2CKLB

Ring1b-bmi1 e3 catalytic domain structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
96
Chain Sequence
KTWELSLYELQRTPQEAITDGLEIVSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and E3-Ligase Activity of the Ring-Ring Complex of Polycomb Proteins Bmi1 and Ring1B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords POLYCOMB GROUP RING FINGER PROTEIN 4
total genus 17
structure length 96
sequence length 100
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2cklB01
1Z2QA 3N9MA 2KU3A 4WZ3B 2LGLA 4QF3A 2Y1MA 5D1MB 2YW8A 2Y43A 5J3XA 3MHSA 2LDRA 3RTRB 2MD8C 2G6QA 4YC9A 4AYCA 3GV4A 2VPDA 2VNFA 4S3OB 2JRJA 1N87A 3U5OA 4C9ZA 2ZETC 2EGPA 2F42A 5FB0A 1LDJB 1LDKC 2YQLA 4LADB 2MNZA 3EB5A 5H1TA 4A4CA 4WA6A 1U6GB 3M99A 3T6RA 5TBNA 4N3WA 1CHCA 4LLBA 2C2VS 3ZPVE 1JOCA 2YHNA 2C2LA 3HCUA 4ZDTA 2K17A 4A49A 5DKAA 4S3OC 5JG6A 4AP4A 1Z6UA 4GNFA 3KV6A 3GL6A 5KH3A 2LV9A 2VJEA 5AITA 3KV5A 5LKXA 1T1HA 4UP0A 5G04B 1DVPA 1WILA 3U5MA 4IC3A 4AYCB 3ZNIA 2EODA 2FUIA 2KWKA 3ASLA 5TDWA 2LXHC 1HYIA 1X4UA 4R2YA 1VYXA 3O35A 2VJEB 2MT5A 2AN6A 4BBQA 2ECWA 3M63A 5G05B 3T7LA 2YREA 2ECNA 1WEMA 2ECJA 3SHBA 5LKUA 3U5NA 2KE1A 5TRBA 4IC2A 4QF2A 2QIZA 3HCSA 2YSJA 2FUUA 4WZ0A 1X4IA 5C11A 5DINA 2YU4A 2CSZA 4FIPA 3MHHA 3LQHA 4YAXA 5TDRA 2KGGA 4YATA 2PNXA 4GB0A 1MM2A 2VP7A 5B75A 4FO9A 2MA6A 3O70A 2YQMA 4FJCA 1WEWA 3DQVR 3ZVZB 3O33A 1WEEA 2ECTA 2YSMA 2KWOA 2LQ6A 1WGMA 2K4DA 5B79A 2YHOA 4AUQB 3DPLR 4WZ2A 3LRQA 2LGVA 2KWNA 4PPEA 2OXQC 1WEUA 3V43A 2L0BA 3KQIA 4NN2A 2L80A 2H0DA 2G45A 4V3KC 4TKPB 1WEQA 2LGKA 2LN0A 4LJNA 5D1KB 2MA5A 1MM3A 2VPGA 4ZUXU 3NG2A 5G0FA 5LKZA 2JMJA 2Y1NA 2L5UA 2M3HA 4MVTA 4W4UA 4YBTA 2QICA 4UI9B 3O34A 2M85A 1WENA 4A0CD 2LRIC 2CKLB 1WFKA 2VJFA 4P5OB 1FBVA 1G25A 4GNEA 2MD7B 5B76A 4R8PK 2L75A 4R7EA 3C5KA 5LCWB 3ZVYA 4N4FA 2KWJA 3VK6A 2KYUA 3O37A 3M62A 4F52B 5B77A 2E6SA 5B78A 3ZTGA 4CA1A 2MUMA 3I2DA 5H9MA 2VPBA 4BHWA 2JMDA 2CSYA 3N9PA 2D8SA 1WEVA 3LQJA 2NAAA 2XEUA 5H1UA 4V3LC 3ZYQA 5KH9A 2UZGA 2IDAA 2VJFB 1HYJA 3LQIA 3SOWA 1WE9A 2PUYA 4XI1A 5FEYA 2KIZA 1E4UA 4X3GA 2CT2A 4ZQLA 3QZVA 3N9NA 2F6NA 3ZPV1 1ZBDB 2E6RA 3C6WA 5TABA 2MIQA 2CKLA 4YABA 3PUQA 2HDPA 1Z60A 4YBSA 2DX8A 4Q6FA 4I7BA 4YADA 4GNGA 2F6JA 2KFTA 1WEPA 4B7YC 3PURA 2M1RA 4YBMA 2YYRA 4LK9A 5I3LA 2YT5A 3L11A 1WIMA 4I7DA 3FL2A 2FSAA 2VPEA 3HTKC 2K16A 1FP0A 1WESA 2KR4A 3PHDA 4I7CA 4L7XA 4LKAA 2ECVA 4UP5A 3RPGB 3SOXA 4A4BA 2HYED 3RPGC 