2VJEB

Crystal structure of the mdm2-mdmx ring domain heterodimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
CQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE MDM2
publication title Structure of the MDM2/MDMX RING domain heterodimer reveals dimerization is required for their ubiquitylation in trans.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vjeB00
3EB5A 2VJFB 3L1ZB 3U5OA 2M85A 5B79A 3ZTGA 3ZPVE 2YT5A 2CKLB 2PUYA 2LGLA 2OXQC 4AP4A 1K2FA 4LKAA 5D1MB 3L1XA 2L75A 2YHOA 3L11A 3RPGC 3VK6A 4WZ3B 4NN2A 1WEVA 4F52B 4CA1A 2LDRA 3M99A 2KGGA 3C6WA 4UP0A 2MUMA 2KGIA 2D8SA 4WA6A 2F6NA 2MT5A 4R7EA 3ASLA 2KWNA 4BBQA 2K16A 2YHNA 4QF3A 4UP5A 5G04B 4GNGA 2K4DA 3KQIA 2G43A 1WE9A 2YSMA 3MHHA 2QICA 2E6SA 4Q6FA 2LGGA 4I7BA 2LGVA 1WEEA 5H9MA 2BAYA 3SOXA 2M3HA 3RTRB 1VD4A 1CHCA 2C2VS 2NAAA 2YUCA 2RI7A 2JMIA 4B86C 2ECTA 5TABA 5D1LB 4PPEA 3RPGB 1WENA 3O35A 5DKAA 3IHPA 4YAXA 2YQMA 5G0FA 3LQHA 5H1TA 4V3LC 2ECNA 3N9QA 2H0DA 2L0BA 4YC9A 2UZGA 1VYXA 3N9NA 4AVXA 3PURA 2ZETC 3U5NA 3ZNIA 3LRQA 2VPDA 1ZBDB 2CSYA 3O70A 1WEUA 3DPLR 3SHBA 3U5MA 1DVPA 4FO9A 2LV9A 2Y43A 5TBNA 2HDPA 4IC3A 5DINA 5JG6A 3PHDA 4B7YC 2M6MA 2VPBA 1WGMA 4L58A 2XEUA 2YURA 4R2YA 3KV5A 1IYMA 3HTKC 1N87A 4AYCA 1JM7B 2KE1A 4ZQLA 4R8PK 2VJFA 2ECIA 1WEPA 5B78A 2CKLA 5FEYA 2LXHC 2Y1MA 2AN6A 2KR4A 3C5KA 4MSXA 4FJCA 2K1JA 3KNVA 2JMDA 2QJ0A 4LADB 4P5OB 1WEOA 2KYUA 4A4CA 2I50A 1G25A 2CSZA 3EB6A 4A49A 2MNZA 3QZVA 2MD8C 1WILA 5TDRA 2RSDA 3KV6A 5LKXA 3GL6A 4A4BA 4QF2A 2FUUA 2DX8A 2KWJA 4UI9B 5LKZA 3N9LA 2EGPA 2K17A 1X4UA 3ZVZB 2PNXA 5D1KB 2KU3A 5KH3A 3GV4A 1WEMA 3FL2A 2MA5A 3DQVR 1MM3A 1RMDA 4BHWA 4A0CD 3O36A 1Z6UA 4O64A 2YQLA 4N4FA 2VJEB 4TKPB 4YADA 2L80A 2VNFA 3N9OA 2YU4A 4YABA 3MHSA 2IDAA 2MNYA 5B76A 3O33A 2E6RA 5LKUA 4L7XA 4YBMA 1Z60A 2JRJA 4GNDA 2QIZA 4FK5A 2F6JA 2KWKA 1WEQA 2F42A 2LQ6A 2EODA 5C11A 4LLBA 2VPGA 1XWHA 3ZVYA 5B8DA 4X3GA 3LQJA 2G6QA 2Y1NA 5H1VA 4GNEA 4WZ2A 3LQIA 2ECWA 4C9ZA 2M1RA 1FP0A 2MA6A 3O37A 2MIQA 2LGKA 2FUIA 2CT2A 2VP7A 2FSAA 3M62A 1LDKC 4S3OC 4LJNA 1JM7A 4ZUXU 3T6RA 3N9PA 2YREA 5TDWA 4IC2A 5I3LA 2ECJA 2L43A 3V43A 1WFKA 1T1HA 1FBVA 3PUQA 5KH9A 5H1UA 3SOUA 2XB1A 5AIUA 3HCTA 4GB0A 2EA6A 4CCGX 1WIMA 2YW8A 4V3KC 5FB1A 3HCUA 4I7DA 2YSJA 4FIPA 1F62A 1HYJA 1LDJB 1WEWA 5KH7A 1VFYA 5EYAF 3U5PA 5B77A 2LRIC 4I7CA 5C13A 1MM2A 3NG2A 2LXPC 2MD7B 1U6GB 1V87A 2C2LA 2KREA 5G05B 4XI1A 5FB0A 4YBSA 3I2DA 4LK9A 2ECVA 4W4UA 2H0DB 3SOWA 1JOCA 1E4UA 2KFTA 2YYRA 4N3WA 4S3OB 3O34A 5FERA 2ECGA 2G45A 1X4IA 5B75A 1Z2QA 2L5UA 2KWOA 3HCSA 5LKTA 5J3XA 1X4JA 2HYED 4ZDTA 2VJEA 2VPEA 4WZ0A 3ZYQA 3M63A 4YATA 4MVTA 3T7LA 1BORA 3ZPV1 3O7AA 5AITA 4GNFA 4YBTA 1HYIA 5TRBA 5LCWB 3N9MA 4PTBA 4AUQB 2LN0A 1WESA 2KIZA 4AYCB 2JMJA
