2YW8A

Crystal structure of human run and fyve domain-containing protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
KDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords RUN and FYVE domain-containing protein 1
publication title Crystal structure of human RUN and FYVE domain-containing protein
rcsb
source organism Homo sapiens
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yw8A00
2L75A 2H0DB 3RPGB 2VPGA 2LGLA 4WA6A 4X3GA 2ECVA 2C2VS 3SOXA 4YADA 2ECWA 3QZVA 5TBNA 1K2FA 2VNFA 3ZPV1 3GL6A 2KE1A 2MNZA 4LK9A 2G43A 2F6JA 4B86C 4BBQA 4ZUXU 1VD4A 2VP7A 3KV6A 3M62A 2QICA 4A4BA 2MD7B 2PNXA 4QF3A 2MA5A 4AP4A 4NN2A 1MM2A 2M6MA 4LADB 1XWHA 2C2LA 4L58A 1Z2QA 1Z60A 1ZBDB 1VFYA 5FEYA 3PHDA 2YYRA 3DPLR 3MHHA 2LDRA 2RI7A 4WZ2A 4CA1A 2KREA 2YHOA 3N9OA 3O35A 2YW8A 2YSJA 2VPEA 5TRBA 2Y43A 2HYED 2MD8C 4FO9A 2Y1MA 1X4IA 2CKLB 5B76A 2IDAA 1WEVA 4A49A 2EA6A 3U5NA 1F62A 5H9MA 3L11A 2L0BA 2YQLA 3GV4A 1WILA 5AITA 3ZNIA 1HYJA 4GB0A 3ZVZB 1WEMA 3HCTA 3VK6A 5LKZA 2D8SA 5I3LA 1DVPA 2KGIA 2K1JA 2VJEB 2FSAA 4FJCA 4PPEA 5FB1A 4WZ0A 1X4JA 4GNGA 4A0CD 4BHWA 2CT2A 2QIZA 4R8PK 2ECGA 3M63A 2LN0A 4YAXA 2F42A 3O37A 5FB0A 2G6QA 5J3XA 3SOUA 2ECJA 2VPDA 5B78A 4F52B 2MNYA 4IC3A 3LRQA 2KFTA 4I7CA 1FP0A 1T1HA 2L43A 4AVXA 3ZVYA 2E6SA 2KWKA 2LGKA 1WIMA 2LXPC 4XI1A 2YURA 2AN6A 2I50A 3SOWA 1WEUA 2VJFA 5H1UA 1WEPA 2CSYA 2KWNA 2RSDA 2FUUA 4PTBA 5LKXA 5FERA 3O33A 3HTKC 4AUQB 4LJNA 2NAAA 1N87A 3O7AA 2FUIA 3LQIA 2YSMA 5JG6A 4GNDA 4A4CA 2LGVA 1WEQA 5B77A 4B7YC 2LV9A 2DX8A 4UP5A 4LKAA 2CSZA 2CKLA 2JMIA 5D1MB 3RTRB 2LQ6A 2MIQA 1WENA 5KH7A 4FK5A 3U5PA 3N9MA 5H1VA 2M3HA 3L1XA 2KU3A 1VYXA 5G05B 4AYCA 3N9NA 4I7BA 2KGGA 5C13A 5G04B 4O64A 2XEUA 3EB5A 3L1ZB 2XB1A 2YUCA 4R7EA 3EB6A 1Z6UA 1WE9A 3HCUA 4S3OC 4ZQLA 3ZTGA 4UP0A 2K4DA 4ZDTA 3ZPVE 1MM3A 3N9LA 3PUQA 5H1TA 5AIUA 2JMJA 5TDRA 1JOCA 1FBVA 