1XWHA 3L1XA 4L58A 4FK5A 3N9QA 2XB1A 1K2FA 2BAYA 1V87A 3IHPA 5FB1A 3N9LA 3EB6A 5D1LB 2H0DB 5C13A 1BORA 5B8DA 5KH7A 4CCGX 3KNVA 2YUCA 5AIUA 2L43A 2YURA 2LXPC 1VD4A 2KGIA 2G43A 1X4JA 2LGGA 2I50A 4PTBA 2ECIA 2ECGA 2RI7A 2K1JA 4AVXA 3O36A 1RMDA 2M6MA 1JM7B 5LKTA 3U5PA 2EA6A 3N9OA 1F62A 3HCTA 4MSXA 2KREA 2JMIA 5H1VA 1IYMA 3SOUA 5EYAF 2RSDA 1VFYA 3O7AA 4O64A 3L1ZB 1WEOA 2QJ0A 5FERA 2MNYA 4B86C 4GNDA 1JM7A
chains in the Genus database with same CATH superfamily
1Z2QA 3N9MA 2KU3A 4WZ3B 3SUBA 3DDTA 2LGLA 4QF3A 2Y1MA 5D1MB 2YW8A 2Y43A 5J3XA 4QQ4A 2KKXA 3MHSA 2LDRA 3RTRB 2MD8C 2G6QA 4YC9A 4AYCA 3GV4A 2VPDA 2VNFA 4S3OB 2JRJA 1N87A 3U5OA 4C9ZA 2ZETC 3FEHA 2IQJA 2EGPA 2F42A 5FB0A 1LDJB 1LDKC 2YQLA 4LADB 2MNZA 3EB5A 3LVRE 3O47A 5H1TA 4A4CA 4WA6A 1U6GB 3M99A 3T6RA 5TBNA 4N3WA 1CHCA 4LLBA 2C2VS 3ZPVE 1JOCA 2YHNA 2C2LA 3HCUA 4ZDTA 2K17A 4A49A 5DKAA 4S3OC 5JG6A 4AP4A 4GNFA 1Z6UA 1MBMA 3KV6A 3GL6A 5KH3A 2LV9A 4O62A 2VJEA 5AITA 3KV5A 5LKXA 1T1HA 4UP0A 5G04B 1DVPA 1WILA 3U5MA 4IC3A 4AYCB 3ZNIA 2EODA 2FUIA 2KWKA 3ASLA 5TDWA 2LXHC 1HYIA 1X4UA 3LJUX 4R2YA 1VYXA 3O35A 2VJEB 2MT5A 2AN6A 4BBQA 2ECWA 3M63A 5G05B 4Z0RA 3T7LA 2XOZA 2YREA 2ECNA 2ECJA 1WEMA 2OWAA 3SHBA 5LKUA 3U5NA 2KE1A 5TRBA 4IC2A 4QF2A 2QIZA 3HCSA 2YSJA 2FUUA 4WZ0A 1X4IA 5C11A 5DINA 2YU4A 2CSZA 4FIPA 3MHHA 3LQHA 4YAXA 5TDRA 2MKEA 2KKYA 2KGGA 4YATA 2PNXA 4GB0A 1MM2A 2VP7A 5B75A 4FO9A 2MA6A 3O70A 2YQMA 4FJCA 1WEWA 3DQVR 3ZVZB 2JM3A 1WEEA 3O33A 2ECTA 2YSMA 2KWOA 2LQ6A 1WGMA 2K4DA 5B79A 2YHOA 4AUQB 3DPLR 3FM8C 4WZ2A 3LRQA 2FD4A 2LGVA 2KWNA 4PPEA 2OXQC 1WEUA 3V43A 2L0BA 3KQIA 4NN2A 5SVYA 2L80A 2H0DA 2G45A 2DJAA 4V3KC 4TKPB 1WEQA 2LGKA 2LN0A 4LJNA 5D1KB 2MA5A 1MM3A 2VPGA 3M7KA 4ZUXU 3NG2A 5G0FA 5LKZA 2JMJA 2Y1NA 2L5UA 2CRRA 2M3HA 4MVTA 4W4UA 4YBTA 2QICA 4UI9B 3O34A 2M85A 1WENA 2YVRA 4A0CD 3JUEA 2EGMA 2LRIC 4OGEA 2CKLB 1WFKA 2VJFA 4P5OB 1FBVA 1G25A 4GNEA 2MD7B 5B76A 4R8PK 2L75A 4R7EA 3C5KA 5LCWB 3ZVYA 4N4FA 2KWJA 3VK6A 2KYUA 2P57A 3O37A 2FFWA 3M62A 4F52B 2B0OE 5B77A 2M13A 2E6SA 5B78A 3ZTGA 4CA1A 2MUMA 3I2DA 2CRWA 5H9MA 2VPBA 4BHWA 2JMDA 1DCQA 3FAOA 3LVQE 2CSYA 3N9PA 2D8SA 1WEVA 3T9KA 3LQJA 2NAAA 2XEUA 2E61A 5H1UA 4V3LC 5SVIB 3ZYQA 3DWDA 3PLWA 5KH9A 2UZGA 5SVXA 2IDAA 2VJFB 1HYJA 3LQIA 3SOWA 2XP0A 1WE9A 2DSMA 3LDYA 2PUYA 4XI1A 5FEYA 2KIZA 1E4UA 4X3GA 2CT2A 4ZQLA 3QZVA 3N9NA 2F6NA 3ZPV1 1ZBDB 2E6RA 3C6WA 4H9DA 5TABA 2MIQA 2CKLA 4YABA 3PUQA 2HDPA 