chains in the Genus database with same CATH superfamily
3EB5A 2VJFB 4QQ4A 3L1ZB 3U5OA 2M85A 5B79A 3ZTGA 3ZPVE 2YT5A 2CKLB 3LJUX 2PUYA 2LGLA 2OXQC 2XOZA 4AP4A 1K2FA 2CRWA 4LKAA 5D1MB 3L1XA 2L75A 2YHOA 3L11A 3RPGC 3VK6A 4WZ3B 4NN2A 1WEVA 3O47A 4F52B 2CSVA 4CA1A 2LDRA 3M99A 2KGGA 3C6WA 4UP0A 2MUMA 2KGIA 2D8SA 4WA6A 3M7KA 2F6NA 2MT5A 4R7EA 3ASLA 3FANA 2KWNA 4BBQA 2K16A 2YHNA 2CONA 4QF3A 4UP5A 5G04B 4GNGA 2K4DA 3KQIA 2G43A 1WE9A 2YSMA 3MHHA 2QICA 2E6SA 4Q6FA 2LGGA 4I7BA 2LGVA 2MKEA 2FFWA 1WEEA 2B0OE 5H9MA 2BAYA 3SOXA 2M3HA 3RTRB 1VD4A 1CHCA 2C2VS 2NAAA 2YUCA 2RI7A 2JMIA 4B86C 2ECTA 5TABA 5D1LB 2XOCA 4PPEA 3RPGB 1WENA 3O35A 5DKAA 3IHPA 4YAXA 2OWAA 2YQMA 5G0FA 3LQHA 5H1TA 4V3LC 2ECNA 2YVRA 3N9QA 2H0DA 2L0BA 4YC9A 2UZGA 1VYXA 3N9NA 4AVXA 3PURA 2ZETC 3U5NA 3ZNIA 3LRQA 2VPDA 1ZBDB 2CSYA 3O70A 3LDYA 1WEUA 3DPLR 3SHBA 3U5MA 1DVPA 4FO9A 2LV9A 2Y43A 5TBNA 2HDPA 4OGEA 2EGMA 3H7HA 4IC3A 5DINA 5JG6A 3PHDA 4B7YC 2M6MA 2XOYA 2VPBA 1WGMA 4L58A 2XEUA 2YURA 4R2YA 3KV5A 1IYMA 3HTKC 1N87A 5K3QA 1MBMA 4AYCA 2LAUA 1JM7B 2KE1A 5SVXA 4ZQLA 4R8PK 2VJFA 2ECIA 1WEPA 5B78A 2CKLA 5FEYA 2JUNA 2LXHC 2Y1MA 2AN6A 2KR4A 3C5KA 4MSXA 4FJCA 3FEHA 2K1JA 3KNVA 2JMDA 2QJ0A 4LADB 4P5OB 1WEOA 2KYUA 4A4CA 2I50A 1G25A 2CSZA 3EB6A 4A49A 2FD4A 2MNZA 3QZVA 2MD8C 1WILA 5TDRA 2RSDA 3KV6A 5LKXA 3GL6A 4A4BA 4QF2A 2FUUA 2DX8A 2KWJA 3Q1DA 2E61A 4UI9B 5LKZA 3FM8C 3N9LA 2EGPA 2K17A 1X4UA 3ZVZB 2PNXA 5D1KB 2KU3A 5KH3A 3GV4A 1WEMA 3FL2A 2MA5A 3DQVR 1MM3A 1RMDA 4BHWA 4A0CD 3O36A 1Z6UA 4O64A 2YQLA 4N4FA 2VJEB 4TKPB 4YADA 2L80A 2VNFA 3N9OA 2YU4A 4YABA 3MHSA 2IDAA 2MNYA 3SUBA 5B76A 3O33A 2E6RA 5LKUA 4L7XA 4YBMA 1Z60A 3DWDA 2JRJA 4GNDA 2QIZA 4FK5A 2F6JA 2KWKA 1WEQA 2F42A 2DJAA 2LQ6A 2KKXA 2EODA 5C11A 4LLBA 2VPGA 1XWHA 3ZVYA 4O62A 5B8DA 4X3GA 3LQJA 2G6QA 2Y1NA 5H1VA 4GNEA 4WZ2A 4Z0OA 3LQIA 2ECWA 4C9ZA 2M1RA 2P57A 1FP0A 2MA6A 3O37A 2DSMA 2MIQA 2RR4A 2LGKA 2FUIA 3LVRE 2CT2A 2VP7A 2FSAA 3M62A 2KKYA 1DCQA 1LDKC 4S3OC 2M13A 4LJNA 1JM7A 4ZUXU 3T6RA 3N9PA 2YREA 5TDWA 4IC2A 2L7PA 5I3LA 3JUEA 2ECJA 2L43A 3V43A 1WFKA 1T1HA 1FBVA 3PUQA 5KH9A 