2YW8A

Crystal structure of human run and fyve domain-containing protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
KDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human RUN and FYVE domain-containing protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords RUN and FYVE domain-containing protein 1
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yw8A00
4X3GA 1HYJA 4GNGA 5G04B 4FO9A 4CCGX 4I7BA 2VP7A 2MNYA 4LKAA 3DPLR 2ECIA 1MM2A 5H9MA 5B78A 2VJFB 2EA6A 3C6WA 5D1LB 2JMJA 3IHPA 4O64A 4PTBA 3T6RA 4AVXA 2JMDA 5I3LA 5KH7A 4PPEA 2XB1A 3N9OA 2CT2A 4ZQLA 1Z60A 3PURA 2BAYA 3SOXA 2F42A 2VPGA 2YT5A 4A0CD 4ZUXU 5DKAA 1VD4A 5DINA 2KU3A 2YW8A 3KQIA 2I50A 1WENA 2LGLA 4YADA 3SHBA 1WIMA 2LRIC 3N9MA 2JRJA 3SOWA 1U6GB 2LV9A 5D1KB 1G25A 3RPGC 3HCSA 2F6NA 2VJEA 1Z2QA 2YREA 2F6JA 2Y43A 3O34A 1WFKA 3LQHA 2KFTA 2YUCA 3U5MA 1DVPA 3ZTGA 2KGGA 1K2FA 2EODA 3ZVYA 2KWJA 3M63A 3RPGB 1LDKC 2KYUA 2YQMA 3N9LA 2HYED 2KGIA 1Z6UA 2CSYA 5KH3A 5B77A 4GB0A 5B75A 5AIUA 1LDJB 3MHSA 3HCTA 2KR4A 4FIPA 2LGKA 2UZGA 4ZDTA 5FB1A 2YYRA 4F52B 4R2YA 4YATA 1XWHA 4N4FA 2Y1MA 5LKUA 2H0DB 4QF2A 2YSMA 1F62A 1JM7A 4UI9B 1WGMA 2L80A 2KWKA 4IC2A 4XI1A 3U5NA 3O7AA 1WE9A 1WEEA 1WEPA 3O36A 2ECWA 1X4IA 2DX8A 2PUYA 3ASLA 5G05B 4BHWA 2EGPA 4Q6FA 3KV6A 5FB0A 3O35A 2QIZA 2MIQA 4B7YC 2ECGA 3NG2A 4UP5A 2CKLB 2VPBA 4IC3A 1CHCA 3VK6A 3O70A 2QJ0A 4LLBA 4I7DA 4UP0A 4S3OC 1WEVA 2M85A 3PHDA 3T7LA 3I2DA 3N9PA 5C13A 2M6MA 4WA6A 5AITA 3C5KA 4FK5A 5LCWB 2LXHC 2L43A 2RI7A 5G0FA 2KE1A 2ECVA 2KWNA 2L75A 1VYXA 3QZVA 3FL2A 2M3HA 3O33A 5B8DA 3KNVA 2Y1NA 2MUMA 4R8PK 2C2LA 2K17A 2CKLA 1WILA 2AN6A 4YBSA 2H0DA 2VPDA 4GNEA 3L1XA 2OXQC 3EB5A 1WEWA 1HYIA 2IDAA 5H1TA 2LGGA 4AP4A 5EYAF 5TDWA 1MM3A 4C9ZA 4GNFA 1WEUA 2K4DA 2YQLA 1FBVA 2L0BA 4WZ0A 1RMDA 2L5UA 3L1ZB 4LJNA 2ZETC 4L7XA 2K16A 2CSZA 2MD7B 2PNXA 5B79A 4S3OB 3LQJA 4NN2A 4LADB 2LGVA 2D8SA 1WESA 4TKPB 2ECNA 5H1VA 1JM7B 2NAAA 3U5OA 5JG6A 4MVTA 2VJEB 2RSDA 1E4UA 3ZPV1 4LK9A 3PUQA 5TBNA 3N9NA 2FSAA 2YURA 3M62A 4B86C 5FEYA 2YHOA 4L58A 3HCUA 2KWOA 2VJFA 3ZVZB 1V87A 5D1MB 1FP0A 1X4UA 3GL6A 4YAXA 3LRQA 2ECJA 4N3WA 2FUUA 4R7EA 3EB6A 4A4CA 4FJCA 1WEOA 5TDRA 4A49A 2KREA 3L11A 4WZ3B 2MNZA 4YABA 3LQIA 3M99A 2M1RA 2KIZA 2YHNA 1IYMA 3ZYQA 2ECTA 1WEQA 3V43A 4WZ2A 1T1HA 5KH9A 4YBTA 2E6SA 4AYCA 2K1JA 2XEUA 2G43A 4V3KC 5J3XA 2VPEA 2MA5A 2LXPC 1JOCA 1VFYA 3ZNIA 2LN0A 2MA6A 2YSJA 5H1UA 3HTKC 5LKTA 1ZBDB 2C2VS 2HDPA 2QICA 4QF3A 1X4JA 2VNFA 5LKXA 2LDRA 4P5OB 4V3LC 4AUQB 3N9QA 4AYCB 2LQ6A 5FERA 3RTRB 2E6RA 5LKZA 4GNDA 1BORA 5TABA 4YBMA 3SOUA 5C11A 2JMIA 1WEMA 3DQVR 3ZPVE 4CA1A 5B76A 2FUIA 3MHHA 4YC9A 4I7CA 4MSXA 2YU4A 3KV5A 3GV4A 3U5PA 3O37A 4A4BA 2G6QA 1N87A 2MT5A 2MD8C 4BBQA 4W4UA 2G45A 5TRBA
