  1MM2 A;  2L80 A;  3EB6 A;  4P5O B;  4WA6 A;  5LKU A;  2VP7 A;  2JMJ A;  2JMI A;  2KE1 A;  1WEW A;  1WES A;  4XI1 A;  5G05 B;  2CT2 A;  4O62 A;  5FB0 A;  3HTK C;  2MT5 A;  3PUQ A;  1T1H A;  4V3K C;  5C11 A;  3RTR B;  3KV5 A;  5LCW B;  2MA5 A;  3LRQ A;  2M13 A;  3HCU A;  4WZ0 A;  1MM3 A;  2ECT A;  4AYC A;  1JOC A;  4R2Y A;  3Q1D A;  4I7C A;  3DWD A;  1VYX A;  1RMD A;  2F42 A;  3KDE C;  2JM3 A;  3SOU A;  3KV6 A;  2LGK A;  2YVR A;  5K3Q A;  4QF3 A;  1G25 A;  2MNZ A;  4FK5 A;  3ZVY A;  5LKT A;  5DIN A;  4C9Z A;  2CSZ A;  5FEY A;  5TDR A;  2MKE A;  2EOD A;  5SVI B;  5LKZ A;  2LGG A;  3E2D A;  1DCQ A;  2LV9 A;  3O33 A;  4N4F A;  3DQV R;  4BBQ A;  3FJU B;  3IHP A;  2YYR A;  2YRE A;  2ECN A;  1WEE A;  1X4U A;  3GL6 A;  3ZNI A;  2VJF A;  3N9P A;  5LKX A;  2OXQ C;  1X4J A;  1K2F A;  4FO9 A;  1N87 A;  2KWN A;  2RR4 A;  2KYU A;  2B0O E;  3N9Q A;  2EA6 A;  2K4D A;  1WGM A;  2IQJ A;  3T6R A;  2FUU A;  4N3W A;  1V87 A;  5H1U A;  3LQI A;  2HYE D;  4TKP B;  2VJF B;  2YW8 A;  2YUR A;  2FUI A;  2JMD A;  4PPE A;  2VPD A;  2G6Q A;  2LN0 A;  4LKA A;  2YT5 A;  2YQM A;  4YAX A;  2KR4 A;  1IYM A;  3RPG C;  3I2D A;  4AP4 A;  2RI7 A;  4UP5 A;  3ZYQ A;  4CA1 A;  4Q6F A;  2P57 A;  2QIZ A;  4YAD A;  2F6J A;  2DSM A;  4AVX A;  5SVX A;  4S3O C;  5TRB A;  2YHO A;  2JUN A;  2LAU A;  1Z2Q A;  3O34 A;  3M63 A;  2FFW A;  4FIP A;  3C6W A;  3LVR E;  3O37 A;  2KFT A;  2KGI A;  3V43 A;  1BOR A;  2L7P A;  2C2L A;  5I3L A;  3PUR A;  2VPB A;  4V3L C;  2EXU A;  4Z0O A;  3ASL A;  3FM8 C;  3MHH A;  4A0C D;  2LRI C;  4I7D A;  1WEV A;  1LDJ B;  2L43 A;  2YUC A;  5EYA F;  4YC9 A;  4QQ4 A;  3ZTG A;  4L58 A;  1HYJ A;  3KNV A;  3DDT A;  4CCG X;  3PLW A;  4F1P A;  2ECW A;  2IDA A;  4WZ2 A;  5D1K B;  2M1R A;  3O7A A;  2PUY A;  4ZUX U;  3FAN A;  4A4C A;  2K1J A;  5H9M A;  2KIZ A;  4MVT A;  4B86 C;  1CHC A;  2KGG A;  2UZG A;  4X3G A;  3DPL R;  4O64 A;  1X4I A;  1FP0 A;  5AIU A;  1VFY A;  2JRJ A;  4AYC B;  4GB0 A;  2QIC A;  2KRE A;  3U5O A;  3SOW A;  4OGE A;  2YSJ A;  3T7L