5H1UA 3SOUA 2XB1A 4F1PA 5AIUA 3HCTA 4GB0A 2EA6A 4CCGX 1WIMA 2IQJA 2YW8A 4V3KC 5FB1A 3KDEC 3HCUA 3FAOA 2XP0A 4I7DA 2YSJA 4FIPA 1F62A 1HYJA 1LDJB 1WEWA 3E2DA 5KH7A 1VFYA 5EYAF 3U5PA 4Z0RA 5B77A 2LRIC 4I7CA 5C13A 1MM2A 3NG2A 3T9KA 2LXPC 2EXUA 2MD7B 1U6GB 1V87A 2C2LA 2KREA 5G05B 4XI1A 5FB0A 4YBSA 3I2DA 4LK9A 2ECVA 4W4UA 2H0DB 3SOWA 1JOCA 5SVIB 1E4UA 2KFTA 2YYRA 4N3WA 4S3OB 3LVQE 3O34A 5FERA 2ECGA 2G45A 1X4IA 4H9DA 5B75A 1Z2QA 2L5UA 3PLWA 2KWOA 3HCSA 5LKTA 5J3XA 1X4JA 2HYED 5SVYA 4ZDTA 2VJEA 2VPEA 5SVIA 4WZ0A 3ZYQA 2CRRA 4OGCA 3M63A 4YATA 4MVTA 3T7LA 1BORA 3ZPV1 3MDBC 3O7AA 5AITA 4GNFA 2JM3A 3DDTA 4YBTA 1HYIA 2D8UA 5TRBA 5LCWB 3N9MA 4PTBA 4AUQB 2LN0A 1WESA 2KIZA 4AYCB 2JMJA 3FJUB
chains in the Genus database with same CATH topology
3EB5A 2VJFB 3L1ZB 3U5OA 2M85A 5B79A 3ZTGA 3ZPVE 2YT5A 2CKLB 2PUYA 2LGLA 2OXQC 4AP4A 1K2FA 4LKAA 5D1MB 3L1XA 2L75A 2YHOA 3L11A 3RPGC 3VK6A 4WZ3B 4NN2A 1WEVA 4F52B 4CA1A 2LDRA 3M99A 2KGGA 3C6WA 4UP0A 2MUMA 2KGIA 2D8SA 4WA6A 2F6NA 2MT5A 4R7EA 3ASLA 2KWNA 4BBQA 2K16A 2YHNA 4QF3A 4UP5A 5G04B 4GNGA 2K4DA 3KQIA 2G43A 1WE9A 2YSMA 3MHHA 2QICA 2E6SA 4Q6FA 2LGGA 4I7BA 2LGVA 1WEEA 5H9MA 2BAYA 3SOXA 2M3HA 3RTRB 1VD4A 1CHCA 2C2VS 2NAAA 2YUCA 2RI7A 2JMIA 4B86C 2ECTA 5TABA 5D1LB 4PPEA 3RPGB 1WENA 3O35A 5DKAA 3IHPA 4YAXA 2YQMA 5G0FA 3LQHA 5H1TA 4V3LC 2ECNA 3N9QA 2H0DA 2L0BA 4YC9A 2UZGA 1VYXA 3N9NA 4AVXA 3PURA 2ZETC 3U5NA 3ZNIA 3LRQA 2VPDA 1ZBDB 2CSYA 3O70A 1WEUA 3DPLR 3SHBA 3U5MA 1DVPA 4FO9A 2LV9A 2Y43A 5TBNA 2HDPA 4IC3A 5DINA 5JG6A 3PHDA 4B7YC 2M6MA 2VPBA 1WGMA 4L58A 2XEUA 2YURA 4R2YA 3KV5A 1IYMA 3HTKC 1N87A 4AYCA 1JM7B 2KE1A 4ZQLA 4R8PK 2VJFA 2ECIA 1WEPA 5B78A 2CKLA 5FEYA 2LXHC 2Y1MA 2AN6A 2KR4A 3C5KA 4MSXA 4FJCA 2K1JA 3KNVA 2JMDA 2QJ0A 4LADB 4P5OB 1WEOA 2KYUA 4A4CA 2I50A 1G25A 2CSZA 3EB6A 4A49A 2MNZA 3QZVA 2MD8C 1WILA 5TDRA 2RSDA 3KV6A 5LKXA 3GL6A 4A4BA 4QF2A 2FUUA 2DX8A 2KWJA 4UI9B 5LKZA 3N9LA 2EGPA 2K17A 1X4UA 3ZVZB 2PNXA 5D1KB 2KU3A 5KH3A 3GV4A 1WEMA 3FL2A 2MA5A 3DQVR 1MM3A 1RMDA 4BHWA 4A0CD 3O36A 1Z6UA 4O64A 2YQLA 4N4FA 2VJEB 4TKPB 4YADA 2L80A 2VNFA 3N9OA 2YU4A 4YABA 3MHSA 2IDAA 2MNYA 5B76A 3O33A 2E6RA 5LKUA 4L7XA 4YBMA 1Z60A 2JRJA 4GNDA 2QIZA 4FK5A 2F6JA 2KWKA 1WEQA 2F42A 2LQ6A 2EODA 5C11A 4LLBA 2VPGA 1XWHA 3ZVYA 5B8DA 4X3GA 3LQJA 2G6QA 2Y1NA 5H1VA 4GNEA 4WZ2A 3LQIA 2ECWA 4C9ZA 2M1RA 1FP0A 2MA6A 3O37A 2MIQA 2LGKA 2FUIA 2CT2A 2VP7A 2FSAA 3M62A 