chains in the Genus database with same CATH superfamily
4X3GA 1HYJA 4GNGA 5G04B 2KKYA 4FO9A 2KKXA 4CCGX 2FFWA 4I7BA 2VP7A 2MNYA 4LKAA 3DPLR 2ECIA 1MM2A 5H9MA 5B78A 2VJFB 2EA6A 3C6WA 5D1LB 2JMJA 2IQJA 3IHPA 4O64A 4PTBA 3T6RA 4AVXA 2JMDA 5I3LA 5KH7A 4PPEA 2XB1A 3N9OA 2CT2A 2XOCA 4ZQLA 1Z60A 3PURA 2BAYA 3SOXA 2F42A 2P57A 2VPGA 2YT5A 4A0CD 4ZUXU 5DKAA 1VD4A 5DINA 2KU3A 2YW8A 3KQIA 2I50A 1WENA 5SVYA 2LGLA 4YADA 3SHBA 1WIMA 2LRIC 3N9MA 2E61A 2JRJA 3SOWA 2M13A 1U6GB 2LV9A 5D1KB 1G25A 3RPGC 3HCSA 2F6NA 2VJEA 1Z2QA 3LJUX 2YREA 2F6JA 2DJAA 2Y43A 3O34A 1WFKA 3LQHA 2KFTA 2YUCA 3U5MA 1DVPA 3ZTGA 2KGGA 2EODA 1K2FA 3ZVYA 2KWJA 2FD4A 3M63A 3RPGB 1LDKC 2KYUA 2YQMA 3N9LA 2HYED 2KGIA 2D8UA 1Z6UA 2CSYA 5KH3A 5B77A 4GB0A 5B75A 5AIUA 1LDJB 3MHSA 3HCTA 2KR4A 4FIPA 2LGKA 2XOYA 2UZGA 4ZDTA 2EXUA 5FB1A 2JUNA 2XP0A 2YYRA 4F52B 2DSMA 4R2YA 4YATA 1XWHA 4N4FA 2Y1MA 5LKUA 2H0DB 4QF2A 2YSMA 1F62A 1JM7A 4UI9B 1WGMA 2L80A 3JUEA 2KWKA 2YVRA 4IC2A 4XI1A 3U5NA 3O7AA 1WE9A 3T9KA 1WEEA 1WEPA 3O36A 2ECWA 1X4IA 2DX8A 2PUYA 5SVXA 3ASLA 2LAUA 5G05B 4BHWA 2EGPA 4Q6FA 3KV6A 5FB0A 3O35A 2QIZA 2MIQA 4B7YC 4Z0RA 2ECGA 3NG2A 4UP5A 2CKLB 2RR4A 2VPBA 3LVRE 4IC3A 3FJUB 3LDYA 1CHCA 3VK6A 3O70A 2QJ0A 4LLBA 4I7DA 4UP0A 4S3OC 1WEVA 2M85A 3SUBA 2MKEA 3PHDA 3T7LA 1MBMA 3I2DA 3N9PA 5C13A 2M6MA 4WA6A 5AITA 3C5KA 4FK5A 3LVQE 5LCWB 2LXHC 2L43A 2RI7A 5G0FA 2KE1A 2ECVA 2KWNA 2L75A 1VYXA 3QZVA 3FANA 3FL2A 2M3HA 3O33A 5B8DA 3KNVA 2Y1NA 2MUMA 4R8PK 2C2LA 2K17A 2CKLA 1WILA 2AN6A 4YBSA 3E2DA 4OGCA 2H0DA 2VPDA 4GNEA 3L1XA 2CONA 2OXQC 3EB5A 1WEWA 2L7PA 1HYIA 2EGMA 2CRWA 2IDAA 5H1TA 2LGGA 4AP4A 5EYAF 5TDWA 1MM3A 4C9ZA 4GNFA 3Q1DA 1WEUA 5SVIB 2K4DA 2YQLA 1FBVA 2L0BA 4WZ0A 1RMDA 2L5UA 3L1ZB 4LJNA 2ZETC 4L7XA 2K16A 2CSZA 2MD7B 2PNXA 5B79A 4S3OB 3LQJA 3PLWA 4LADB 4NN2A 2LGVA 2D8SA 1WESA 4TKPB 2ECNA 2XOZA 4F1PA 5H1VA 1JM7B 2NAAA 3U5OA 5JG6A 4MVTA 2VJEB 2RSDA 1E4UA 3ZPV1 4Z0OA 4LK9A 3PUQA 5TBNA 3N9NA 2FSAA 2YURA 3M62A 4B86C 5FEYA 3FM8C 2YHOA 4L58A 2JM3A 3HCUA 2KWOA 4H9DA 2VJFA 3ZVZB 1V87A 5D1MB 1FP0A 1X4UA 3GL6A 4YAXA 3O47A 3LRQA 2ECJA 