2YW8A

Crystal structure of human run and fyve domain-containing protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
KDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human RUN and FYVE domain-containing protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords RUN and FYVE domain-containing protein 1
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yw8A00
4YAXA 3KNVA 5H9MA 1WENA 4LADB 4TKPB 4WZ3B 1X4IA 3ZVZB 3QZVA 2EA6A 2CSYA 4YBTA 2MD8C 5KH3A 4W4UA 1V87A 1WEMA 3T6RA 2Y43A 3EB5A 3ASLA 3MHHA 2YHNA 5B8DA 1FBVA 1VD4A 1WEVA 4V3KC 4LK9A 2ECGA 3HCTA 2JMDA 2MNZA 3GL6A 4AYCB 2YYRA 2MUMA 2PUYA 2JMIA 4S3OB 3HCUA 3SOWA 5TDWA 3LQHA 2UZGA 5C11A 3KV6A 2KIZA 3IHPA 1U6GB 4GNDA 4WZ2A 2BAYA 1FP0A 4QF3A 3SOUA 3N9QA 1JOCA 1E4UA 5LKTA 2K1JA 2KFTA 1MM3A 3N9OA 2ECIA 4IC2A 1WFKA 4GNFA 2RSDA 2YU4A 2LN0A 2CKLA 2VJFA 2KE1A 2M85A 5J3XA 2VPBA 3PUQA 2FUUA 4AYCA 1WEUA 2QJ0A 2VPGA 2MD7B 4A0CD 2D8SA 5DKAA 1K2FA 4O64A 5LCWB 3GV4A 1CHCA 1JM7B 5LKUA 4GB0A 2HDPA 1Z60A 3O34A 1MM2A 2C2VS 2YQMA 1ZBDB 4YBMA 2K4DA 2M6MA 1HYIA 5D1KB 3EB6A 2I50A 4BHWA 4S3OC 4PTBA 4YABA 2DX8A 5C13A 2L5UA 3HCSA 5B75A 2L75A 4R7EA 2HYED 5FB0A 2LQ6A 3M62A 5D1MB 3DQVR 3RPGC 2PNXA 4A4BA 2MA6A 4FJCA 2KU3A 2KGIA 2IDAA 2VJFB 2YSJA 4ZQLA 1LDKC 3U5OA 4WZ0A 4B7YC 2CSZA 5H1VA 3SHBA 2L0BA 1N87A 4YBSA 2FSAA 1JM7A 4P5OB 5G05B 4N3WA 4FO9A 2H0DB 3M63A 5TABA 2G43A 1WILA 5AIUA 3PURA 5KH7A 2YREA 3O35A 1G25A 2Y1MA 4AVXA 3ZPV1 1WIMA 3T7LA 2YSMA 1IYMA 3LQIA 3ZTGA 1DVPA 4R8PK 4GNEA 2H0DA 3U5NA 4LLBA 2RI7A 5G0FA 5FB1A 2VNFA 3O7AA 2MNYA 2LRIC 3N9PA 4AP4A 2LDRA 3FL2A 2YW8A 4L7XA 5B78A 5D1LB 2G6QA 4ZUXU 2E6SA 5FERA 2LGGA 3NG2A 3ZNIA 2VPDA 2KR4A 3LQJA 4F52B 3PHDA 3L11A 4ZDTA 2YHOA 2ECWA 3ZVYA 3ZYQA 5AITA 4YC9A 4A4CA 3U5PA 1X4UA 2VJEB 3C6WA 2KWNA 4UP5A 2JRJA 3L1XA 5TDRA 2KWOA 3MHSA 2L43A 4B86C 2MIQA 1LDJB 3U5MA 4A49A 5H1UA 1Z6UA 4CA1A 2XB1A 3ZPVE 2C2LA 4L58A 5B79A 2YQLA 4LJNA 2KGGA 2F6NA 4R2YA 4IC3A 2ZETC 4PPEA 3DPLR 2LGLA 1F62A 2YURA 1HYJA 3O36A 4QF2A 2ECNA 2ECTA 5LKZA 1X4JA 5B77A 4FIPA 2ECJA 1WGMA 2XEUA 2MT5A 2KWJA 4GNGA 5LKXA 2FUIA 2CT2A 2LV9A 2Y1NA 4YATA 3I2DA 4X3GA 3VK6A 2LXHC 1WE9A 2F6JA 5EYAF 1VYXA 2NAAA 4XI1A 3RPGB 5JG6A 3KV5A 4YADA 4AUQB 1WEWA 4UP0A 1WESA 2M1RA 2VJEA 2LGVA 5TBNA 4V3LC 2MA5A 4NN2A 4I7CA 4CCGX 3SOXA 1RMDA 4I7BA 4I7DA 2YT5A 2KWKA 4N4FA 4UI9B 4LKAA 2F42A 3N9NA 2OXQC 2JMJA 3N9LA 4WA6A 1WEQA 2M3HA 2K16A 2ECVA 2KYUA 1BORA 2QIZA 3V43A 3O70A 2KREA 1WEPA 2QICA 1XWHA 3C5KA 2K17A 2G45A 5B76A 2EODA 3O33A 2AN6A 5TRBA 4MVTA 2L80A 3KQIA 1VFYA 3O37A 2LXPC 4BBQA 2YUCA 2LGKA 5I3LA 1T1HA 5KH9A 4C9ZA 2VPEA 4MSXA 3RTRB 1Z2QA 1WEEA 2EGPA 1WEOA 3HTKC 2E6RA 4Q6FA 5DINA 4FK5A 2VP7A 3N9MA 5G04B 5H1TA 5FEYA 3M99A 2CKLB 3LRQA 3L1ZB