1LDKC 4S3OC 4LJNA 1JM7A 4ZUXU 3T6RA 3N9PA 2YREA 5TDWA 4IC2A 5I3LA 2ECJA 2L43A 3V43A 1WFKA 1T1HA 1FBVA 3PUQA 5KH9A 5H1UA 3SOUA 2XB1A 5AIUA 3HCTA 4GB0A 2EA6A 4CCGX 1WIMA 2YW8A 4V3KC 5FB1A 3HCUA 4I7DA 2YSJA 4FIPA 1F62A 1HYJA 1LDJB 1WEWA 5KH7A 1VFYA 5EYAF 3U5PA 5B77A 2LRIC 4I7CA 5C13A 1MM2A 3NG2A 2LXPC 2MD7B 1U6GB 1V87A 2C2LA 2KREA 5G05B 4XI1A 5FB0A 4YBSA 3I2DA 4LK9A 2ECVA 4W4UA 2H0DB 3SOWA 1JOCA 1E4UA 2KFTA 2YYRA 4N3WA 4S3OB 3O34A 5FERA 2ECGA 2G45A 1X4IA 5B75A 1Z2QA 2L5UA 2KWOA 3HCSA 5LKTA 5J3XA 1X4JA 2HYED 4ZDTA 2VJEA 2VPEA 4WZ0A 3ZYQA 3M63A 4YATA 4MVTA 3T7LA 1BORA 3ZPV1 3O7AA 5AITA 4GNFA 4YBTA 1HYIA 5TRBA 5LCWB 3N9MA 4PTBA 4AUQB 2LN0A 1WESA 2KIZA 4AYCB 2JMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EB5 A;  2VJF B;  3L1Z B;  3U5O A;  2M85 A;  5B79 A;  3ZTG A;  3ZPV E;  2YT5 A;  2CKL B;  2PUY A;  2LGL A;  2OXQ C;  4AP4 A;  1K2F A;  4LKA A;  5D1M B;  3L1X A;  2L75 A;  2YHO A;  3L11 A;  3RPG C;  3VK6 A;  4WZ3 B;  4NN2 A;  1WEV A;  4F52 B;  4CA1 A;  2LDR A;  3M99 A;  2KGG A;  3C6W A;  4UP0 A;  2MUM A;  2KGI A;  2D8S A;  4WA6 A;  2F6N A;  2MT5 A;  4R7E A;  3ASL A;  2KWN A;  4BBQ A;  2K16 A;  2YHN A;  4QF3 A;  4UP5 A;  5G04 B;  4GNG A;  2K4D A;  3KQI A;  2G43 A;  1WE9 A;  2YSM A;  3MHH A;  2QIC A;  2E6S A;  4Q6F A;  2LGG A;  4I7B A;  2LGV A;  1WEE A;  5H9M A;  2BAY A;  3SOX A;  2M3H A;  3RTR B;  1VD4 A;  1CHC A;  2C2V S;  2NAA A;  2YUC A;  2RI7 A;  2JMI A;  4B86 C;  2ECT A;  5TAB A;  5D1L B;  4PPE A;  3RPG B;  1WEN A;  3O35 A;  5DKA A;  3IHP A;  4YAX A;  2YQM A;  5G0F A;  3LQH A;  5H1T A;  4V3L C;  2ECN A;  3N9Q A;  2H0D A;  2L0B A;  4YC9 A;  2UZG A;  1VYX A;  3N9N A;  4AVX A;  3PUR A;  2ZET C;  3U5N A;  3ZNI A;  3LRQ A;  2VPD A;  1ZBD B;  2CSY A;  3O70 A;  1WEU A;  3DPL R;  3SHB A;  3U5M A;  1DVP A;  4FO9 A;  2LV9 A;  2Y43 A;  5TBN A;  2HDP A;  4IC3 A;  5DIN A;  5JG6 A;  3PHD A;  4B7Y C;  2M6M A;  2VPB A;  1WGM A;  4L58 A;  2XEU A;  2YUR A;  4R2Y A;  3KV5 A;  1IYM A;  3HTK C;  1N87 A;  4AYC A;  1JM7 B;  2KE1 A;  4ZQL A;  4R8P K;  2VJF A;  2ECI A;  1WEP A;  5B78 A;  2CKL A;  5FEY A;  2LXH C;  2Y1M A;  2AN6 A;  2KR4 A;  3C5K A;  4MSX A;  4FJC A;  2K1J A;  3KNV A;  2JMD A;  2QJ0 A;  4LAD B;  4P5O B;  1WEO A;  2KYU A;  4A4C A;  2I50 A;  1G25 A;  2CSZ A;  3EB6 A;  4A49 A;  2MNZ A;  3QZV A;  2MD8 C;  1WIL A;  5TDR A;  2RSD A;  3KV6 A;  5LKX A;  3GL6 A;  4A4B A;  