3KV5A 1IYMA 1CHCA 2EGPA 2JRJA 2LXHC 1JM7A 3O34A 2MT5A 2L80A 2H0DA 5KH3A 4TKPB 2YHNA 1LDJB 3SHBA 3N9QA 2LRIC 2F6NA 1G25A 5LKUA 4R2YA 2VPBA 4S3OB 2KYUA 4YABA 2ECNA 3U5OA 2PUYA 4FIPA 5B79A 3LQJA 1WEOA 1WEWA 3DQVR 4P5OB 2KWOA 3IHPA 3V43A 5B75A 2MA6A 2LGGA 5KH9A 2UZGA 3HCSA 1E4UA 4N3WA 3LQHA 5D1KB 1U6GB 2M1RA 4V3KC 2M85A 5G0FA 2K17A 2VJFB 5D1LB 1RMDA 2BAYA 4N4FA 2KIZA 5TDWA 1WEEA 2L5UA 3M99A 3N9PA 4I7DA 5DINA 2G45A 3ASLA 2ZETC 5C11A 3C5KA 4GNEA 4YBTA 3MHSA 2K16A 1WGMA 4MVTA 2ECTA 4MSXA 5LKTA 4QF2A 2KWJA 4W4UA 4YC9A 4L7XA 1WFKA 5EYAF 4V3LC 2OXQC 2VJEA 3RPGC 3U5MA 2MUMA 4Q6FA 4AYCB 4IC2A 4CCGX 4YATA 1X4UA 3PURA 3NG2A 5B8DA 2YQMA 3ZYQA 4YBMA 4YBSA 3O36A 2JMDA 3FL2A 5DKAA 1HYIA 4LLBA 2YT5A 4C9ZA 3T7LA 3KNVA 2EODA 3T6RA 3I2DA 1LDKC 2HDPA 2E6RA 1BORA 3C6WA 4GNFA 2ECIA 2QJ0A 5TABA 2KR4A 4WZ3B 2YREA 3O70A 2Y1NA 5LCWB 4UI9B 1V87A 1WESA 1JM7B 3KQIA 2YU4A
chains in the Genus database with same CATH superfamily
2L75A 2H0DB 3RPGB 2VPGA 2LGLA 4WA6A 4X3GA 2ECVA 2C2VS 3SOXA 4YADA 2ECWA 3QZVA 5TBNA 1K2FA 2VNFA 3ZPV1 3GL6A 2KE1A 2MNZA 4LK9A 2G43A 2F6JA 2MKEA 4B86C 4O62A 4BBQA 2KKYA 4ZUXU 1VD4A 3LVQE 2VP7A 3KV6A 3M62A 2QICA 4A4BA 2MD7B 2PNXA 4QF3A 2MA5A 4AP4A 4NN2A 1MM2A 2M6MA 4LADB 1XWHA 2M13A 2C2LA 4L58A 1Z2QA 1Z60A 1ZBDB 1VFYA 3DWDA 5FEYA 3KDEC 3PHDA 3H7HA 2YYRA 3DPLR 3MHHA 2LDRA 2RI7A 4WZ2A 4CA1A 2KREA 2YHOA 3N9OA 3O35A 2YW8A 2YSJA 5SVYA 2VPEA 5TRBA 2Y43A 2HYED 2MD8C 3E2DA 4OGCA 4FO9A 2Y1MA 1X4IA 2CKLB 5B76A 4H9DA 2IDAA 1WEVA 3LDYA 4A49A 2EA6A 3U5NA 1F62A 2CRWA 5H9MA 3L11A 2L0BA 2YQLA 3GV4A 1WILA 5AITA 3ZNIA 1HYJA 4Z0RA 4GB0A 3ZVZB 1WEMA 4Z0OA 2JM3A 3HCTA 3VK6A 5LKZA 2D8SA 5I3LA 5SVIB 1DVPA 2KGIA 2K1JA 2VJEB 2FSAA 1DCQA 4FJCA 3LVRE 4PPEA 5FB1A 4WZ0A 1X4JA 4GNGA 4A0CD 4BHWA 3Q1DA 2CT2A 2QIZA 4R8PK 2ECGA 3M63A 2LN0A 2E61A 2YVRA 4YAXA 2F42A 3FM8C 3O37A 5FB0A 2G6QA 