chains in the Genus database with same CATH superfamily
2LAUA 4YAXA 3KNVA 5H9MA 1WENA 4LADB 4TKPB 4WZ3B 1X4IA 3ZVZB 3QZVA 2EA6A 4OGEA 2CSYA 4YBTA 2B0OE 4Z0OA 2MD8C 5KH3A 4W4UA 1V87A 1WEMA 3T6RA 2Y43A 2FD4A 3EB5A 3ASLA 3MHHA 2YHNA 5B8DA 3JUEA 1FBVA 1VD4A 1WEVA 4V3KC 4LK9A 2ECGA 3HCTA 2JMDA 2MNZA 3GL6A 4AYCB 2E61A 2YYRA 2MUMA 2PUYA 2JMIA 4S3OB 3HCUA 3SOWA 2CONA 3LVRE 5TDWA 3KDEC 3LQHA 2UZGA 5C11A 3KV6A 2KIZA 3IHPA 2L7PA 1U6GB 4GNDA 4WZ2A 2BAYA 1FP0A 4QF3A 3SOUA 3N9QA 1JOCA 3LDYA 1E4UA 2RR4A 5LKTA 2K1JA 2KFTA 3SUBA 1MM3A 3N9OA 2ECIA 4IC2A 1WFKA 4GNFA 2RSDA 2YU4A 4F1PA 2XOYA 2LN0A 2CKLA 2VJFA 2KE1A 2M85A 5J3XA 2VPBA 3PUQA 2FUUA 4AYCA 1WEUA 2QJ0A 2VPGA 2MD7B 4A0CD 2D8SA 4QQ4A 5DKAA 1K2FA 4O64A 5LCWB 3GV4A 1CHCA 1JM7B 5LKUA 4GB0A 2HDPA 1Z60A 3O34A 1MM2A 2C2VS 2YQMA 1ZBDB 4YBMA 3LVQE 2K4DA 2M6MA 2EGMA 1HYIA 5D1KB 3EB6A 2FFWA 2I50A 4BHWA 4S3OC 4PTBA 4YABA 2DX8A 5C13A 2L5UA 3HCSA 5B75A 2L75A 4R7EA 2HYED 5FB0A 2LQ6A 3M62A 3PLWA 5D1MB 3DQVR 2OWAA 3RPGC 2PNXA 4A4BA 2MA6A 4FJCA 2KU3A 2KGIA 1MBMA 2IDAA 2VJFB 2JM3A 2YSJA 4ZQLA 1LDKC 3U5OA 4WZ0A 4B7YC 2CSZA 5H1VA 3SHBA 2L0BA 1N87A 4YBSA 3E2DA 2FSAA 1JM7A 4P5OB 5G05B 4N3WA 2M13A 4FO9A 2H0DB 3M63A 5K3QA 5TABA 3Q1DA 2G43A 1WILA 5AIUA 2CSVA 3PURA 5KH7A 2YREA 3O35A 2DSMA 2JUNA 1G25A 2Y1MA 4AVXA 3ZPV1 1WIMA 3T7LA 2YSMA 1IYMA 3LQIA 3ZTGA 1DVPA 2KKXA 4R8PK 4GNEA 2H0DA 3U5NA 4LLBA 2D8UA 2RI7A 5G0FA 5FB1A 2EXUA 2VNFA 3O7AA 2MNYA 3T9KA 2LRIC 3N9PA 4AP4A 2LDRA 3FL2A 2YW8A 4L7XA 5B78A 2CRWA 4H9DA 5D1LB 2G6QA 4ZUXU 2E6SA 5FERA 2LGGA 5SVXA 3NG2A 3ZNIA 2VPDA 2KR4A 3LQJA 3H7HA 4F52B 3PHDA 3L11A 4ZDTA 2YHOA 3FJUB 2ECWA 3ZVYA 3ZYQA 5AITA 4YC9A 4A4CA 3U5PA 1X4UA 2VJEB 2IQJA 3C6WA 4Z0RA 2KWNA 4UP5A 2KKYA 2JRJA 3L1XA 5TDRA 2KWOA 3MHSA 2L43A 4B86C 2MIQA 1LDJB 3U5MA 4A49A 5H1UA 4O62A 1Z6UA 4CA1A 2XB1A 1DCQA 3ZPVE 2C2LA 4L58A 5B79A 2YQLA 4LJNA 2KGGA 2F6NA 4R2YA 4IC3A 2ZETC 4PPEA 3DPLR 2LGLA 1F62A 2YURA 1HYJA 3O36A 4QF2A 2ECNA 2ECTA 5LKZA 1X4JA 5B77A 4FIPA 2ECJA 1WGMA 2XEUA 2MT5A 2KWJA 4GNGA 5LKXA 2CRRA 2FUIA 2CT2A 3MDBC 2XOCA 2LV9A 2Y1NA 4YATA 3I2DA 