1Z60A 3FJUB 4YBSA 2DX8A 4Q6FA 3FANA 4I7BA 4YADA 4GNGA 2F6JA 2KFTA 1WEPA 4B7YC 3PURA 2M1RA 4YBMA 2YYRA 4LK9A 5I3LA 3MDBC 2YT5A 3L11A 1WIMA 4I7DA 3FL2A 2FSAA 2VPEA 3HTKC 2K16A 2CONA 4Z0OA 1FP0A 1WESA 2KR4A 3PHDA 4I7CA 4L7XA 4LKAA 2ECVA 4UP5A 3RPGB 3SOXA 4A4BA 2HYED 3RPGC 5SVIA 1XWHA 2L7PA 3L1XA 4L58A 2XOCA 4FK5A 3N9QA 2XB1A 1K2FA 2BAYA 1V87A 3IHPA 2EXUA 5FB1A 3N9LA 3EB6A 2CSVA 5D1LB 2H0DB 5C13A 1BORA 3H7HA 5B8DA 5KH7A 4CCGX 3KNVA 2YUCA 5AIUA 2L43A 2YURA 3E2DA 2JUNA 2LXPC 1VD4A 2KGIA 2G43A 1X4JA 2LGGA 2I50A 4PTBA 2ECIA 2ECGA 2RI7A 2K1JA 4AVXA 3O36A 1RMDA 2M6MA 1JM7B 5LKTA 3U5PA 2EA6A 2D8UA 3N9OA 1F62A 3HCTA 4MSXA 2KREA 3Q1DA 5K3QA 2XOYA 2JMIA 5H1VA 1IYMA 3SOUA 5EYAF 2LAUA 2RSDA 1VFYA 4OGCA 3O7AA 4O64A 3L1ZB 1WEOA 2QJ0A 2RR4A 5FERA 4F1PA 2MNYA 4B86C 4GNDA 3KDEC 1JM7A
chains in the Genus database with same CATH topology
1Z2QA 3N9MA 2KU3A 4WZ3B 2LGLA 4QF3A 2Y1MA 5D1MB 2YW8A 2Y43A 5J3XA 3MHSA 2LDRA 3RTRB 2MD8C 2G6QA 4YC9A 4AYCA 3GV4A 2VPDA 2VNFA 4S3OB 2JRJA 1N87A 3U5OA 4C9ZA 2ZETC 2EGPA 2F42A 5FB0A 1LDJB 1LDKC 2YQLA 4LADB 2MNZA 3EB5A 5H1TA 4A4CA 4WA6A 1U6GB 3M99A 3T6RA 5TBNA 4N3WA 1CHCA 4LLBA 2C2VS 3ZPVE 1JOCA 2YHNA 2C2LA 3HCUA 4ZDTA 2K17A 4A49A 5DKAA 4S3OC 5JG6A 4AP4A 1Z6UA 4GNFA 3KV6A 3GL6A 5KH3A 2LV9A 2VJEA 5AITA 3KV5A 5LKXA 1T1HA 4UP0A 5G04B 1DVPA 1WILA 3U5MA 4IC3A 4AYCB 3ZNIA 2EODA 2FUIA 2KWKA 3ASLA 5TDWA 2LXHC 1HYIA 1X4UA 4R2YA 1VYXA 3O35A 2VJEB 2MT5A 2AN6A 4BBQA 2ECWA 3M63A 5G05B 3T7LA 2YREA 2ECNA 1WEMA 2ECJA 3SHBA 5LKUA 3U5NA 2KE1A 5TRBA 4IC2A 4QF2A 2QIZA 3HCSA 2YSJA 2FUUA 4WZ0A 1X4IA 5C11A 5DINA 2YU4A 2CSZA 4FIPA 3MHHA 3LQHA 4YAXA 5TDRA 2KGGA 4YATA 2PNXA 4GB0A 1MM2A 2VP7A 5B75A 4FO9A 2MA6A 3O70A 2YQMA 4FJCA 1WEWA 3DQVR 3ZVZB 3O33A 1WEEA 2ECTA 2YSMA 2KWOA 2LQ6A 1WGMA 2K4DA 5B79A 2YHOA 4AUQB 3DPLR 4WZ2A 3LRQA 2LGVA 2KWNA 4PPEA 2OXQC 1WEUA 3V43A 2L0BA 3KQIA 4NN2A 2L80A 2H0DA 2G45A 4V3KC 4TKPB 1WEQA 2LGKA 2LN0A 4LJNA 5D1KB 2MA5A 1MM3A 2VPGA 4ZUXU 3NG2A 5G0FA 5LKZA 2JMJA 2Y1NA 2L5UA 2M3HA 4MVTA 4W4UA 4YBTA 2QICA 4UI9B 3O34A 2M85A 1WENA 4A0CD 2LRIC 2CKLB 1WFKA 2VJFA 4P5OB 1FBVA 1G25A 4GNEA 2MD7B 5B76A 4R8PK 2L75A 4R7EA 3C5KA 5LCWB 3ZVYA 4N4FA 2KWJA 3VK6A 2KYUA 3O37A 3M62A 4F52B 5B77A 2E6SA 5B78A 3ZTGA 4CA1A 2MUMA 3I2DA 5H9MA 2VPBA 4BHWA 2JMDA 2CSYA 3N9PA 2D8SA 1WEVA 3LQJA 2NAAA 2XEUA 5H1UA 4V3LC 3ZYQA 5KH9A 2UZGA 2IDAA 2VJFB 1HYJA 3LQIA 3SOWA 1WE9A 2PUYA 4XI1A 5FEYA 2KIZA 1E4UA 