5J3XA 3SOUA 2ECJA 2VPDA 5B78A 3SUBA 4F52B 2EXUA 2MNYA 3LRQA 4IC3A 2KFTA 3M7KA 4I7CA 1FP0A 1T1HA 2L43A 4AVXA 3ZVYA 2E6SA 2KWKA 2LGKA 2CSVA 1WIMA 2LXPC 4XI1A 2YURA 2AN6A 2I50A 2XOYA 3SOWA 1WEUA 1MBMA 2VJFA 5H1UA 1WEPA 2KKXA 2CSYA 2KWNA 2RSDA 2FUUA 4PTBA 5LKXA 5FERA 3O33A 3HTKC 4AUQB 4LJNA 2NAAA 1N87A 3O7AA 2FUIA 3LQIA 2YSMA 5JG6A 3FAOA 4GNDA 2DSMA 4A4CA 2LGVA 1WEQA 4OGEA 5B77A 4B7YC 2LV9A 2DX8A 4UP5A 4LKAA 2CSZA 3MDBC 2CKLA 2JMIA 5D1MB 3RTRB 2LQ6A 2MIQA 1WENA 5KH7A 4FK5A 3U5PA 3N9MA 3O47A 5H1VA 2M3HA 3L1XA 2KU3A 1VYXA 5G05B 4AYCA 3N9NA 4I7BA 2KGGA 5C13A 5G04B 4O64A 2XEUA 3EB5A 3L1ZB 2XB1A 2YUCA 4R7EA 3EB6A 1Z6UA 1WE9A 3HCUA 4S3OC 4ZQLA 3ZTGA 5SVIA 4UP0A 2K4DA 4ZDTA 3ZPVE 1MM3A 3N9LA 3PUQA 5H1TA 2FFWA 3FJUB 5AIUA 2XOZA 2JMJA 4F1PA 5TDRA 1JOCA 1FBVA 3KV5A 2IQJA 1IYMA 1CHCA 2EGPA 2EGMA 2JRJA 3JUEA 2LXHC 1JM7A 3O34A 2MT5A 2L80A 2H0DA 5KH3A 4TKPB 2DJAA 2YHNA 1LDJB 3SHBA 2L7PA 3N9QA 4QQ4A 2LRIC 2F6NA 1G25A 5LKUA 4R2YA 2VPBA 4S3OB 2KYUA 4YABA 2ECNA 3U5OA 2PUYA 4FIPA 5B79A 2LAUA 3LQJA 3FANA 1WEOA 1WEWA 3DQVR 4P5OB 2KWOA 3IHPA 3V43A 5B75A 2OWAA 2MA6A 2LGGA 5KH9A 2UZGA 3HCSA 1E4UA 4N3WA 3LQHA 5D1KB 2XP0A 1U6GB 2M1RA 4V3KC 2JUNA 2M85A 5G0FA 2K17A 5SVXA 2B0OE 2RR4A 2VJFB 5D1LB 2FD4A 1RMDA 2BAYA 4N4FA 2KIZA 5TDWA 1WEEA 2L5UA 3M99A 3N9PA 4I7DA 5DINA 2G45A 2P57A 3ASLA 2ZETC 5C11A 3T9KA 3C5KA 4GNEA 3FEHA 4YBTA 3MHSA 2K16A 1WGMA 4MVTA 2ECTA 4MSXA 5LKTA 4QF2A 2KWJA 3LJUX 4W4UA 3DDTA 4YC9A 4L7XA 1WFKA 5EYAF 3PLWA 4V3LC 2CRRA 2OXQC 2VJEA 3RPGC 3U5MA 2MUMA 4Q6FA 4AYCB 4IC2A 4CCGX 4YATA 1X4UA 3PURA 5K3QA 3NG2A 5B8DA 2YQMA 3ZYQA 4YBMA 4YBSA 3O36A 2JMDA 3FL2A 5DKAA 1HYIA 4LLBA 2YT5A 4C9ZA 3T7LA 3KNVA 2EODA 3T6RA 2D8UA 1LDKC 3I2DA 2HDPA 2CONA 2E6RA 1BORA 3C6WA 4GNFA 2ECIA 2QJ0A 5TABA 2KR4A 4WZ3B 2YREA 3O70A 2Y1NA 5LCWB 4UI9B 1V87A 1WESA 1JM7B 3KQIA 2YU4A 2XOCA