4X3GA 3FEHA 3VK6A 2MKEA 2LXHC 1WE9A 2F6JA 5EYAF 3DWDA 1VYXA 2NAAA 4XI1A 3RPGB 5JG6A 3KV5A 4YADA 2P57A 4AUQB 1WEWA 4UP0A 1WESA 2M1RA 2VJEA 2LGVA 5TBNA 4V3LC 2MA5A 4NN2A 3FANA 4I7CA 4CCGX 3O47A 3SOXA 1RMDA 4I7BA 4I7DA 5SVIB 2YT5A 4OGCA 2KWKA 4N4FA 3DDTA 4UI9B 3FM8C 2XOZA 4LKAA 2F42A 2YVRA 3N9NA 2OXQC 2JMJA 3N9LA 4WA6A 1WEQA 2M3HA 2K16A 2ECVA 2KYUA 3LJUX 2XP0A 1BORA 2QIZA 3V43A 3O70A 5SVIA 2KREA 1WEPA 2QICA 1XWHA 3C5KA 2K17A 2G45A 2DJAA 3M7KA 5B76A 2EODA 3O33A 2AN6A 5TRBA 4MVTA 2L80A 3KQIA 1VFYA 5SVYA 3O37A 2LXPC 4BBQA 2YUCA 2LGKA 3FAOA 5I3LA 1T1HA 5KH9A 4C9ZA 2VPEA 4MSXA 3RTRB 1Z2QA 1WEEA 2EGPA 1WEOA 3HTKC 2E6RA 4Q6FA 5DINA 4FK5A 2VP7A 3N9MA 5G04B 5H1TA 5FEYA 3M99A 2CKLB 3LRQA 3L1ZB
chains in the Genus database with same CATH topology
4YAXA 3KNVA 5H9MA 1WENA 4LADB 4TKPB 4WZ3B 1X4IA 3ZVZB 3QZVA 2EA6A 2CSYA 4YBTA 2MD8C 5KH3A 4W4UA 1V87A 1WEMA 3T6RA 2Y43A 3EB5A 3ASLA 3MHHA 2YHNA 5B8DA 1FBVA 1VD4A 1WEVA 4V3KC 4LK9A 2ECGA 3HCTA 2JMDA 2MNZA 3GL6A 4AYCB 2YYRA 2MUMA 2PUYA 2JMIA 4S3OB 3HCUA 3SOWA 5TDWA 3LQHA 2UZGA 5C11A 3KV6A 2KIZA 3IHPA 1U6GB 4GNDA 4WZ2A 2BAYA 1FP0A 4QF3A 3SOUA 3N9QA 1JOCA 1E4UA 5LKTA 2K1JA 2KFTA 1MM3A 3N9OA 2ECIA 4IC2A 1WFKA 4GNFA 2RSDA 2YU4A 2LN0A 2CKLA 2VJFA 2KE1A 2M85A 5J3XA 2VPBA 3PUQA 2FUUA 4AYCA 1WEUA 2QJ0A 2VPGA 2MD7B 4A0CD 2D8SA 5DKAA 1K2FA 4O64A 5LCWB 3GV4A 1CHCA 1JM7B 5LKUA 4GB0A 2HDPA 1Z60A 3O34A 1MM2A 2C2VS 2YQMA 1ZBDB 4YBMA 2K4DA 2M6MA 1HYIA 5D1KB 3EB6A 2I50A 4BHWA 4S3OC 4PTBA 4YABA 2DX8A 5C13A 2L5UA 3HCSA 5B75A 2L75A 4R7EA 2HYED 5FB0A 2LQ6A 3M62A 5D1MB 3DQVR 3RPGC 2PNXA 4A4BA 2MA6A 4FJCA 2KU3A 2KGIA 2IDAA 2VJFB 2YSJA 4ZQLA 1LDKC 3U5OA 4WZ0A 4B7YC 2CSZA 5H1VA 3SHBA 2L0BA 1N87A 4YBSA 2FSAA 1JM7A 4P5OB 5G05B 4N3WA 4FO9A 2H0DB 3M63A 5TABA 2G43A 1WILA 5AIUA 3PURA 5KH7A 2YREA 3O35A 1G25A 2Y1MA 4AVXA 3ZPV1 1WIMA 3T7LA 2YSMA 1IYMA 3LQIA 3ZTGA 1DVPA 4R8PK 4GNEA 2H0DA 3U5NA 4LLBA 2RI7A 5G0FA 5FB1A 2VNFA 3O7AA 2MNYA 2LRIC 3N9PA 4AP4A 2LDRA 3FL2A 2YW8A 4L7XA 5B78A 5D1LB 2G6QA 4ZUXU 2E6SA 5FERA 2LGGA 3NG2A 3ZNIA 2VPDA 2KR4A 3LQJA 4F52B 3PHDA 3L11A 4ZDTA 2YHOA 2ECWA 3ZVYA 3ZYQA 5AITA 4YC9A 4A4CA 3U5PA 1X4UA 2VJEB 3C6WA 2KWNA 4UP5A 2JRJA 3L1XA 5TDRA 2KWOA 3MHSA 2L43A 4B86C 2MIQA 1LDJB 3U5MA 4A49A 5H1UA 1Z6UA 4CA1A 2XB1A 3ZPVE 2C2LA 4L58A 5B79A 2YQLA 4LJNA 2KGGA 2F6NA 4R2YA 4IC3A 2ZETC 4PPEA 3DPLR 2LGLA 1F62A 2YURA 1HYJA 3O36A 4QF2A 2ECNA 2ECTA 5LKZA 1X4JA 