4N3WA 2FUUA 4R7EA 3EB6A 4A4CA 4FJCA 1WEOA 5SVIA 5TDRA 4A49A 2KREA 3L11A 4WZ3B 2MNZA 5K3QA 3M7KA 4YABA 3LQIA 3FAOA 3M99A 2M1RA 3H7HA 2KIZA 2YHNA 1IYMA 3ZYQA 2ECTA 1WEQA 3V43A 1DCQA 4WZ2A 1T1HA 2OWAA 5KH9A 4YBTA 2E6SA 4AYCA 2K1JA 2XEUA 2G43A 4QQ4A 4O62A 4V3KC 5J3XA 2VPEA 2MA5A 2LXPC 1JOCA 1VFYA 3ZNIA 2LN0A 2MA6A 2YSJA 5H1UA 3HTKC 5LKTA 1ZBDB 2C2VS 2HDPA 3FEHA 2QICA 4QF3A 1X4JA 2VNFA 5LKXA 2LDRA 4P5OB 4V3LC 4AUQB 3N9QA 4AYCB 2LQ6A 5FERA 3RTRB 2E6RA 2CRRA 5LKZA 4GNDA 1BORA 5TABA 4YBMA 3SOUA 5C11A 2JMIA 1WEMA 3DQVR 3KDEC 4OGEA 3ZPVE 4CA1A 5B76A 2FUIA 3MHHA 4YC9A 3MDBC 4I7CA 4MSXA 2CSVA 2YU4A 3KV5A 3GV4A 3U5PA 3O37A 1N87A 2B0OE 2G6QA 4A4BA 2MT5A 3DDTA 3DWDA 2MD8C 4BBQA 4W4UA 2G45A 5TRBA
chains in the Genus database with same CATH topology
4X3GA 1HYJA 4GNGA 5G04B 4FO9A 4CCGX 4I7BA 2VP7A 2MNYA 4LKAA 3DPLR 2ECIA 1MM2A 5H9MA 5B78A 2VJFB 2EA6A 3C6WA 5D1LB 2JMJA 3IHPA 4O64A 4PTBA 3T6RA 4AVXA 2JMDA 5I3LA 5KH7A 4PPEA 2XB1A 3N9OA 2CT2A 4ZQLA 1Z60A 3PURA 2BAYA 3SOXA 2F42A 2VPGA 2YT5A 4A0CD 4ZUXU 5DKAA 1VD4A 5DINA 2KU3A 2YW8A 3KQIA 2I50A 1WENA 2LGLA 4YADA 3SHBA 1WIMA 2LRIC 3N9MA 2JRJA 3SOWA 1U6GB 2LV9A 5D1KB 1G25A 3RPGC 3HCSA 2F6NA 2VJEA 1Z2QA 2YREA 2F6JA 2Y43A 3O34A 1WFKA 3LQHA 2KFTA 2YUCA 3U5MA 1DVPA 3ZTGA 2KGGA 1K2FA 2EODA 3ZVYA 2KWJA 3M63A 3RPGB 1LDKC 2KYUA 2YQMA 3N9LA 2HYED 2KGIA 1Z6UA 2CSYA 5KH3A 5B77A 4GB0A 5B75A 5AIUA 1LDJB 3MHSA 3HCTA 2KR4A 4FIPA 2LGKA 2UZGA 4ZDTA 5FB1A 2YYRA 4F52B 4R2YA 4YATA 1XWHA 4N4FA 2Y1MA 5LKUA 2H0DB 4QF2A 2YSMA 1F62A 1JM7A 4UI9B 1WGMA 2L80A 2KWKA 4IC2A 4XI1A 3U5NA 3O7AA 1WE9A 1WEEA 1WEPA 3O36A 2ECWA 1X4IA 2DX8A 2PUYA 3ASLA 5G05B 4BHWA 2EGPA 4Q6FA 3KV6A 5FB0A 3O35A 2QIZA 2MIQA 4B7YC 2ECGA 3NG2A 4UP5A 2CKLB 2VPBA 4IC3A 1CHCA 3VK6A 3O70A 2QJ0A 4LLBA 4I7DA 4UP0A 4S3OC 1WEVA 2M85A 3PHDA 3T7LA 3I2DA 3N9PA 5C13A 2M6MA 4WA6A 5AITA 3C5KA 4FK5A 5LCWB 2LXHC 2L43A 2RI7A 5G0FA 2KE1A 2ECVA 2KWNA 2L75A 1VYXA 3QZVA 3FL2A 2M3HA 3O33A 5B8DA 3KNVA 2Y1NA 2MUMA 4R8PK 2C2LA 2K17A 2CKLA 1WILA 2AN6A 4YBSA 2H0DA 2VPDA 4GNEA 3L1XA 2OXQC 3EB5A 1WEWA 1HYIA 2IDAA 5H1TA 2LGGA 4AP4A 5EYAF 5TDWA 1MM3A 4C9ZA 4GNFA 1WEUA 2K4DA 2YQLA 1FBVA 2L0BA 4WZ0A 1RMDA 2L5UA 3L1ZB 4LJNA 2ZETC 4L7XA 2K16A 2CSZA 2MD7B 2PNXA 5B79A 4S3OB 3LQJA 4NN2A 4LADB 2LGVA 2D8SA 1WESA 4TKPB 2ECNA 5H1VA 1JM7B 2NAAA 3U5OA 5JG6A 4MVTA 2VJEB 2RSDA 1E4UA 3ZPV1 4LK9A 3PUQA 5TBNA 3N9NA 2FSAA 2YURA 3M62A 4B86C 5FEYA 