chains in the Genus database with same CATH topology
2L75A 2H0DB 3RPGB 2VPGA 2LGLA 4WA6A 4X3GA 2ECVA 2C2VS 3SOXA 4YADA 2ECWA 3QZVA 5TBNA 1K2FA 2VNFA 3ZPV1 3GL6A 2KE1A 2MNZA 4LK9A 2G43A 2F6JA 4B86C 4BBQA 4ZUXU 1VD4A 2VP7A 3KV6A 3M62A 2QICA 4A4BA 2MD7B 2PNXA 4QF3A 2MA5A 4AP4A 4NN2A 1MM2A 2M6MA 4LADB 1XWHA 2C2LA 4L58A 1Z2QA 1Z60A 1ZBDB 1VFYA 5FEYA 3PHDA 2YYRA 3DPLR 3MHHA 2LDRA 2RI7A 4WZ2A 4CA1A 2KREA 2YHOA 3N9OA 3O35A 2YW8A 2YSJA 2VPEA 5TRBA 2Y43A 2HYED 2MD8C 4FO9A 2Y1MA 1X4IA 2CKLB 5B76A 2IDAA 1WEVA 4A49A 2EA6A 3U5NA 1F62A 5H9MA 3L11A 2L0BA 2YQLA 3GV4A 1WILA 5AITA 3ZNIA 1HYJA 4GB0A 3ZVZB 1WEMA 3HCTA 3VK6A 5LKZA 2D8SA 5I3LA 1DVPA 2KGIA 2K1JA 2VJEB 2FSAA 4FJCA 4PPEA 5FB1A 4WZ0A 1X4JA 4GNGA 4A0CD 4BHWA 2CT2A 2QIZA 4R8PK 2ECGA 3M63A 2LN0A 4YAXA 2F42A 3O37A 5FB0A 2G6QA 5J3XA 3SOUA 2ECJA 2VPDA 5B78A 4F52B 2MNYA 4IC3A 3LRQA 2KFTA 4I7CA 1FP0A 1T1HA 2L43A 4AVXA 3ZVYA 2E6SA 2KWKA 2LGKA 1WIMA 2LXPC 4XI1A 2YURA 2AN6A 2I50A 3SOWA 1WEUA 2VJFA 5H1UA 1WEPA 2CSYA 2KWNA 2RSDA 2FUUA 4PTBA 5LKXA 5FERA 3O33A 3HTKC 4AUQB 4LJNA 2NAAA 1N87A 3O7AA 2FUIA 3LQIA 2YSMA 5JG6A 4GNDA 4A4CA 2LGVA 1WEQA 5B77A 4B7YC 2LV9A 2DX8A 4UP5A 4LKAA 2CSZA 2CKLA 2JMIA 5D1MB 3RTRB 2LQ6A 2MIQA 1WENA 5KH7A 4FK5A 3U5PA 3N9MA 5H1VA 2M3HA 3L1XA 2KU3A 1VYXA 5G05B 4AYCA 3N9NA 4I7BA 2KGGA 5C13A 5G04B 4O64A 2XEUA 3EB5A 3L1ZB 2XB1A 2YUCA 4R7EA 3EB6A 1Z6UA 1WE9A 3HCUA 4S3OC 4ZQLA 3ZTGA 4UP0A 2K4DA 4ZDTA 3ZPVE 1MM3A 3N9LA 3PUQA 5H1TA 5AIUA 2JMJA 5TDRA 1JOCA 1FBVA 3KV5A 1IYMA 1CHCA 2EGPA 2JRJA 2LXHC 1JM7A 3O34A 2MT5A 2L80A 2H0DA 5KH3A 4TKPB 2YHNA 1LDJB 3SHBA 3N9QA 2LRIC 2F6NA 1G25A 5LKUA 4R2YA 2VPBA 4S3OB 2KYUA 4YABA 2ECNA 3U5OA 2PUYA 4FIPA 5B79A 3LQJA 1WEOA 1WEWA 3DQVR 4P5OB 2KWOA 3IHPA 3V43A 5B75A 2MA6A 2LGGA 5KH9A 2UZGA 3HCSA 1E4UA 4N3WA 3LQHA 5D1KB 1U6GB 2M1RA 4V3KC 2M85A 5G0FA 2K17A 2VJFB 5D1LB 1RMDA 2BAYA 