5B77A 4FIPA 2ECJA 1WGMA 2XEUA 2MT5A 2KWJA 4GNGA 5LKXA 2FUIA 2CT2A 2LV9A 2Y1NA 4YATA 3I2DA 4X3GA 3VK6A 2LXHC 1WE9A 2F6JA 5EYAF 1VYXA 2NAAA 4XI1A 3RPGB 5JG6A 3KV5A 4YADA 4AUQB 1WEWA 4UP0A 1WESA 2M1RA 2VJEA 2LGVA 5TBNA 4V3LC 2MA5A 4NN2A 4I7CA 4CCGX 3SOXA 1RMDA 4I7BA 4I7DA 2YT5A 2KWKA 4N4FA 4UI9B 4LKAA 2F42A 3N9NA 2OXQC 2JMJA 3N9LA 4WA6A 1WEQA 2M3HA 2K16A 2ECVA 2KYUA 1BORA 2QIZA 3V43A 3O70A 2KREA 1WEPA 2QICA 1XWHA 3C5KA 2K17A 2G45A 5B76A 2EODA 3O33A 2AN6A 5TRBA 4MVTA 2L80A 3KQIA 1VFYA 3O37A 2LXPC 4BBQA 2YUCA 2LGKA 5I3LA 1T1HA 5KH9A 4C9ZA 2VPEA 4MSXA 3RTRB 1Z2QA 1WEEA 2EGPA 1WEOA 3HTKC 2E6RA 4Q6FA 5DINA 4FK5A 2VP7A 3N9MA 5G04B 5H1TA 5FEYA 3M99A 2CKLB 3LRQA 3L1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAX A;  3KNV A;  5H9M A;  1WEN A;  4LAD B;  4TKP B;  4WZ3 B;  1X4I A;  3ZVZ B;  3QZV A;  2EA6 A;  2CSY A;  4YBT A;  2MD8 C;  5KH3 A;  4W4U A;  1V87 A;  1WEM A;  3T6R A;  2Y43 A;  3EB5 A;  3ASL A;  3MHH A;  2YHN A;  5B8D A;  1FBV A;  1VD4 A;  1WEV A;  4V3K C;  4LK9 A;  2ECG A;  3HCT A;  2JMD A;  2MNZ A;  3GL6 A;  4AYC B;  2YYR A;  2MUM A;  2PUY A;  2JMI A;  4S3O B;  3HCU A;  3SOW A;  5TDW A;  3LQH A;  2UZG A;  5C11 A;  3KV6 A;  2KIZ A;  3IHP A;  1U6G B;  4GND A;  4WZ2 A;  2BAY A;  1FP0 A;  4QF3 A;  3SOU A;  3N9Q A;  1JOC A;  1E4U A;  5LKT A;  2K1J A;  2KFT A;  1MM3 A;  3N9O A;  2ECI A;  4IC2 A;  1WFK A;  4GNF A;  2RSD A;  2YU4 A;  2LN0 A;  2CKL A;  2VJF A;  2KE1 A;  2M85 A;  5J3X A;  2VPB A;  3PUQ A;  2FUU A;  4AYC A;  1WEU A;  2QJ0 A;  2VPG A;  2MD7 B;  4A0C D;  2D8S A;  5DKA A;  1K2F A;  4O64 A;  5LCW B;  3GV4 A;  1CHC A;  1JM7 B;  5LKU A;  4GB0 A;  2HDP A;  1Z60 A;  3O34 A;  1MM2 A;  2C2V S;  2YQM A;  1ZBD B;  4YBM A;  2K4D A;  2M6M A;  1HYI A;  5D1K B;  3EB6 A;  2I50 A;  4BHW A;  4S3O C;  4PTB A;  4YAB A;  2DX8 A;  5C13 A;  2L5U A;  3HCS A;  5B75 A;  2L75 A;  4R7E A;  2HYE D;  5FB0 A;  2LQ6 A;  3M62 A;  5D1M B;  3DQV R;  3RPG C;  2PNX A;  4A4B A;  2MA6 A;  4FJC A;  2KU3 A;  2KGI A;  2IDA A;  2VJF B;  2YSJ A;  4ZQL A;  1LDK C;  3U5O A;  4WZ0 A;  4B7Y C;  2CSZ A;  5H1V A;  3SHB A;  2L0B A;  1N87 A;  4YBS A;  2FSA A;  1JM7 A;  4P5O B;  5G05 B;  4N3W A;  4FO9 A;  2H0D B;  3M63 A;  5TAB A;  2G43 A;  1WIL A;  5AIU A;  3PUR A;  5KH7 A;  2YRE A;  3O35 A;  1G25 A;  2Y1M A;  4AVX A;  3ZPV 1;  1WIM A;  3T7L A;  2YSM A;  1IYM A;  3LQI A;  3ZTG A;  1DVP A;  4R8P K;  