2YHOA 4L58A 3HCUA 2KWOA 2VJFA 3ZVZB 1V87A 5D1MB 1FP0A 1X4UA 3GL6A 4YAXA 3LRQA 2ECJA 4N3WA 2FUUA 4R7EA 3EB6A 4A4CA 4FJCA 1WEOA 5TDRA 4A49A 2KREA 3L11A 4WZ3B 2MNZA 4YABA 3LQIA 3M99A 2M1RA 2KIZA 2YHNA 1IYMA 3ZYQA 2ECTA 1WEQA 3V43A 4WZ2A 1T1HA 5KH9A 4YBTA 2E6SA 4AYCA 2K1JA 2XEUA 2G43A 4V3KC 5J3XA 2VPEA 2MA5A 2LXPC 1JOCA 1VFYA 3ZNIA 2LN0A 2MA6A 2YSJA 5H1UA 3HTKC 5LKTA 1ZBDB 2C2VS 2HDPA 2QICA 4QF3A 1X4JA 2VNFA 5LKXA 2LDRA 4P5OB 4V3LC 4AUQB 3N9QA 4AYCB 2LQ6A 5FERA 3RTRB 2E6RA 5LKZA 4GNDA 1BORA 5TABA 4YBMA 3SOUA 5C11A 2JMIA 1WEMA 3DQVR 3ZPVE 4CA1A 5B76A 2FUIA 3MHHA 4YC9A 4I7CA 4MSXA 2YU4A 3KV5A 3GV4A 3U5PA 3O37A 4A4BA 2G6QA 1N87A 2MT5A 2MD8C 4BBQA 4W4UA 2G45A 5TRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3G A;  1HYJ A;  4GNG A;  5G04 B;  4FO9 A;  4CCG X;  4I7B A;  2VP7 A;  2MNY A;  4LKA A;  3DPL R;  2ECI A;  1MM2 A;  5H9M A;  5B78 A;  2VJF B;  2EA6 A;  3C6W A;  5D1L B;  2JMJ A;  3IHP A;  4O64 A;  4PTB A;  3T6R A;  4AVX A;  2JMD A;  5I3L A;  5KH7 A;  4PPE A;  2XB1 A;  3N9O A;  2CT2 A;  4ZQL A;  1Z60 A;  3PUR A;  2BAY A;  3SOX A;  2F42 A;  2VPG A;  2YT5 A;  4A0C D;  4ZUX U;  5DKA A;  1VD4 A;  5DIN A;  2KU3 A;  2YW8 A;  3KQI A;  2I50 A;  1WEN A;  2LGL A;  4YAD A;  3SHB A;  1WIM A;  2LRI C;  3N9M A;  2JRJ A;  3SOW A;  1U6G B;  2LV9 A;  5D1K B;  1G25 A;  3RPG C;  3HCS A;  2F6N A;  2VJE A;  1Z2Q A;  2YRE A;  2F6J A;  2Y43 A;  3O34 A;  1WFK A;  3LQH A;  2KFT A;  2YUC A;  3U5M A;  1DVP A;  3ZTG A;  2KGG A;  1K2F A;  2EOD A;  3ZVY A;  2KWJ A;  3M63 A;  3RPG B;  1LDK C;  2KYU A;  2YQM A;  3N9L A;  2HYE D;  2KGI A;  1Z6U A;  2CSY A;  5KH3 A;  5B77 A;  4GB0 A;  5B75 A;  5AIU A;  1LDJ B;  3MHS A;  3HCT A;  2KR4 A;  4FIP A;  2LGK A;  2UZG A;  4ZDT A;  5FB1 A;  2YYR A;  4F52 B;  4R2Y A;  4YAT A;  1XWH A;  4N4F A;  2Y1M A;  5LKU A;  2H0D B;  4QF2 A;  2YSM A;  1F62 A;  1JM7 A;  4UI9 B;  1WGM A;  2L80 A;  2KWK A;  4IC2 A;  4XI1 A;  3U5N A;  3O7A A;  1WE9 A;  1WEE A;  1WEP A;  3O36 A;  2ECW A;  1X4I A;  2DX8 A;  2PUY A;  3ASL A;  5G05 B;  4BHW A;  2EGP A;  4Q6F A;  3KV6 A;  5FB0 A;  3O35 A;  2QIZ A;  2MIQ A;  4B7Y C;  2ECG A;  3NG2 A;  4UP5 A;  2CKL B;  2VPB A;  4IC3 A;  1CHC A;  3VK6 A;  3O70 A;  2QJ0 A;  4LLB A;  4I7D A;  4UP0 A;  4S3O C;  1WEV A;  2M85 A;  3PHD A;  3T7L A;  3I2D A;  3N9P A;  5C13 A;  2M6M A;  4WA6 A;  5AIT A;  3C5K A;  4FK5 A;  5LCW B;  2LXH C;  2L43 A;  