4QF2 A;  2FUU A;  2DX8 A;  2KWJ A;  4UI9 B;  5LKZ A;  3N9L A;  2EGP A;  2K17 A;  1X4U A;  3ZVZ B;  2PNX A;  5D1K B;  2KU3 A;  5KH3 A;  3GV4 A;  1WEM A;  3FL2 A;  2MA5 A;  3DQV R;  1MM3 A;  1RMD A;  4BHW A;  4A0C D;  3O36 A;  1Z6U A;  4O64 A;  2YQL A;  4N4F A;  2VJE B;  4TKP B;  4YAD A;  2L80 A;  2VNF A;  3N9O A;  2YU4 A;  4YAB A;  3MHS A;  2IDA A;  2MNY A;  5B76 A;  3O33 A;  2E6R A;  5LKU A;  4L7X A;  4YBM A;  1Z60 A;  2JRJ A;  4GND A;  2QIZ A;  4FK5 A;  2F6J A;  2KWK A;  1WEQ A;  2F42 A;  2LQ6 A;  2EOD A;  5C11 A;  4LLB A;  2VPG A;  1XWH A;  3ZVY A;  5B8D A;  4X3G A;  3LQJ A;  2G6Q A;  2Y1N A;  5H1V A;  4GNE A;  4WZ2 A;  3LQI A;  2ECW A;  4C9Z A;  2M1R A;  1FP0 A;  2MA6 A;  3O37 A;  2MIQ A;  2LGK A;  2FUI A;  2CT2 A;  2VP7 A;  2FSA A;  3M62 A;  1LDK C;  4S3O C;  4LJN A;  1JM7 A;  4ZUX U;  3T6R A;  3N9P A;  2YRE A;  5TDW A;  4IC2 A;  5I3L A;  2ECJ A;  2L43 A;  3V43 A;  1WFK A;  1T1H A;  1FBV A;  3PUQ A;  5KH9 A;  5H1U A;  3SOU A;  2XB1 A;  5AIU A;  3HCT A;  4GB0 A;  2EA6 A;  4CCG X;  1WIM A;  2YW8 A;  4V3K C;  5FB1 A;  3HCU A;  4I7D A;  2YSJ A;  4FIP A;  1F62 A;  1HYJ A;  1LDJ B;  1WEW A;  5KH7 A;  1VFY A;  5EYA F;  3U5P A;  5B77 A;  2LRI C;  4I7C A;  5C13 A;  1MM2 A;  3NG2 A;  2LXP C;  2MD7 B;  1U6G B;  1V87 A;  2C2L A;  2KRE A;  5G05 B;  4XI1 A;  5FB0 A;  4YBS A;  3I2D A;  4LK9 A;  2ECV A;  4W4U A;  2H0D B;  3SOW A;  1JOC A;  1E4U A;  2KFT A;  2YYR A;  4N3W A;  4S3O B;  3O34 A;  5FER A;  2ECG A;  2G45 A;  1X4I A;  5B75 A;  1Z2Q A;  2L5U A;  2KWO A;  3HCS A;  5LKT A;  5J3X A;  1X4J A;  2HYE D;  4ZDT A;  2VJE A;  2VPE A;  4WZ0 A;  3ZYQ A;  3M63 A;  4YAT A;  4MVT A;  3T7L A;  1BOR A;  3ZPV 1;  3O7A A;  5AIT A;  4GNF A;  4YBT A;  1HYI A;  5TRB A;  5LCW B;  3N9M A;  4PTB A;  4AUQ B;  2LN0 A;  1WES A;  2KIZ A;  4AYC B;  2JMJ A; 
#chains in the Genus database with same CATH topology
 3EB5 A;  2VJF B;  4QQ4 A;  3L1Z B;  3U5O A;  2M85 A;  5B79 A;  3ZTG A;  3ZPV E;  2YT5 A;  2CKL B;  3LJU X;  2PUY A;  2LGL A;  2OXQ C;  2XOZ A;  4AP4 A;  1K2F A;  2CRW A;  4LKA A;  5D1M B;  3L1X A;  2L75 A;  2YHO A;  3L11 A;  3RPG C;  3VK6 A;  4WZ3 B;  4NN2 A;  1WEV A;  3O47 A;  4F52 B;  2CSV A;  4CA1 A;  2LDR A;  3M99 A;  2KGG A;  3C6W A;  4UP0 A;  2MUM A;  2KGI A;  2D8S A;  4WA6 A;  3M7K A;  2F6N A;  2MT5 A;  4R7E A;  3ASL A;  3FAN A;  2KWN A;  4BBQ A;  2K16 A;  2YHN A;  2CON A;  4QF3 