4N4FA 2KIZA 5TDWA 1WEEA 2L5UA 3M99A 3N9PA 4I7DA 5DINA 2G45A 3ASLA 2ZETC 5C11A 3C5KA 4GNEA 4YBTA 3MHSA 2K16A 1WGMA 4MVTA 2ECTA 4MSXA 5LKTA 4QF2A 2KWJA 4W4UA 4YC9A 4L7XA 1WFKA 5EYAF 4V3LC 2OXQC 2VJEA 3RPGC 3U5MA 2MUMA 4Q6FA 4AYCB 4IC2A 4CCGX 4YATA 1X4UA 3PURA 3NG2A 5B8DA 2YQMA 3ZYQA 4YBMA 4YBSA 3O36A 2JMDA 3FL2A 5DKAA 1HYIA 4LLBA 2YT5A 4C9ZA 3T7LA 3KNVA 2EODA 3T6RA 3I2DA 1LDKC 2HDPA 2E6RA 1BORA 3C6WA 4GNFA 2ECIA 2QJ0A 5TABA 2KR4A 4WZ3B 2YREA 3O70A 2Y1NA 5LCWB 4UI9B 1V87A 1WESA 1JM7B 3KQIA 2YU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L75 A;  2H0D B;  3RPG B;  2VPG A;  2LGL A;  4WA6 A;  4X3G A;  2ECV A;  2C2V S;  3SOX A;  4YAD A;  2ECW A;  3QZV A;  5TBN A;  1K2F A;  2VNF A;  3ZPV 1;  3GL6 A;  2KE1 A;  2MNZ A;  4LK9 A;  2G43 A;  2F6J A;  4B86 C;  4BBQ A;  4ZUX U;  1VD4 A;  2VP7 A;  3KV6 A;  3M62 A;  2QIC A;  4A4B A;  2MD7 B;  2PNX A;  4QF3 A;  2MA5 A;  4AP4 A;  4NN2 A;  1MM2 A;  2M6M A;  4LAD B;  1XWH A;  2C2L A;  4L58 A;  1Z2Q A;  1Z60 A;  1ZBD B;  1VFY A;  5FEY A;  3PHD A;  2YYR A;  3DPL R;  3MHH A;  2LDR A;  2RI7 A;  4WZ2 A;  4CA1 A;  2KRE A;  2YHO A;  3N9O A;  3O35 A;  2YW8 A;  2YSJ A;  2VPE A;  5TRB A;  2Y43 A;  2HYE D;  2MD8 C;  4FO9 A;  2Y1M A;  1X4I A;  2CKL B;  5B76 A;  2IDA A;  1WEV A;  4A49 A;  2EA6 A;  3U5N A;  1F62 A;  5H9M A;  3L11 A;  2L0B A;  2YQL A;  3GV4 A;  1WIL A;  5AIT A;  3ZNI A;  1HYJ A;  4GB0 A;  3ZVZ B;  1WEM A;  3HCT A;  3VK6 A;  5LKZ A;  2D8S A;  5I3L A;  1DVP A;  2KGI A;  2K1J A;  2VJE B;  2FSA A;  4FJC A;  4PPE A;  5FB1 A;  4WZ0 A;  1X4J A;  4GNG A;  4A0C D;  4BHW A;  2CT2 A;  2QIZ A;  4R8P K;  2ECG A;  3M63 A;  2LN0 A;  4YAX A;  2F42 A;  3O37 A;  5FB0 A;  2G6Q A;  5J3X A;  3SOU A;  2ECJ A;  2VPD A;  5B78 A;  4F52 B;  2MNY A;  4IC3 A;  3LRQ A;  2KFT A;  4I7C A;  1FP0 A;  1T1H A;  2L43 A;  4AVX A;  3ZVY A;  2E6S