4X3GA 2CT2A 4ZQLA 3QZVA 3N9NA 2F6NA 3ZPV1 1ZBDB 2E6RA 3C6WA 5TABA 2MIQA 2CKLA 4YABA 3PUQA 2HDPA 1Z60A 4YBSA 2DX8A 4Q6FA 4I7BA 4YADA 4GNGA 2F6JA 2KFTA 1WEPA 4B7YC 3PURA 2M1RA 4YBMA 2YYRA 4LK9A 5I3LA 2YT5A 3L11A 1WIMA 4I7DA 3FL2A 2FSAA 2VPEA 3HTKC 2K16A 1FP0A 1WESA 2KR4A 3PHDA 4I7CA 4L7XA 4LKAA 2ECVA 4UP5A 3RPGB 3SOXA 4A4BA 2HYED 3RPGC 1XWHA 3L1XA 4L58A 4FK5A 3N9QA 2XB1A 1K2FA 2BAYA 1V87A 3IHPA 5FB1A 3N9LA 3EB6A 5D1LB 2H0DB 5C13A 1BORA 5B8DA 5KH7A 4CCGX 3KNVA 2YUCA 5AIUA 2L43A 2YURA 2LXPC 1VD4A 2KGIA 2G43A 1X4JA 2LGGA 2I50A 4PTBA 2ECIA 2ECGA 2RI7A 2K1JA 4AVXA 3O36A 1RMDA 2M6MA 1JM7B 5LKTA 3U5PA 2EA6A 3N9OA 1F62A 3HCTA 4MSXA 2KREA 2JMIA 5H1VA 1IYMA 3SOUA 5EYAF 2RSDA 1VFYA 3O7AA 4O64A 3L1ZB 1WEOA 2QJ0A 5FERA 2MNYA 4B86C 4GNDA 1JM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2Q A;  3N9M A;  2KU3 A;  4WZ3 B;  2LGL A;  4QF3 A;  2Y1M A;  5D1M B;  2YW8 A;  2Y43 A;  5J3X A;  3MHS A;  2LDR A;  3RTR B;  2MD8 C;  2G6Q A;  4YC9 A;  4AYC A;  3GV4 A;  2VPD A;  2VNF A;  4S3O B;  2JRJ A;  1N87 A;  3U5O A;  4C9Z A;  2ZET C;  2EGP A;  2F42 A;  5FB0 A;  1LDJ B;  1LDK C;  2YQL A;  4LAD B;  2MNZ A;  3EB5 A;  5H1T A;  4A4C A;  4WA6 A;  1U6G B;  3M99 A;  3T6R A;  5TBN A;  4N3W A;  1CHC A;  4LLB A;  2C2V S;  3ZPV E;  1JOC A;  2YHN A;  2C2L A;  3HCU A;  4ZDT A;  2K17 A;  4A49 A;  5DKA A;  4S3O C;  5JG6 A;  4AP4 A;  1Z6U A;  4GNF A;  3KV6 A;  3GL6 A;  5KH3 A;  2LV9 A;  2VJE A;  5AIT A;  3KV5 A;  5LKX A;  1T1H A;  4UP0 A;  5G04 B;  1DVP A;  1WIL A;  3U5M A;  4IC3 A;  4AYC B;  3ZNI A;  2EOD A;  2FUI A;  2KWK A;  3ASL A;  5TDW A;  2LXH C;  1HYI A;  1X4U A;  4R2Y A;  1VYX A;  3O35 A;  2VJE B;  2MT5 A;  2AN6 A;  4BBQ A;  2ECW A;  3M63 A;  5G05 B;  3T7L A;  2YRE A;  2ECN A;  1WEM A;  2ECJ A;  3SHB A;  5LKU A;  3U5N A;  2KE1 A;  5TRB A;  4IC2 A;  4QF2 A;  2QIZ A;  3HCS A;  2YSJ A;  2FUU A;  4WZ0 A;  1X4I A;  5C11 A;  5DIN A;  2YU4 A;  2CSZ A;  4FIP A;  3MHH A;  3LQH A;  4YAX A;  5TDR A;  2KGG A;  4YAT A;  2PNX A;  4GB0 A;  1MM2 A;  2VP7 A;  5B75 A;  4FO9 A;  2MA6 A;  3O70 A;  2YQM A;  4FJC A;  1WEW A;  3DQV R;  3ZVZ B;  3O33 A;  1WEE A;  2ECT A;  2YSM A;  2KWO A;  2LQ6 A;  1WGM A;  2K4D A;  5B79 A;  2YHO A;  4AUQ B;  3DPL R;  4WZ2 A;  3LRQ A;  2LGV A;  2KWN A;  4PPE A;  2OXQ C;  1WEU A;  3V43 A;  2L0B A;  3KQI A;  4NN2 A;  2L80 A;  2H0D A;  2G45 A;  4V3K C;  4TKP B;  1WEQ A;  2LGK A;  2LN0 A;  4LJN