2RI7 A;  5G0F A;  2KE1 A;  2ECV A;  2KWN A;  2L75 A;  1VYX A;  3QZV A;  3FL2 A;  2M3H A;  3O33 A;  5B8D A;  3KNV A;  2Y1N A;  2MUM A;  4R8P K;  2C2L A;  2K17 A;  2CKL A;  1WIL A;  2AN6 A;  4YBS A;  2H0D A;  2VPD A;  4GNE A;  3L1X A;  2OXQ C;  3EB5 A;  1WEW A;  1HYI A;  2IDA A;  5H1T A;  2LGG A;  4AP4 A;  5EYA F;  5TDW A;  1MM3 A;  4C9Z A;  4GNF A;  1WEU A;  2K4D A;  2YQL A;  1FBV A;  2L0B A;  4WZ0 A;  1RMD A;  2L5U A;  3L1Z B;  4LJN A;  2ZET C;  4L7X A;  2K16 A;  2CSZ A;  2MD7 B;  2PNX A;  5B79 A;  4S3O B;  3LQJ A;  4NN2 A;  4LAD B;  2LGV A;  2D8S A;  1WES A;  4TKP B;  2ECN A;  5H1V A;  1JM7 B;  2NAA A;  3U5O A;  5JG6 A;  4MVT A;  2VJE B;  2RSD A;  1E4U A;  3ZPV 1;  4LK9 A;  3PUQ A;  5TBN A;  3N9N A;  2FSA A;  2YUR A;  3M62 A;  4B86 C;  5FEY A;  2YHO A;  4L58 A;  3HCU A;  2KWO A;  2VJF A;  3ZVZ B;  1V87 A;  5D1M B;  1FP0 A;  1X4U A;  3GL6 A;  4YAX A;  3LRQ A;  2ECJ A;  4N3W A;  2FUU A;  4R7E A;  3EB6 A;  4A4C A;  4FJC A;  1WEO A;  5TDR A;  4A49 A;  2KRE A;  3L11 A;  4WZ3 B;  2MNZ A;  4YAB A;  3LQI A;  3M99 A;  2M1R A;  2KIZ A;  2YHN A;  1IYM A;  3ZYQ A;  2ECT A;  1WEQ A;  3V43 A;  4WZ2 A;  1T1H A;  5KH9 A;  4YBT A;  2E6S A;  4AYC A;  2K1J A;  2XEU A;  2G43 A;  4V3K C;  5J3X A;  2VPE A;  2MA5 A;  2LXP C;  1JOC A;  1VFY A;  3ZNI A;  2LN0 A;  2MA6 A;  2YSJ A;  5H1U A;  3HTK C;  5LKT A;  1ZBD B;  2C2V S;  2HDP A;  2QIC A;  4QF3 A;  1X4J A;  2VNF A;  5LKX A;  2LDR A;  4P5O B;  4V3L C;  4AUQ B;  3N9Q A;  4AYC B;  2LQ6 A;  5FER A;  3RTR B;  2E6R A;  5LKZ A;  4GND A;  1BOR A;  5TAB A;  4YBM A;  3SOU A;  5C11 A;  2JMI A;  1WEM A;  3DQV R;  3ZPV E;  4CA1 A;  5B76 A;  2FUI A;  3MHH A;  4YC9 A;  4I7C A;  4MSX A;  2YU4 A;  3KV5 A;  3GV4 A;  3U5P A;  3O37 A;  4A4B A;  2G6Q A;  1N87 A;  2MT5 A;  2MD8 C;  4BBQ A;  4W4U A;  2G45 A;  5TRB A; 
#chains in the Genus database with same CATH topology
 4X3G A;  1HYJ A;  4GNG A;  5G04 B;  2KKY A;  4FO9 A;  2KKX A;  4CCG X;  2FFW A;  4I7B A;  2VP7 A;  2MNY A;  4LKA A;  3DPL R;  2ECI A;  1MM2 A;  5H9M A;  5B78 A;  2VJF B;  2EA6 A;  3C6W A;  5D1L B;  2JMJ A;  2IQJ A;  3IHP A;  4O64 A;  4PTB A;  3T6R A;  4AVX A;  2JMD A;  5I3L A;  5KH7 A;  4PPE A;  2XB1 A;  3N9O A;  2CT2 A;  2XOC A;  4ZQL A;  1Z60 A;  3PUR A;  2BAY A;  3SOX A;  2F42 A;  2P57 A;  2VPG A;  2YT5 A;  4A0C D;  4ZUX U;  5DKA A;  1VD4 A;  5DIN A;  2KU3 A;  2YW8 A;  3KQI A;  