4GNE A;  2H0D A;  3U5N A;  4LLB A;  2RI7 A;  5G0F A;  5FB1 A;  2VNF A;  3O7A A;  2MNY A;  2LRI C;  3N9P A;  4AP4 A;  2LDR A;  3FL2 A;  2YW8 A;  4L7X A;  5B78 A;  5D1L B;  2G6Q A;  4ZUX U;  2E6S A;  5FER A;  2LGG A;  3NG2 A;  3ZNI A;  2VPD A;  2KR4 A;  3LQJ A;  4F52 B;  3PHD A;  3L11 A;  4ZDT A;  2YHO A;  2ECW A;  3ZVY A;  3ZYQ A;  5AIT A;  4YC9 A;  4A4C A;  3U5P A;  1X4U A;  2VJE B;  3C6W A;  2KWN A;  4UP5 A;  2JRJ A;  3L1X A;  5TDR A;  2KWO A;  3MHS A;  2L43 A;  4B86 C;  2MIQ A;  1LDJ B;  3U5M A;  4A49 A;  5H1U A;  1Z6U A;  4CA1 A;  2XB1 A;  3ZPV E;  2C2L A;  4L58 A;  5B79 A;  2YQL A;  4LJN A;  2KGG A;  2F6N A;  4R2Y A;  4IC3 A;  2ZET C;  4PPE A;  3DPL R;  2LGL A;  1F62 A;  2YUR A;  1HYJ A;  3O36 A;  4QF2 A;  2ECN A;  2ECT A;  5LKZ A;  1X4J A;  5B77 A;  4FIP A;  2ECJ A;  1WGM A;  2XEU A;  2MT5 A;  2KWJ A;  4GNG A;  5LKX A;  2FUI A;  2CT2 A;  2LV9 A;  2Y1N A;  4YAT A;  3I2D A;  4X3G A;  3VK6 A;  2LXH C;  1WE9 A;  2F6J A;  5EYA F;  1VYX A;  2NAA A;  4XI1 A;  3RPG B;  5JG6 A;  3KV5 A;  4YAD A;  4AUQ B;  1WEW A;  4UP0 A;  1WES A;  2M1R A;  2VJE A;  2LGV A;  5TBN A;  4V3L C;  2MA5 A;  4NN2 A;  4I7C A;  4CCG X;  3SOX A;  1RMD A;  4I7B A;  4I7D A;  2YT5 A;  2KWK A;  4N4F A;  4UI9 B;  4LKA A;  2F42 A;  3N9N A;  2OXQ C;  2JMJ A;  3N9L A;  4WA6 A;  1WEQ A;  2M3H A;  2K16 A;  2ECV A;  2KYU A;  1BOR A;  2QIZ A;  3V43 A;  3O70 A;  2KRE A;  1WEP A;  2QIC A;  1XWH A;  3C5K A;  2K17 A;  2G45 A;  5B76 A;  2EOD A;  3O33 A;  2AN6 A;  5TRB A;  4MVT A;  2L80 A;  3KQI A;  1VFY A;  3O37 A;  2LXP C;  4BBQ A;  2YUC A;  2LGK A;  5I3L A;  1T1H A;  5KH9 A;  4C9Z A;  2VPE A;  4MSX A;  3RTR B;  1Z2Q A;  1WEE A;  2EGP A;  1WEO A;  3HTK C;  2E6R A;  4Q6F A;  5DIN A;  4FK5 A;  2VP7 A;  3N9M A;  5G04 B;  5H1T A;  5FEY A;  3M99 A;  2CKL B;  3LRQ A;  3L1Z B; 
#chains in the Genus database with same CATH topology
 2LAU A;  4YAX A;  3KNV A;  5H9M A;  1WEN A;  4LAD B;  4TKP B;  4WZ3 B;  1X4I A;  3ZVZ B;  3QZV A;  2EA6 A;  4OGE A;  2CSY A;  4YBT A;  2B0O E;  4Z0O A;  2MD8 C;  5KH3 A;  4W4U A;  1V87 A;  1WEM A;  3T6R A;  2Y43 A;  2FD4 A;  3EB5 A;  3ASL A;  3MHH A;  2YHN A;  5B8D A;  3JUE A;  1FBV A;  1VD4 A;  1WEV A;  4V3K C;  4LK9 A;  2ECG A;  3HCT A;  2JMD A;  2MNZ A;  3GL6 A;  4AYC B;  2E61 A;  2YYR A;  2MUM A;  2PUY A;  2JMI A;  4S3O B;  3HCU A;  3SOW A;  2CON A;  3LVR E;  5TDW A;  3KDE C;  