A;  5D1K B;  2MA5 A;  1MM3 A;  2VPG A;  4ZUX U;  3NG2 A;  5G0F A;  5LKZ A;  2JMJ A;  2Y1N A;  2L5U A;  2M3H A;  4MVT A;  4W4U A;  4YBT A;  2QIC A;  4UI9 B;  3O34 A;  2M85 A;  1WEN A;  4A0C D;  2LRI C;  2CKL B;  1WFK A;  2VJF A;  4P5O B;  1FBV A;  1G25 A;  4GNE A;  2MD7 B;  5B76 A;  4R8P K;  2L75 A;  4R7E A;  3C5K A;  5LCW B;  3ZVY A;  4N4F A;  2KWJ A;  3VK6 A;  2KYU A;  3O37 A;  3M62 A;  4F52 B;  5B77 A;  2E6S A;  5B78 A;  3ZTG A;  4CA1 A;  2MUM A;  3I2D A;  5H9M A;  2VPB A;  4BHW A;  2JMD A;  2CSY A;  3N9P A;  2D8S A;  1WEV A;  3LQJ A;  2NAA A;  2XEU A;  5H1U A;  4V3L C;  3ZYQ A;  5KH9 A;  2UZG A;  2IDA A;  2VJF B;  1HYJ A;  3LQI A;  3SOW A;  1WE9 A;  2PUY A;  4XI1 A;  5FEY A;  2KIZ A;  1E4U A;  4X3G A;  2CT2 A;  4ZQL A;  3QZV A;  3N9N A;  2F6N A;  3ZPV 1;  1ZBD B;  2E6R A;  3C6W A;  5TAB A;  2MIQ A;  2CKL A;  4YAB A;  3PUQ A;  2HDP A;  1Z60 A;  4YBS A;  2DX8 A;  4Q6F A;  4I7B A;  4YAD A;  4GNG A;  2F6J A;  2KFT A;  1WEP A;  4B7Y C;  3PUR A;  2M1R A;  4YBM A;  2YYR A;  4LK9 A;  5I3L A;  2YT5 A;  3L11 A;  1WIM A;  4I7D A;  3FL2 A;  2FSA A;  2VPE A;  3HTK C;  2K16 A;  1FP0 A;  1WES A;  2KR4 A;  3PHD A;  4I7C A;  4L7X A;  4LKA A;  2ECV A;  4UP5 A;  3RPG B;  3SOX A;  4A4B A;  2HYE D;  3RPG C;  1XWH A;  3L1X A;  4L58 A;  4FK5 A;  3N9Q A;  2XB1 A;  1K2F A;  2BAY A;  1V87 A;  3IHP A;  5FB1 A;  3N9L A;  3EB6 A;  5D1L B;  2H0D B;  5C13 A;  1BOR A;  5B8D A;  5KH7 A;  4CCG X;  3KNV A;  2YUC A;  5AIU A;  2L43 A;  2YUR A;  2LXP C;  1VD4 A;  2KGI A;  2G43 A;  1X4J A;  2LGG A;  2I50 A;  4PTB A;  2ECI A;  2ECG A;  2RI7 A;  2K1J A;  4AVX A;  3O36 A;  1RMD A;  2M6M A;  1JM7 B;  5LKT A;  3U5P A;  2EA6 A;  3N9O A;  1F62 A;  3HCT A;  4MSX A;  2KRE A;  2JMI A;  5H1V A;  1IYM A;  3SOU A;  5EYA F;  2RSD A;  1VFY A;  3O7A A;  4O64 A;  3L1Z B;  1WEO A;  2QJ0 A;  5FER A;  2MNY A;  4B86 C;  4GND A;  1JM7 A; 
#chains in the Genus database with same CATH topology
 1Z2Q A;  3N9M A;  2KU3 A;  4WZ3 B;  3SUB A;  3DDT A;  2LGL A;  4QF3 A;  2Y1M A;  5D1M B;  2YW8 A;  2Y43 A;  5J3X A;  4QQ4 A;  2KKX A;  3MHS A;  2LDR A;  3RTR B;  2MD8 C;  2G6Q A;  4YC9 A;  4AYC A;  3GV4 A;  2VPD A;  2VNF A;  4S3O B;  2JRJ A;  1N87 A;  3U5O A;  4C9Z A;  2ZET C;  3FEH A;  2IQJ A;  2EGP A;  2F42 A;  5FB0 A;  1LDJ B;  1LDK C;  2YQL A;  4LAD B;  2MNZ A;  3EB5 A;  3LVR E;  3O47 A;  5H1T A;  4A4C A;  4WA6 A;  1U6G B;  3M99 A;  3T6R