2I50 A;  1WEN A;  5SVY A;  2LGL A;  4YAD A;  3SHB A;  1WIM A;  2LRI C;  3N9M A;  2E61 A;  2JRJ A;  3SOW A;  2M13 A;  1U6G B;  2LV9 A;  5D1K B;  1G25 A;  3RPG C;  3HCS A;  2F6N A;  2VJE A;  1Z2Q A;  3LJU X;  2YRE A;  2F6J A;  2DJA A;  2Y43 A;  3O34 A;  1WFK A;  3LQH A;  2KFT A;  2YUC A;  3U5M A;  1DVP A;  3ZTG A;  2KGG A;  2EOD A;  1K2F A;  3ZVY A;  2KWJ A;  2FD4 A;  3M63 A;  3RPG B;  1LDK C;  2KYU A;  2YQM A;  3N9L A;  2HYE D;  2KGI A;  2D8U A;  1Z6U A;  2CSY A;  5KH3 A;  5B77 A;  4GB0 A;  5B75 A;  5AIU A;  1LDJ B;  3MHS A;  3HCT A;  2KR4 A;  4FIP A;  2LGK A;  2XOY A;  2UZG A;  4ZDT A;  2EXU A;  5FB1 A;  2JUN A;  2XP0 A;  2YYR A;  4F52 B;  2DSM A;  4R2Y A;  4YAT A;  1XWH A;  4N4F A;  2Y1M A;  5LKU A;  2H0D B;  4QF2 A;  2YSM A;  1F62 A;  1JM7 A;  4UI9 B;  1WGM A;  2L80 A;  3JUE A;  2KWK A;  2YVR A;  4IC2 A;  4XI1 A;  3U5N A;  3O7A A;  1WE9 A;  3T9K A;  1WEE A;  1WEP A;  3O36 A;  2ECW A;  1X4I A;  2DX8 A;  2PUY A;  5SVX A;  3ASL A;  2LAU A;  5G05 B;  4BHW A;  2EGP A;  4Q6F A;  3KV6 A;  5FB0 A;  3O35 A;  2QIZ A;  2MIQ A;  4B7Y C;  4Z0R A;  2ECG A;  3NG2 A;  4UP5 A;  2CKL B;  2RR4 A;  2VPB A;  3LVR E;  4IC3 A;  3FJU B;  3LDY A;  1CHC A;  3VK6 A;  3O70 A;  2QJ0 A;  4LLB A;  4I7D A;  4UP0 A;  4S3O C;  1WEV A;  2M85 A;  3SUB A;  2MKE A;  3PHD A;  3T7L A;  1MBM A;  3I2D A;  3N9P A;  5C13 A;  2M6M A;  4WA6 A;  5AIT A;  3C5K A;  4FK5 A;  3LVQ E;  5LCW B;  2LXH C;  2L43 A;  2RI7 A;  5G0F A;  2KE1 A;  2ECV A;  2KWN A;  2L75 A;  1VYX A;  3QZV A;  3FAN A;  3FL2 A;  2M3H A;  3O33 A;  5B8D A;  3KNV A;  2Y1N A;  2MUM A;  4R8P K;  2C2L A;  2K17 A;  2CKL A;  1WIL A;  2AN6 A;  4YBS A;  3E2D A;  4OGC A;  2H0D A;  2VPD A;  4GNE A;  3L1X A;  2CON A;  2OXQ C;  3EB5 A;  1WEW A;  2L7P A;  1HYI A;  2EGM A;  2CRW A;  2IDA A;  5H1T A;  2LGG A;  4AP4 A;  5EYA F;  5TDW A;  1MM3 A;  4C9Z A;  4GNF A;  3Q1D A;  1WEU A;  5SVI B;  2K4D A;  2YQL A;  1FBV A;  2L0B A;  4WZ0 A;  1RMD A;  2L5U A;  3L1Z B;  4LJN A;  2ZET C;  4L7X A;  2K16 A;  2CSZ A;  2MD7 B;  2PNX A;  5B79 A;  4S3O B;  3LQJ A;  3PLW A;  4LAD B;  4NN2 A;  2LGV A;  2D8S A;  1WES A;  4TKP B;  2ECN A;  2XOZ A;  4F1P A;  5H1V A;  1JM7 B;  2NAA A;  3U5O A;  5JG6 A;  4MVT A;  2VJE B;  2RSD A;  1E4U A;  3ZPV 1;  4Z0O A;  4LK9 A;  3PUQ A;  5TBN A;  3N9N A;  2FSA A;  2YUR A;  3M62 A;  4B86 C;  5FEY A;  3FM8 C;  2YHO A;  4L58 A;  2JM3 A;  3HCU