3LQH A;  2UZG A;  5C11 A;  3KV6 A;  2KIZ A;  3IHP A;  2L7P A;  1U6G B;  4GND A;  4WZ2 A;  2BAY A;  1FP0 A;  4QF3 A;  3SOU A;  3N9Q A;  1JOC A;  3LDY A;  1E4U A;  2RR4 A;  5LKT A;  2K1J A;  2KFT A;  3SUB A;  1MM3 A;  3N9O A;  2ECI A;  4IC2 A;  1WFK A;  4GNF A;  2RSD A;  2YU4 A;  4F1P A;  2XOY A;  2LN0 A;  2CKL A;  2VJF A;  2KE1 A;  2M85 A;  5J3X A;  2VPB A;  3PUQ A;  2FUU A;  4AYC A;  1WEU A;  2QJ0 A;  2VPG A;  2MD7 B;  4A0C D;  2D8S A;  4QQ4 A;  5DKA A;  1K2F A;  4O64 A;  5LCW B;  3GV4 A;  1CHC A;  1JM7 B;  5LKU A;  4GB0 A;  2HDP A;  1Z60 A;  3O34 A;  1MM2 A;  2C2V S;  2YQM A;  1ZBD B;  4YBM A;  3LVQ E;  2K4D A;  2M6M A;  2EGM A;  1HYI A;  5D1K B;  3EB6 A;  2FFW A;  2I50 A;  4BHW A;  4S3O C;  4PTB A;  4YAB A;  2DX8 A;  5C13 A;  2L5U A;  3HCS A;  5B75 A;  2L75 A;  4R7E A;  2HYE D;  5FB0 A;  2LQ6 A;  3M62 A;  3PLW A;  5D1M B;  3DQV R;  2OWA A;  3RPG C;  2PNX A;  4A4B A;  2MA6 A;  4FJC A;  2KU3 A;  2KGI A;  1MBM A;  2IDA A;  2VJF B;  2JM3 A;  2YSJ A;  4ZQL A;  1LDK C;  3U5O A;  4WZ0 A;  4B7Y C;  2CSZ A;  5H1V A;  3SHB A;  2L0B A;  1N87 A;  4YBS A;  3E2D A;  2FSA A;  1JM7 A;  4P5O B;  5G05 B;  4N3W A;  2M13 A;  4FO9 A;  2H0D B;  3M63 A;  5K3Q A;  5TAB A;  3Q1D A;  2G43 A;  1WIL A;  5AIU A;  2CSV A;  3PUR A;  5KH7 A;  2YRE A;  3O35 A;  2DSM A;  2JUN A;  1G25 A;  2Y1M A;  4AVX A;  3ZPV 1;  1WIM A;  3T7L A;  2YSM A;  1IYM A;  3LQI A;  3ZTG A;  1DVP A;  2KKX A;  4R8P K;  4GNE A;  2H0D A;  3U5N A;  4LLB A;  2D8U A;  2RI7 A;  5G0F A;  5FB1 A;  2EXU A;  2VNF A;  3O7A A;  2MNY A;  3T9K A;  2LRI C;  3N9P A;  4AP4 A;  2LDR A;  3FL2 A;  2YW8 A;  4L7X A;  5B78 A;  2CRW A;  4H9D A;  5D1L B;  2G6Q A;  4ZUX U;  2E6S A;  5FER A;  2LGG A;  5SVX A;  3NG2 A;  3ZNI A;  2VPD A;  2KR4 A;  3LQJ A;  3H7H A;  4F52 B;  3PHD A;  3L11 A;  4ZDT A;  2YHO A;  3FJU B;  2ECW A;  3ZVY A;  3ZYQ A;  5AIT A;  4YC9 A;  4A4C A;  3U5P A;  1X4U A;  2VJE B;  2IQJ A;  3C6W A;  4Z0R A;  2KWN A;  4UP5 A;  2KKY A;  2JRJ A;  3L1X A;  5TDR A;  2KWO A;  3MHS A;  2L43 A;  4B86 C;  2MIQ A;  1LDJ B;  3U5M A;  4A49 A;  5H1U A;  4O62 A;  1Z6U A;  4CA1 A;  2XB1 A;  1DCQ A;  3ZPV E;  2C2L A;  4L58 A;  5B79 A;  2YQL A;  4LJN A;  2KGG A;  2F6N A;  4R2Y A;  4IC3 A;  2ZET C;  4PPE A;  3DPL R;  2LGL A;  1F62 A;  2YUR A;  1HYJ A;  3O36 A;  4QF2 A;  2ECN A;  2ECT A;  5LKZ A;  1X4J A;  5B77 A;  4FIP A;  2ECJ A;  1WGM A;  2XEU