A;  5TBN A;  4N3W A;  1CHC A;  4LLB A;  2C2V S;  3ZPV E;  1JOC A;  2YHN A;  2C2L A;  3HCU A;  4ZDT A;  2K17 A;  4A49 A;  5DKA A;  4S3O C;  5JG6 A;  4AP4 A;  4GNF A;  1Z6U A;  1MBM A;  3KV6 A;  3GL6 A;  5KH3 A;  2LV9 A;  4O62 A;  2VJE A;  5AIT A;  3KV5 A;  5LKX A;  1T1H A;  4UP0 A;  5G04 B;  1DVP A;  1WIL A;  3U5M A;  4IC3 A;  4AYC B;  3ZNI A;  2EOD A;  2FUI A;  2KWK A;  3ASL A;  5TDW A;  2LXH C;  1HYI A;  1X4U A;  3LJU X;  4R2Y A;  1VYX A;  3O35 A;  2VJE B;  2MT5 A;  2AN6 A;  4BBQ A;  2ECW A;  3M63 A;  5G05 B;  4Z0R A;  3T7L A;  2XOZ A;  2YRE A;  2ECN A;  2ECJ A;  1WEM A;  2OWA A;  3SHB A;  5LKU A;  3U5N A;  2KE1 A;  5TRB A;  4IC2 A;  4QF2 A;  2QIZ A;  3HCS A;  2YSJ A;  2FUU A;  4WZ0 A;  1X4I A;  5C11 A;  5DIN A;  2YU4 A;  2CSZ A;  4FIP A;  3MHH A;  3LQH A;  4YAX A;  5TDR A;  2MKE A;  2KKY A;  2KGG A;  4YAT A;  2PNX A;  4GB0 A;  1MM2 A;  2VP7 A;  5B75 A;  4FO9 A;  2MA6 A;  3O70 A;  2YQM A;  4FJC A;  1WEW A;  3DQV R;  3ZVZ B;  2JM3 A;  1WEE A;  3O33 A;  2ECT A;  2YSM A;  2KWO A;  2LQ6 A;  1WGM A;  2K4D A;  5B79 A;  2YHO A;  4AUQ B;  3DPL R;  3FM8 C;  4WZ2 A;  3LRQ A;  2FD4 A;  2LGV A;  2KWN A;  4PPE A;  2OXQ C;  1WEU A;  3V43 A;  2L0B A;  3KQI A;  4NN2 A;  5SVY A;  2L80 A;  2H0D A;  2G45 A;  2DJA A;  4V3K C;  4TKP B;  1WEQ A;  2LGK A;  2LN0 A;  4LJN A;  5D1K B;  2MA5 A;  1MM3 A;  2VPG A;  3M7K A;  4ZUX U;  3NG2 A;  5G0F A;  5LKZ A;  2JMJ A;  2Y1N A;  2L5U A;  2CRR A;  2M3H A;  4MVT A;  4W4U A;  4YBT A;  2QIC A;  4UI9 B;  3O34 A;  2M85 A;  1WEN A;  2YVR A;  4A0C D;  3JUE A;  2EGM A;  2LRI C;  4OGE A;  2CKL B;  1WFK A;  2VJF A;  4P5O B;  1FBV A;  1G25 A;  4GNE A;  2MD7 B;  5B76 A;  4R8P K;  2L75 A;  4R7E A;  3C5K A;  5LCW B;  3ZVY A;  4N4F A;  2KWJ A;  3VK6 A;  2KYU A;  2P57 A;  3O37 A;  2FFW A;  3M62 A;  4F52 B;  2B0O E;  5B77 A;  2M13 A;  2E6S A;  5B78 A;  3ZTG A;  4CA1 A;  2MUM A;  3I2D A;  2CRW A;  5H9M A;  2VPB A;  4BHW A;  2JMD A;  1DCQ A;  3FAO A;  3LVQ E;  2CSY A;  3N9P A;  2D8S A;  1WEV A;  3T9K A;  3LQJ A;  2NAA A;  2XEU A;  2E61 A;  5H1U A;  4V3L C;  5SVI B;  3ZYQ A;  3DWD A;  3PLW A;  5KH9 A;  2UZG A;  5SVX A;  2IDA A;  2VJF B;  1HYJ A;  3LQI A;  3SOW A;  2XP0 A;  1WE9 A;  2DSM A;  3LDY A;  2PUY A;  4XI1 A;  5FEY A;  2KIZ A;  1E4U A;  4X3G A;  2CT2 A;  4ZQL A;  3QZV A;  3N9N A;  2F6N A;  3ZPV 1;  1ZBD B;  2E6R A;  3C6W A;  4H9D A;  5TAB A;  2MIQ A;  2CKL A;  4YAB