A;  2KWO A;  4H9D A;  2VJF A;  3ZVZ B;  1V87 A;  5D1M B;  1FP0 A;  1X4U A;  3GL6 A;  4YAX A;  3O47 A;  3LRQ A;  2ECJ A;  4N3W A;  2FUU A;  4R7E A;  3EB6 A;  4A4C A;  4FJC A;  1WEO A;  5SVI A;  5TDR A;  4A49 A;  2KRE A;  3L11 A;  4WZ3 B;  2MNZ A;  5K3Q A;  3M7K A;  4YAB A;  3LQI A;  3FAO A;  3M99 A;  2M1R A;  3H7H A;  2KIZ A;  2YHN A;  1IYM A;  3ZYQ A;  2ECT A;  1WEQ A;  3V43 A;  1DCQ A;  4WZ2 A;  1T1H A;  2OWA A;  5KH9 A;  4YBT A;  2E6S A;  4AYC A;  2K1J A;  2XEU A;  2G43 A;  4QQ4 A;  4O62 A;  4V3K C;  5J3X A;  2VPE A;  2MA5 A;  2LXP C;  1JOC A;  1VFY A;  3ZNI A;  2LN0 A;  2MA6 A;  2YSJ A;  5H1U A;  3HTK C;  5LKT A;  1ZBD B;  2C2V S;  2HDP A;  3FEH A;  2QIC A;  4QF3 A;  1X4J A;  2VNF A;  5LKX A;  2LDR A;  4P5O B;  4V3L C;  4AUQ B;  3N9Q A;  4AYC B;  2LQ6 A;  5FER A;  3RTR B;  2E6R A;  2CRR A;  5LKZ A;  4GND A;  1BOR A;  5TAB A;  4YBM A;  3SOU A;  5C11 A;  2JMI A;  1WEM A;  3DQV R;  3KDE C;  4OGE A;  3ZPV E;  4CA1 A;  5B76 A;  2FUI A;  3MHH A;  4YC9 A;  3MDB C;  4I7C A;  4MSX A;  2CSV A;  2YU4 A;  3KV5 A;  3GV4 A;  3U5P A;  3O37 A;  1N87 A;  2B0O E;  2G6Q A;  4A4B A;  2MT5 A;  3DDT A;  3DWD A;  2MD8 C;  4BBQ A;  4W4U A;  2G45 A;  5TRB A; 
#chains in the Genus database with same CATH homology
 4X3G A;  1HYJ A;  4GNG A;  5G04 B;  4FO9 A;  4CCG X;  4I7B A;  2VP7 A;  2MNY A;  4LKA A;  3DPL R;  2ECI A;  1MM2 A;  5H9M A;  5B78 A;  2VJF B;  2EA6 A;  3C6W A;  5D1L B;  2JMJ A;  3IHP A;  4O64 A;  4PTB A;  3T6R A;  4AVX A;  2JMD A;  5I3L A;  5KH7 A;  4PPE A;  2XB1 A;  3N9O A;  2CT2 A;  4ZQL A;  1Z60 A;  3PUR A;  2BAY A;  3SOX A;  2F42 A;  2VPG A;  2YT5 A;  4A0C D;  4ZUX U;  5DKA A;  1VD4 A;  5DIN A;  2KU3 A;  2YW8 A;  3KQI A;  2I50 A;  1WEN A;  2LGL A;  4YAD A;  3SHB A;  1WIM A;  2LRI C;  3N9M A;  2JRJ A;  3SOW A;  1U6G B;  2LV9 A;  5D1K B;  1G25 A;  3RPG C;  3HCS A;  2F6N A;  2VJE A;  1Z2Q A;  2YRE A;  2F6J A;  2Y43 A;  3O34 A;  1WFK A;  3LQH A;  2KFT A;  2YUC A;  3U5M A;  1DVP A;  3ZTG A;  2KGG A;  1K2F A;  2EOD A;  3ZVY A;  2KWJ A;  3M63 A;  3RPG B;  1LDK C;  2KYU A;  2YQM A;  3N9L A;  2HYE D;  2KGI A;  1Z6U A;  2CSY A;  5KH3 A;  5B77 A;  4GB0 A;  5B75 A;  5AIU A;  1LDJ B;  3MHS A;  3HCT A;  2KR4 A;  4FIP A;  2LGK A;  2UZG A;  4ZDT A;  5FB1 A;  2YYR A;  4F52 B;  4R2Y A;  4YAT A;  1XWH A;  4N4F A;  2Y1M A;  5LKU A;  2H0D B;  4QF2 A;  2YSM A;  1F62 A;  1JM7 A;  4UI9 B;  