A;  2MT5 A;  2KWJ A;  4GNG A;  5LKX A;  2CRR A;  2FUI A;  2CT2 A;  3MDB C;  2XOC A;  2LV9 A;  2Y1N A;  4YAT A;  3I2D A;  4X3G A;  3FEH A;  3VK6 A;  2MKE A;  2LXH C;  1WE9 A;  2F6J A;  5EYA F;  3DWD A;  1VYX A;  2NAA A;  4XI1 A;  3RPG B;  5JG6 A;  3KV5 A;  4YAD A;  2P57 A;  4AUQ B;  1WEW A;  4UP0 A;  1WES A;  2M1R A;  2VJE A;  2LGV A;  5TBN A;  4V3L C;  2MA5 A;  4NN2 A;  3FAN A;  4I7C A;  4CCG X;  3O47 A;  3SOX A;  1RMD A;  4I7B A;  4I7D A;  5SVI B;  2YT5 A;  4OGC A;  2KWK A;  4N4F A;  3DDT A;  4UI9 B;  3FM8 C;  2XOZ A;  4LKA A;  2F42 A;  2YVR A;  3N9N A;  2OXQ C;  2JMJ A;  3N9L A;  4WA6 A;  1WEQ A;  2M3H A;  2K16 A;  2ECV A;  2KYU A;  3LJU X;  2XP0 A;  1BOR A;  2QIZ A;  3V43 A;  3O70 A;  5SVI A;  2KRE A;  1WEP A;  2QIC A;  1XWH A;  3C5K A;  2K17 A;  2G45 A;  2DJA A;  3M7K A;  5B76 A;  2EOD A;  3O33 A;  2AN6 A;  5TRB A;  4MVT A;  2L80 A;  3KQI A;  1VFY A;  5SVY A;  3O37 A;  2LXP C;  4BBQ A;  2YUC A;  2LGK A;  3FAO A;  5I3L A;  1T1H A;  5KH9 A;  4C9Z A;  2VPE A;  4MSX A;  3RTR B;  1Z2Q A;  1WEE A;  2EGP A;  1WEO A;  3HTK C;  2E6R A;  4Q6F A;  5DIN A;  4FK5 A;  2VP7 A;  3N9M A;  5G04 B;  5H1T A;  5FEY A;  3M99 A;  2CKL B;  3LRQ A;  3L1Z B; 
#chains in the Genus database with same CATH homology
 4YAX A;  3KNV A;  5H9M A;  1WEN A;  4LAD B;  4TKP B;  4WZ3 B;  1X4I A;  3ZVZ B;  3QZV A;  2EA6 A;  2CSY A;  4YBT A;  2MD8 C;  5KH3 A;  4W4U A;  1V87 A;  1WEM A;  3T6R A;  2Y43 A;  3EB5 A;  3ASL A;  3MHH A;  2YHN A;  5B8D A;  1FBV A;  1VD4 A;  1WEV A;  4V3K C;  4LK9 A;  2ECG A;  3HCT A;  2JMD A;  2MNZ A;  3GL6 A;  4AYC B;  2YYR A;  2MUM A;  2PUY A;  2JMI A;  4S3O B;  3HCU A;  3SOW A;  5TDW A;  3LQH A;  2UZG A;  5C11 A;  3KV6 A;  2KIZ A;  3IHP A;  1U6G B;  4GND A;  4WZ2 A;  2BAY A;  1FP0 A;  4QF3 A;  3SOU A;  3N9Q A;  1JOC A;  1E4U A;  5LKT A;  2K1J A;  2KFT A;  1MM3 A;  3N9O A;  2ECI A;  4IC2 A;  1WFK A;  4GNF A;  2RSD A;  2YU4 A;  2LN0 A;  2CKL A;  2VJF A;  2KE1 A;  2M85 A;  5J3X A;  2VPB A;  3PUQ A;  2FUU A;  4AYC A;  1WEU A;  2QJ0 A;  2VPG A;  2MD7 B;  4A0C D;  2D8S A;  5DKA A;  1K2F A;  4O64 A;  5LCW B;  3GV4 A;  1CHC A;  1JM7 B;  5LKU A;  4GB0 A;  2HDP A;  1Z60 A;  3O34 A;  1MM2 A;  2C2V S;  2YQM A;  1ZBD B;  4YBM A;  2K4D A;  2M6M A;  1HYI A;  5D1K B;  3EB6 A;  2I50 A;  4BHW A;  4S3O C;  4PTB A;  4YAB A;  2DX8 A;  5C13 A;  2L5U A;  3HCS A;  5B75 A;  2L75 A;  4R7E A;  