A;  2YSM A;  5KH9 A;  3M62 A;  2VPG A;  4GNG A;  2CKL A;  5KH3 A;  5JG6 A;  1WFK A;  2M6M A;  2XP0 A;  1XWH A;  5D1M B;  3JUE A;  4ZQL A;  2PNX A;  2ECV A;  4UP0 A;  4GNF A;  5AIT A;  2K17 A;  3O36 A;  3H7H A;  3ZPV 1;  4Z0R A;  1WEO A;  4R8P K;  4B7Y C;  2CKL B;  2KKY A;  3RPG B;  2LGV A;  5TBN A;  2MD8 C;  3MDB C;  2LDR A;  1E4U A;  2OWA A;  2DX8 A;  5G04 B;  5B75 A;  3ZVZ B;  4L7X A;  1WEQ A;  4MSX A;  3C5K A;  3SUB A;  4H9D A;  2VPE A;  2VNF A;  4UI9 B; 
#chains in the Genus database with same CATH homology
 3N9M A;  4A4B A;  3QZV A;  3N9O A;  2MA6 A;  1WEM A;  5H1V A;  4LK9 A;  2I50 A;  2E6S A;  2KWK A;  2D8S A;  2MUM A;  2NAA A;  5DKA A;  3N9L A;  4LLB A;  2KU3 A;  4R7E A;  3SOX A;  2G43 A;  4YBM A;  2F6N A;  2M3H A;  2ZET C;  5TDW A;  3FL2 A;  4I7B A;  5B8D A;  2BAY A;  2ECI A;  1LDK C;  2ECG A;  2LGL A;  1HYI A;  2L5U A;  5B79 A;  3SHB A;  3ZPV E;  1Z60 A;  4NN2 A;  2E6R A;  1Z6U A;  2RSD A;  2YU4 A;  5C13 A;  3PHD A;  2VPE A;  3HCT A;  5G0F A;  4PTB A;  1JM7 A;  5KH7 A;  2M85 A;  1F62 A;  1VD4 A;  2H0D A;  2L0B A;  3L1Z B;  4IC2 A;  2Y1N A;  4A49 A;  3U5N A;  4LJN A;  3O35 A;  5FB1 A;  1FBV A;  3M99 A;  5TAB A;  2MD7 B;  1DVP A;  3EB5 A;  2QJ0 A;  5H1T A;  1JM7 B;  3VK6 A;  4AUQ B;  1WIL A;  2YHN A;  1WEU A;  3L1X A;  2H0D B;  4YAB A;  4LAD B;  2VJE A;  4ZDT A;  3O70 A;  3NG2 A;  3KQI A;  2XB1 A;  5B77 A;  4BHW A;  1WE9 A;  1WEP A;  2FSA A;  3L11 A;  2Y43 A;  3MHS A;  3U5M A;  2KWO A;  3U5P A;  3N9N A;  2VJE B;  2LQ6 A;  4YAT A;  5J3X A;  2MIQ A;  2HDP A;  2K16 A;  4W4U A;  2AN6 A;  2XEU A;  5D1L B;  3LQJ A;  4QF2 A;  3LQH A;  2C2V S;  2Y1M A;  2L75 A;  2CSY A;  4GNE A;  4F52 B;  4IC3 A;  4GND A;  2KWJ A;  5B76 A;  2MNY A;  5FER A;  2G45 A;  4YBT A;  2YQL A;  1WIM A;  2LXP C;  3GV4 A;  2LXH C;  2EGP A;  4FJC A;  2ECJ A;  1U6G B;  1ZBD B;  1WEN A;  4WZ3 B;  4YBS A;  3HCS A;  5B78 A;  1MM2 A;  2L80 A;  3EB6 A;  4P5O B;  4WA6 A;  5LKU A;  2VP7 A;  2JMJ A;  2JMI A;  2KE1 A;  1WEW A;  1WES A;  4XI1 A;  5G05 B;  2CT2 