1WGM A;  2L80 A;  2KWK A;  4IC2 A;  4XI1 A;  3U5N A;  3O7A A;  1WE9 A;  1WEE A;  1WEP A;  3O36 A;  2ECW A;  1X4I A;  2DX8 A;  2PUY A;  3ASL A;  5G05 B;  4BHW A;  2EGP A;  4Q6F A;  3KV6 A;  5FB0 A;  3O35 A;  2QIZ A;  2MIQ A;  4B7Y C;  2ECG A;  3NG2 A;  4UP5 A;  2CKL B;  2VPB A;  4IC3 A;  1CHC A;  3VK6 A;  3O70 A;  2QJ0 A;  4LLB A;  4I7D A;  4UP0 A;  4S3O C;  1WEV A;  2M85 A;  3PHD A;  3T7L A;  3I2D A;  3N9P A;  5C13 A;  2M6M A;  4WA6 A;  5AIT A;  3C5K A;  4FK5 A;  5LCW B;  2LXH C;  2L43 A;  2RI7 A;  5G0F A;  2KE1 A;  2ECV A;  2KWN A;  2L75 A;  1VYX A;  3QZV A;  3FL2 A;  2M3H A;  3O33 A;  5B8D A;  3KNV A;  2Y1N A;  2MUM A;  4R8P K;  2C2L A;  2K17 A;  2CKL A;  1WIL A;  2AN6 A;  4YBS A;  2H0D A;  2VPD A;  4GNE A;  3L1X A;  2OXQ C;  3EB5 A;  1WEW A;  1HYI A;  2IDA A;  5H1T A;  2LGG A;  4AP4 A;  5EYA F;  5TDW A;  1MM3 A;  4C9Z A;  4GNF A;  1WEU A;  2K4D A;  2YQL A;  1FBV A;  2L0B A;  4WZ0 A;  1RMD A;  2L5U A;  3L1Z B;  4LJN A;  2ZET C;  4L7X A;  2K16 A;  2CSZ A;  2MD7 B;  2PNX A;  5B79 A;  4S3O B;  3LQJ A;  4NN2 A;  4LAD B;  2LGV A;  2D8S A;  1WES A;  4TKP B;  2ECN A;  5H1V A;  1JM7 B;  2NAA A;  3U5O A;  5JG6 A;  4MVT A;  2VJE B;  2RSD A;  1E4U A;  3ZPV 1;  4LK9 A;  3PUQ A;  5TBN A;  3N9N A;  2FSA A;  2YUR A;  3M62 A;  4B86 C;  5FEY A;  2YHO A;  4L58 A;  3HCU A;  2KWO A;  2VJF A;  3ZVZ B;  1V87 A;  5D1M B;  1FP0 A;  1X4U A;  3GL6 A;  4YAX A;  3LRQ A;  2ECJ A;  4N3W A;  2FUU A;  4R7E A;  3EB6 A;  4A4C A;  4FJC A;  1WEO A;  5TDR A;  4A49 A;  2KRE A;  3L11 A;  4WZ3 B;  2MNZ A;  4YAB A;  3LQI A;  3M99 A;  2M1R A;  2KIZ A;  2YHN A;  1IYM A;  3ZYQ A;  2ECT A;  1WEQ A;  3V43 A;  4WZ2 A;  1T1H A;  5KH9 A;  4YBT A;  2E6S A;  4AYC A;  2K1J A;  2XEU A;  2G43 A;  4V3K C;  5J3X A;  2VPE A;  2MA5 A;  2LXP C;  1JOC A;  1VFY A;  3ZNI A;  2LN0 A;  2MA6 A;  2YSJ A;  5H1U A;  3HTK C;  5LKT A;  1ZBD B;  2C2V S;  2HDP A;  2QIC A;  4QF3 A;  1X4J A;  2VNF A;  5LKX A;  2LDR A;  4P5O B;  4V3L C;  4AUQ B;  3N9Q A;  4AYC B;  2LQ6 A;  5FER A;  3RTR B;  2E6R A;  5LKZ A;  4GND A;  1BOR A;  5TAB A;  4YBM A;  3SOU A;  5C11 A;  2JMI A;  1WEM A;  3DQV R;  3ZPV E;  4CA1 A;  5B76 A;  2FUI A;  3MHH A;  4YC9 A;  4I7C A;  4MSX A;  2YU4 A;  3KV5 A;  3GV4 A;  3U5P A;  3O37 A;  4A4B A;  2G6Q A;  1N87 A;  2MT5 A;  2MD8 C;  4BBQ A;  4W4U A;  2G45 A;  5TRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...