A;  4UP5 A;  5G04 B;  4GNG A;  2K4D A;  3KQI A;  2G43 A;  1WE9 A;  2YSM A;  3MHH A;  2QIC A;  2E6S A;  4Q6F A;  2LGG A;  4I7B A;  2LGV A;  2MKE A;  2FFW A;  1WEE A;  2B0O E;  5H9M A;  2BAY A;  3SOX A;  2M3H A;  3RTR B;  1VD4 A;  1CHC A;  2C2V S;  2NAA A;  2YUC A;  2RI7 A;  2JMI A;  4B86 C;  2ECT A;  5TAB A;  5D1L B;  2XOC A;  4PPE A;  3RPG B;  1WEN A;  3O35 A;  5DKA A;  3IHP A;  4YAX A;  2OWA A;  2YQM A;  5G0F A;  3LQH A;  5H1T A;  4V3L C;  2ECN A;  2YVR A;  3N9Q A;  2H0D A;  2L0B A;  4YC9 A;  2UZG A;  1VYX A;  3N9N A;  4AVX A;  3PUR A;  2ZET C;  3U5N A;  3ZNI A;  3LRQ A;  2VPD A;  1ZBD B;  2CSY A;  3O70 A;  3LDY A;  1WEU A;  3DPL R;  3SHB A;  3U5M A;  1DVP A;  4FO9 A;  2LV9 A;  2Y43 A;  5TBN A;  2HDP A;  4OGE A;  2EGM A;  3H7H A;  4IC3 A;  5DIN A;  5JG6 A;  3PHD A;  4B7Y C;  2M6M A;  2XOY A;  2VPB A;  1WGM A;  4L58 A;  2XEU A;  2YUR A;  4R2Y A;  3KV5 A;  1IYM A;  3HTK C;  1N87 A;  5K3Q A;  1MBM A;  4AYC A;  2LAU A;  1JM7 B;  2KE1 A;  5SVX A;  4ZQL A;  4R8P K;  2VJF A;  2ECI A;  1WEP A;  5B78 A;  2CKL A;  5FEY A;  2JUN A;  2LXH C;  2Y1M A;  2AN6 A;  2KR4 A;  3C5K A;  4MSX A;  4FJC A;  3FEH A;  2K1J A;  3KNV A;  2JMD A;  2QJ0 A;  4LAD B;  4P5O B;  1WEO A;  2KYU A;  4A4C A;  2I50 A;  1G25 A;  2CSZ A;  3EB6 A;  4A49 A;  2FD4 A;  2MNZ A;  3QZV A;  2MD8 C;  1WIL A;  5TDR A;  2RSD A;  3KV6 A;  5LKX A;  3GL6 A;  4A4B A;  4QF2 A;  2FUU A;  2DX8 A;  2KWJ A;  3Q1D A;  2E61 A;  4UI9 B;  5LKZ A;  3FM8 C;  3N9L A;  2EGP A;  2K17 A;  1X4U A;  3ZVZ B;  2PNX A;  5D1K B;  2KU3 A;  5KH3 A;  3GV4 A;  1WEM A;  3FL2 A;  2MA5 A;  3DQV R;  1MM3 A;  1RMD A;  4BHW A;  4A0C D;  3O36 A;  1Z6U A;  4O64 A;  2YQL A;  4N4F A;  2VJE B;  4TKP B;  4YAD A;  2L80 A;  2VNF A;  3N9O A;  2YU4 A;  4YAB A;  3MHS A;  2IDA A;  2MNY A;  3SUB A;  5B76 A;  3O33 A;  2E6R A;  5LKU A;  4L7X A;  4YBM A;  1Z60 A;  3DWD A;  2JRJ A;  4GND A;  2QIZ A;  4FK5 A;  2F6J A;  2KWK A;  1WEQ A;  2F42 A;  2DJA A;  2LQ6 A;  2KKX A;  2EOD A;  5C11 A;  4LLB A;  2VPG A;  1XWH A;  3ZVY A;  4O62 A;  5B8D A;  4X3G A;  3LQJ A;  2G6Q A;  2Y1N A;  5H1V A;  4GNE A;  4WZ2 A;  4Z0O A;  3LQI A;  2ECW A;  4C9Z A;  2M1R A;  2P57 A;  1FP0 A;  2MA6 A;  3O37 A;  2DSM A;  2MIQ A;  2RR4 A;  2LGK A;  2FUI A;  3LVR E;  2CT2 A;  2VP7 A;  2FSA A;  3M62 A;  2KKY A;  1DCQ A;  1LDK C;  4S3O C;  2M13 A;  4LJN A;  1JM7 A;  4ZUX U;  3T6R A;  3N9P