A;  5FB0 A;  3HTK C;  2MT5 A;  3PUQ A;  1T1H A;  4V3K C;  5C11 A;  3RTR B;  3KV5 A;  5LCW B;  2MA5 A;  3LRQ A;  3HCU A;  4WZ0 A;  1MM3 A;  2ECT A;  4AYC A;  1JOC A;  4R2Y A;  4I7C A;  1VYX A;  1RMD A;  2F42 A;  3SOU A;  3KV6 A;  2LGK A;  4QF3 A;  1G25 A;  2MNZ A;  4FK5 A;  3ZVY A;  5LKT A;  5DIN A;  4C9Z A;  5FEY A;  5TDR A;  2CSZ A;  2EOD A;  5LKZ A;  2LGG A;  4N4F A;  2LV9 A;  3O33 A;  3DQV R;  4BBQ A;  3IHP A;  2YYR A;  2YRE A;  2ECN A;  1WEE A;  1X4U A;  3GL6 A;  3ZNI A;  2VJF A;  3N9P A;  5LKX A;  2OXQ C;  1X4J A;  1K2F A;  4FO9 A;  1N87 A;  2KWN A;  2KYU A;  3N9Q A;  2EA6 A;  2K4D A;  1WGM A;  3T6R A;  2FUU A;  4N3W A;  1V87 A;  5H1U A;  3LQI A;  2HYE D;  4TKP B;  2VJF B;  2YW8 A;  2YUR A;  2FUI A;  2JMD A;  4PPE A;  2VPD A;  2G6Q A;  2LN0 A;  4LKA A;  2YT5 A;  2YQM A;  4YAX A;  2KR4 A;  1IYM A;  3RPG C;  3I2D A;  4AP4 A;  2RI7 A;  4UP5 A;  3ZYQ A;  4CA1 A;  4Q6F A;  2QIZ A;  4YAD A;  2F6J A;  4AVX A;  4S3O C;  5TRB A;  2YHO A;  1Z2Q A;  3O34 A;  3M63 A;  4FIP A;  3C6W A;  3O37 A;  2KFT A;  2KGI A;  3V43 A;  1BOR A;  2C2L A;  5I3L A;  3PUR A;  2VPB A;  4V3L C;  3ASL A;  3MHH A;  4A0C D;  2LRI C;  4I7D A;  1WEV A;  1LDJ B;  2L43 A;  2YUC A;  5EYA F;  4YC9 A;  3ZTG A;  4L58 A;  1HYJ A;  3KNV A;  4CCG X;  2ECW A;  2IDA A;  4WZ2 A;  5D1K B;  2M1R A;  3O7A A;  2PUY A;  4ZUX U;  4A4C A;  2K1J A;  5H9M A;  2KIZ A;  4MVT A;  4B86 C;  1CHC A;  2KGG A;  2UZG A;  4X3G A;  3DPL R;  4O64 A;  1X4I A;  1FP0 A;  5AIU A;  1VFY A;  2JRJ A;  4AYC B;  4GB0 A;  2QIC A;  2KRE A;  3U5O A;  3SOW A;  2YSJ A;  3T7L A;  2YSM A;  5KH9 A;  3M62 A;  2VPG A;  4GNG A;  2CKL A;  5KH3 A;  5JG6 A;  1WFK A;  2M6M A;  1XWH A;  5D1M B;  4ZQL A;  2PNX A;  2ECV A;  4UP0 A;  4GNF A;  5AIT A;  2K17 A;  3O36 A;  3ZPV 1;  1WEO A;  4R8P K;  4B7Y C;  2CKL B;  3RPG B;  2LGV A;  5TBN A;  2MD8 C;  2LDR A;  1E4U A;  2DX8 A;  5G04 B;  5B75 A;  3ZVZ B;  4L7X A;  1WEQ A;  4MSX A;  3C5K A;  4S3O B;  2VNF A;  4UI9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...