A;  3PUQ A;  2HDP A;  1Z60 A;  3FJU B;  4YBS A;  2DX8 A;  4Q6F A;  3FAN A;  4I7B A;  4YAD A;  4GNG A;  2F6J A;  2KFT A;  1WEP A;  4B7Y C;  3PUR A;  2M1R A;  4YBM A;  2YYR A;  4LK9 A;  5I3L A;  3MDB C;  2YT5 A;  3L11 A;  1WIM A;  4I7D A;  3FL2 A;  2FSA A;  2VPE A;  3HTK C;  2K16 A;  2CON A;  4Z0O A;  1FP0 A;  1WES A;  2KR4 A;  3PHD A;  4I7C A;  4L7X A;  4LKA A;  2ECV A;  4UP5 A;  3RPG B;  3SOX A;  4A4B A;  2HYE D;  3RPG C;  5SVI A;  1XWH A;  2L7P A;  3L1X A;  4L58 A;  2XOC A;  4FK5 A;  3N9Q A;  2XB1 A;  1K2F A;  2BAY A;  1V87 A;  3IHP A;  2EXU A;  5FB1 A;  3N9L A;  3EB6 A;  2CSV A;  5D1L B;  2H0D B;  5C13 A;  1BOR A;  3H7H A;  5B8D A;  5KH7 A;  4CCG X;  3KNV A;  2YUC A;  5AIU A;  2L43 A;  2YUR A;  3E2D A;  2JUN A;  2LXP C;  1VD4 A;  2KGI A;  2G43 A;  1X4J A;  2LGG A;  2I50 A;  4PTB A;  2ECI A;  2ECG A;  2RI7 A;  2K1J A;  4AVX A;  3O36 A;  1RMD A;  2M6M A;  1JM7 B;  5LKT A;  3U5P A;  2EA6 A;  2D8U A;  3N9O A;  1F62 A;  3HCT A;  4MSX A;  2KRE A;  3Q1D A;  5K3Q A;  2XOY A;  2JMI A;  5H1V A;  1IYM A;  3SOU A;  5EYA F;  2LAU A;  2RSD A;  1VFY A;  4OGC A;  3O7A A;  4O64 A;  3L1Z B;  1WEO A;  2QJ0 A;  2RR4 A;  5FER A;  4F1P A;  2MNY A;  4B86 C;  4GND A;  3KDE C;  1JM7 A; 
#chains in the Genus database with same CATH homology
 1Z2Q A;  3N9M A;  2KU3 A;  4WZ3 B;  2LGL A;  4QF3 A;  2Y1M A;  5D1M B;  2YW8 A;  2Y43 A;  5J3X A;  3MHS A;  2LDR A;  3RTR B;  2MD8 C;  2G6Q A;  4YC9 A;  4AYC A;  3GV4 A;  2VPD A;  2VNF A;  4S3O B;  2JRJ A;  1N87 A;  3U5O A;  4C9Z A;  2ZET C;  2EGP A;  2F42 A;  5FB0 A;  1LDJ B;  1LDK C;  2YQL A;  4LAD B;  2MNZ A;  3EB5 A;  5H1T A;  4A4C A;  4WA6 A;  1U6G B;  3M99 A;  3T6R A;  5TBN A;  4N3W A;  1CHC A;  4LLB A;  2C2V S;  3ZPV E;  1JOC A;  2YHN A;  2C2L A;  3HCU A;  4ZDT A;  2K17 A;  4A49 A;  5DKA A;  4S3O C;  5JG6 A;  4AP4 A;  1Z6U A;  4GNF A;  3KV6 A;  3GL6 A;  5KH3 A;  2LV9 A;  2VJE A;  5AIT A;  3KV5 A;  5LKX A;  1T1H A;  4UP0 A;  5G04 B;  1DVP A;  1WIL A;  3U5M A;  4IC3 A;  4AYC B;  3ZNI A;  2EOD A;  2FUI A;  2KWK A;  3ASL A;  5TDW A;  2LXH C;  1HYI A;  1X4U A;  4R2Y A;  1VYX A;  3O35 A;  2VJE B;  2MT5 A;  2AN6 A;  4BBQ A;  2ECW A;  3M63 A;  5G05 B;  3T7L A;  2YRE A;  2ECN A;  1WEM A;  2ECJ A;  3SHB A;  5LKU A;  3U5N A;  2KE1 A;  5TRB A;  4IC2 A;  4QF2 A;  2QIZ A;  3HCS A;  2YSJ A;  2FUU A;  4WZ0 A;  1X4I A;  5C11 A;  5DIN A;  2YU4 A;  2CSZ A;  4FIP A;  3MHH