2HYE D;  5FB0 A;  2LQ6 A;  3M62 A;  5D1M B;  3DQV R;  3RPG C;  2PNX A;  4A4B A;  2MA6 A;  4FJC A;  2KU3 A;  2KGI A;  2IDA A;  2VJF B;  2YSJ A;  4ZQL A;  1LDK C;  3U5O A;  4WZ0 A;  4B7Y C;  2CSZ A;  5H1V A;  3SHB A;  2L0B A;  1N87 A;  4YBS A;  2FSA A;  1JM7 A;  4P5O B;  5G05 B;  4N3W A;  4FO9 A;  2H0D B;  3M63 A;  5TAB A;  2G43 A;  1WIL A;  5AIU A;  3PUR A;  5KH7 A;  2YRE A;  3O35 A;  1G25 A;  2Y1M A;  4AVX A;  3ZPV 1;  1WIM A;  3T7L A;  2YSM A;  1IYM A;  3LQI A;  3ZTG A;  1DVP A;  4R8P K;  4GNE A;  2H0D A;  3U5N A;  4LLB A;  2RI7 A;  5G0F A;  5FB1 A;  2VNF A;  3O7A A;  2MNY A;  2LRI C;  3N9P A;  4AP4 A;  2LDR A;  3FL2 A;  2YW8 A;  4L7X A;  5B78 A;  5D1L B;  2G6Q A;  4ZUX U;  2E6S A;  5FER A;  2LGG A;  3NG2 A;  3ZNI A;  2VPD A;  2KR4 A;  3LQJ A;  4F52 B;  3PHD A;  3L11 A;  4ZDT A;  2YHO A;  2ECW A;  3ZVY A;  3ZYQ A;  5AIT A;  4YC9 A;  4A4C A;  3U5P A;  1X4U A;  2VJE B;  3C6W A;  2KWN A;  4UP5 A;  2JRJ A;  3L1X A;  5TDR A;  2KWO A;  3MHS A;  2L43 A;  4B86 C;  2MIQ A;  1LDJ B;  3U5M A;  4A49 A;  5H1U A;  1Z6U A;  4CA1 A;  2XB1 A;  3ZPV E;  2C2L A;  4L58 A;  5B79 A;  2YQL A;  4LJN A;  2KGG A;  2F6N A;  4R2Y A;  4IC3 A;  2ZET C;  4PPE A;  3DPL R;  2LGL A;  1F62 A;  2YUR A;  1HYJ A;  3O36 A;  4QF2 A;  2ECN A;  2ECT A;  5LKZ A;  1X4J A;  5B77 A;  4FIP A;  2ECJ A;  1WGM A;  2XEU A;  2MT5 A;  2KWJ A;  4GNG A;  5LKX A;  2FUI A;  2CT2 A;  2LV9 A;  2Y1N A;  4YAT A;  3I2D A;  4X3G A;  3VK6 A;  2LXH C;  1WE9 A;  2F6J A;  5EYA F;  1VYX A;  2NAA A;  4XI1 A;  3RPG B;  5JG6 A;  3KV5 A;  4YAD A;  4AUQ B;  1WEW A;  4UP0 A;  1WES A;  2M1R A;  2VJE A;  2LGV A;  5TBN A;  4V3L C;  2MA5 A;  4NN2 A;  4I7C A;  4CCG X;  3SOX A;  1RMD A;  4I7B A;  4I7D A;  2YT5 A;  2KWK A;  4N4F A;  4UI9 B;  4LKA A;  2F42 A;  3N9N A;  2OXQ C;  2JMJ A;  3N9L A;  4WA6 A;  1WEQ A;  2M3H A;  2K16 A;  2ECV A;  2KYU A;  1BOR A;  2QIZ A;  3V43 A;  3O70 A;  2KRE A;  1WEP A;  2QIC A;  1XWH A;  3C5K A;  2K17 A;  2G45 A;  5B76 A;  2EOD A;  3O33 A;  2AN6 A;  5TRB A;  4MVT A;  2L80 A;  3KQI A;  1VFY A;  3O37 A;  2LXP C;  4BBQ A;  2YUC A;  2LGK A;  5I3L A;  1T1H A;  5KH9 A;  4C9Z A;  2VPE A;  4MSX A;  3RTR B;  1Z2Q A;  1WEE A;  2EGP A;  1WEO A;  3HTK C;  2E6R A;  4Q6F A;  5DIN A;  4FK5 A;  2VP7 A;  3N9M A;  5G04 B;  5H1T A;  5FEY A;  3M99 A;  2CKL B;  3LRQ A;  3L1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...