A;  2YRE A;  5TDW A;  4IC2 A;  2L7P A;  5I3L A;  3JUE A;  2ECJ A;  2L43 A;  3V43 A;  1WFK A;  1T1H A;  1FBV A;  3PUQ A;  5KH9 A;  5H1U A;  3SOU A;  2XB1 A;  4F1P A;  5AIU A;  3HCT A;  4GB0 A;  2EA6 A;  4CCG X;  1WIM A;  2IQJ A;  2YW8 A;  4V3K C;  5FB1 A;  3KDE C;  3HCU A;  3FAO A;  2XP0 A;  4I7D A;  2YSJ A;  4FIP A;  1F62 A;  1HYJ A;  1LDJ B;  1WEW A;  3E2D A;  5KH7 A;  1VFY A;  5EYA F;  3U5P A;  4Z0R A;  5B77 A;  2LRI C;  4I7C A;  5C13 A;  1MM2 A;  3NG2 A;  3T9K A;  2LXP C;  2EXU A;  2MD7 B;  1U6G B;  1V87 A;  2C2L A;  2KRE A;  5G05 B;  4XI1 A;  5FB0 A;  4YBS A;  3I2D A;  4LK9 A;  2ECV A;  4W4U A;  2H0D B;  3SOW A;  1JOC A;  5SVI B;  1E4U A;  2KFT A;  2YYR A;  4N3W A;  4S3O B;  3LVQ E;  3O34 A;  5FER A;  2ECG A;  2G45 A;  1X4I A;  4H9D A;  5B75 A;  1Z2Q A;  2L5U A;  3PLW A;  2KWO A;  3HCS A;  5LKT A;  5J3X A;  1X4J A;  2HYE D;  5SVY A;  4ZDT A;  2VJE A;  2VPE A;  5SVI A;  4WZ0 A;  3ZYQ A;  2CRR A;  4OGC A;  3M63 A;  4YAT A;  4MVT A;  3T7L A;  1BOR A;  3ZPV 1;  3MDB C;  3O7A A;  5AIT A;  4GNF A;  2JM3 A;  3DDT A;  4YBT A;  1HYI A;  2D8U A;  5TRB A;  5LCW B;  3N9M A;  4PTB A;  4AUQ B;  2LN0 A;  1WES A;  2KIZ A;  4AYC B;  2JMJ A;  3FJU B; 
#chains in the Genus database with same CATH homology
 3EB5 A;  2VJF B;  3L1Z B;  3U5O A;  2M85 A;  5B79 A;  3ZTG A;  3ZPV E;  2YT5 A;  2CKL B;  2PUY A;  2LGL A;  2OXQ C;  4AP4 A;  1K2F A;  4LKA A;  5D1M B;  3L1X A;  2L75 A;  2YHO A;  3L11 A;  3RPG C;  3VK6 A;  4WZ3 B;  4NN2 A;  1WEV A;  4F52 B;  4CA1 A;  2LDR A;  3M99 A;  2KGG A;  3C6W A;  4UP0 A;  2MUM A;  2KGI A;  2D8S A;  4WA6 A;  2F6N A;  2MT5 A;  4R7E A;  3ASL A;  2KWN A;  4BBQ A;  2K16 A;  2YHN A;  4QF3 A;  4UP5 A;  5G04 B;  4GNG A;  2K4D A;  3KQI A;  2G43 A;  1WE9 A;  2YSM A;  3MHH A;  2QIC A;  2E6S A;  4Q6F A;  2LGG A;  4I7B A;  2LGV A;  1WEE A;  5H9M A;  2BAY A;  3SOX A;  2M3H A;  3RTR B;  1VD4 A;  1CHC A;  2C2V S;  2NAA A;  2YUC A;  2RI7 A;  2JMI A;  4B86 C;  2ECT A;  5TAB A;  5D1L B;  4PPE A;  3RPG B;  1WEN A;  3O35 A;  5DKA A;  3IHP A;  4YAX A;  2YQM A;  5G0F A;  3LQH A;  5H1T A;  4V3L C;  2ECN A;  3N9Q A;  2H0D A;  2L0B A;  4YC9 A;  2UZG A;  1VYX A;  3N9N A;  4AVX A;  3PUR A;  2ZET C;  3U5N A;  3ZNI A;  3LRQ A;  2VPD A;  1ZBD B;  2CSY A;  3O70 A;  1WEU A;  3DPL R;  3SHB A;  3U5M A;  1DVP A;  4FO9 A;  2LV9 A;  2Y43 A;  5TBN A;  2HDP A;  4IC3 A;  5DIN A;  5JG6 A;  