A;  3LQH A;  4YAX A;  5TDR A;  2KGG A;  4YAT A;  2PNX A;  4GB0 A;  1MM2 A;  2VP7 A;  5B75 A;  4FO9 A;  2MA6 A;  3O70 A;  2YQM A;  4FJC A;  1WEW A;  3DQV R;  3ZVZ B;  3O33 A;  1WEE A;  2ECT A;  2YSM A;  2KWO A;  2LQ6 A;  1WGM A;  2K4D A;  5B79 A;  2YHO A;  4AUQ B;  3DPL R;  4WZ2 A;  3LRQ A;  2LGV A;  2KWN A;  4PPE A;  2OXQ C;  1WEU A;  3V43 A;  2L0B A;  3KQI A;  4NN2 A;  2L80 A;  2H0D A;  2G45 A;  4V3K C;  4TKP B;  1WEQ A;  2LGK A;  2LN0 A;  4LJN A;  5D1K B;  2MA5 A;  1MM3 A;  2VPG A;  4ZUX U;  3NG2 A;  5G0F A;  5LKZ A;  2JMJ A;  2Y1N A;  2L5U A;  2M3H A;  4MVT A;  4W4U A;  4YBT A;  2QIC A;  4UI9 B;  3O34 A;  2M85 A;  1WEN A;  4A0C D;  2LRI C;  2CKL B;  1WFK A;  2VJF A;  4P5O B;  1FBV A;  1G25 A;  4GNE A;  2MD7 B;  5B76 A;  4R8P K;  2L75 A;  4R7E A;  3C5K A;  5LCW B;  3ZVY A;  4N4F A;  2KWJ A;  3VK6 A;  2KYU A;  3O37 A;  3M62 A;  4F52 B;  5B77 A;  2E6S A;  5B78 A;  3ZTG A;  4CA1 A;  2MUM A;  3I2D A;  5H9M A;  2VPB A;  4BHW A;  2JMD A;  2CSY A;  3N9P A;  2D8S A;  1WEV A;  3LQJ A;  2NAA A;  2XEU A;  5H1U A;  4V3L C;  3ZYQ A;  5KH9 A;  2UZG A;  2IDA A;  2VJF B;  1HYJ A;  3LQI A;  3SOW A;  1WE9 A;  2PUY A;  4XI1 A;  5FEY A;  2KIZ A;  1E4U A;  4X3G A;  2CT2 A;  4ZQL A;  3QZV A;  3N9N A;  2F6N A;  3ZPV 1;  1ZBD B;  2E6R A;  3C6W A;  5TAB A;  2MIQ A;  2CKL A;  4YAB A;  3PUQ A;  2HDP A;  1Z60 A;  4YBS A;  2DX8 A;  4Q6F A;  4I7B A;  4YAD A;  4GNG A;  2F6J A;  2KFT A;  1WEP A;  4B7Y C;  3PUR A;  2M1R A;  4YBM A;  2YYR A;  4LK9 A;  5I3L A;  2YT5 A;  3L11 A;  1WIM A;  4I7D A;  3FL2 A;  2FSA A;  2VPE A;  3HTK C;  2K16 A;  1FP0 A;  1WES A;  2KR4 A;  3PHD A;  4I7C A;  4L7X A;  4LKA A;  2ECV A;  4UP5 A;  3RPG B;  3SOX A;  4A4B A;  2HYE D;  3RPG C;  1XWH A;  3L1X A;  4L58 A;  4FK5 A;  3N9Q A;  2XB1 A;  1K2F A;  2BAY A;  1V87 A;  3IHP A;  5FB1 A;  3N9L A;  3EB6 A;  5D1L B;  2H0D B;  5C13 A;  1BOR A;  5B8D A;  5KH7 A;  4CCG X;  3KNV A;  2YUC A;  5AIU A;  2L43 A;  2YUR A;  2LXP C;  1VD4 A;  2KGI A;  2G43 A;  1X4J A;  2LGG A;  2I50 A;  4PTB A;  2ECI A;  2ECG A;  2RI7 A;  2K1J A;  4AVX A;  3O36 A;  1RMD A;  2M6M A;  1JM7 B;  5LKT A;  3U5P A;  2EA6 A;  3N9O A;  1F62 A;  3HCT A;  4MSX A;  2KRE A;  2JMI A;  5H1V A;  1IYM A;  3SOU A;  5EYA F;  2RSD A;  1VFY A;  3O7A A;  4O64 A;  3L1Z B;  1WEO A;  2QJ0 A;  5FER A;  2MNY A;  4B86 C;  4GND A;  1JM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...