3PHD A;  4B7Y C;  2M6M A;  2VPB A;  1WGM A;  4L58 A;  2XEU A;  2YUR A;  4R2Y A;  3KV5 A;  1IYM A;  3HTK C;  1N87 A;  4AYC A;  1JM7 B;  2KE1 A;  4ZQL A;  4R8P K;  2VJF A;  2ECI A;  1WEP A;  5B78 A;  2CKL A;  5FEY A;  2LXH C;  2Y1M A;  2AN6 A;  2KR4 A;  3C5K A;  4MSX A;  4FJC A;  2K1J A;  3KNV A;  2JMD A;  2QJ0 A;  4LAD B;  4P5O B;  1WEO A;  2KYU A;  4A4C A;  2I50 A;  1G25 A;  2CSZ A;  3EB6 A;  4A49 A;  2MNZ A;  3QZV A;  2MD8 C;  1WIL A;  5TDR A;  2RSD A;  3KV6 A;  5LKX A;  3GL6 A;  4A4B A;  4QF2 A;  2FUU A;  2DX8 A;  2KWJ A;  4UI9 B;  5LKZ A;  3N9L A;  2EGP A;  2K17 A;  1X4U A;  3ZVZ B;  2PNX A;  5D1K B;  2KU3 A;  5KH3 A;  3GV4 A;  1WEM A;  3FL2 A;  2MA5 A;  3DQV R;  1MM3 A;  1RMD A;  4BHW A;  4A0C D;  3O36 A;  1Z6U A;  4O64 A;  2YQL A;  4N4F A;  2VJE B;  4TKP B;  4YAD A;  2L80 A;  2VNF A;  3N9O A;  2YU4 A;  4YAB A;  3MHS A;  2IDA A;  2MNY A;  5B76 A;  3O33 A;  2E6R A;  5LKU A;  4L7X A;  4YBM A;  1Z60 A;  2JRJ A;  4GND A;  2QIZ A;  4FK5 A;  2F6J A;  2KWK A;  1WEQ A;  2F42 A;  2LQ6 A;  2EOD A;  5C11 A;  4LLB A;  2VPG A;  1XWH A;  3ZVY A;  5B8D A;  4X3G A;  3LQJ A;  2G6Q A;  2Y1N A;  5H1V A;  4GNE A;  4WZ2 A;  3LQI A;  2ECW A;  4C9Z A;  2M1R A;  1FP0 A;  2MA6 A;  3O37 A;  2MIQ A;  2LGK A;  2FUI A;  2CT2 A;  2VP7 A;  2FSA A;  3M62 A;  1LDK C;  4S3O C;  4LJN A;  1JM7 A;  4ZUX U;  3T6R A;  3N9P A;  2YRE A;  5TDW A;  4IC2 A;  5I3L A;  2ECJ A;  2L43 A;  3V43 A;  1WFK A;  1T1H A;  1FBV A;  3PUQ A;  5KH9 A;  5H1U A;  3SOU A;  2XB1 A;  5AIU A;  3HCT A;  4GB0 A;  2EA6 A;  4CCG X;  1WIM A;  2YW8 A;  4V3K C;  5FB1 A;  3HCU A;  4I7D A;  2YSJ A;  4FIP A;  1F62 A;  1HYJ A;  1LDJ B;  1WEW A;  5KH7 A;  1VFY A;  5EYA F;  3U5P A;  5B77 A;  2LRI C;  4I7C A;  5C13 A;  1MM2 A;  3NG2 A;  2LXP C;  2MD7 B;  1U6G B;  1V87 A;  2C2L A;  2KRE A;  5G05 B;  4XI1 A;  5FB0 A;  4YBS A;  3I2D A;  4LK9 A;  2ECV A;  4W4U A;  2H0D B;  3SOW A;  1JOC A;  1E4U A;  2KFT A;  2YYR A;  4N3W A;  4S3O B;  3O34 A;  5FER A;  2ECG A;  2G45 A;  1X4I A;  5B75 A;  1Z2Q A;  2L5U A;  2KWO A;  3HCS A;  5LKT A;  5J3X A;  1X4J A;  2HYE D;  4ZDT A;  2VJE A;  2VPE A;  4WZ0 A;  3ZYQ A;  3M63 A;  4YAT A;  4MVT A;  3T7L A;  1BOR A;  3ZPV 1;  3O7A A;  5AIT A;  4GNF A;  4YBT A;  1HYI A;  5TRB A;  5LCW B;  3N9M A;  4PTB A;  4AUQ B;  2LN0 A;  1WES A;  2KIZ A;  4AYC B;  2JMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...