A;  2KWK A;  2LGK A;  1WIM A;  2LXP C;  4XI1 A;  2YUR A;  2AN6 A;  2I50 A;  3SOW A;  1WEU A;  2VJF A;  5H1U A;  1WEP A;  2CSY A;  2KWN A;  2RSD A;  2FUU A;  4PTB A;  5LKX A;  5FER A;  3O33 A;  3HTK C;  4AUQ B;  4LJN A;  2NAA A;  1N87 A;  3O7A A;  2FUI A;  3LQI A;  2YSM A;  5JG6 A;  4GND A;  4A4C A;  2LGV A;  1WEQ A;  5B77 A;  4B7Y C;  2LV9 A;  2DX8 A;  4UP5 A;  4LKA A;  2CSZ A;  2CKL A;  2JMI A;  5D1M B;  3RTR B;  2LQ6 A;  2MIQ A;  1WEN A;  5KH7 A;  4FK5 A;  3U5P A;  3N9M A;  5H1V A;  2M3H A;  3L1X A;  2KU3 A;  1VYX A;  5G05 B;  4AYC A;  3N9N A;  4I7B A;  2KGG A;  5C13 A;  5G04 B;  4O64 A;  2XEU A;  3EB5 A;  3L1Z B;  2XB1 A;  2YUC A;  4R7E A;  3EB6 A;  1Z6U A;  1WE9 A;  3HCU A;  4S3O C;  4ZQL A;  3ZTG A;  4UP0 A;  2K4D A;  4ZDT A;  3ZPV E;  1MM3 A;  3N9L A;  3PUQ A;  5H1T A;  5AIU A;  2JMJ A;  5TDR A;  1JOC A;  1FBV A;  3KV5 A;  1IYM A;  1CHC A;  2EGP A;  2JRJ A;  2LXH C;  1JM7 A;  3O34 A;  2MT5 A;  2L80 A;  2H0D A;  5KH3 A;  4TKP B;  2YHN A;  1LDJ B;  3SHB A;  3N9Q A;  2LRI C;  2F6N A;  1G25 A;  5LKU A;  4R2Y A;  2VPB A;  4S3O B;  2KYU A;  4YAB A;  2ECN A;  3U5O A;  2PUY A;  4FIP A;  5B79 A;  3LQJ A;  1WEO A;  1WEW A;  3DQV R;  4P5O B;  2KWO A;  3IHP A;  3V43 A;  5B75 A;  2MA6 A;  2LGG A;  5KH9 A;  2UZG A;  3HCS A;  1E4U A;  4N3W A;  3LQH A;  5D1K B;  1U6G B;  2M1R A;  4V3K C;  2M85 A;  5G0F A;  2K17 A;  2VJF B;  5D1L B;  1RMD A;  2BAY A;  4N4F A;  2KIZ A;  5TDW A;  1WEE A;  2L5U A;  3M99 A;  3N9P A;  4I7D A;  5DIN A;  2G45 A;  3ASL A;  2ZET C;  5C11 A;  3C5K A;  4GNE A;  4YBT A;  3MHS A;  2K16 A;  1WGM A;  4MVT A;  2ECT A;  4MSX A;  5LKT A;  4QF2 A;  2KWJ A;  4W4U A;  4YC9 A;  4L7X A;  1WFK A;  5EYA F;  4V3L C;  2OXQ C;  2VJE A;  3RPG C;  3U5M A;  2MUM A;  4Q6F A;  4AYC B;  4IC2 A;  4CCG X;  4YAT A;  1X4U A;  3PUR A;  3NG2 A;  5B8D A;  2YQM A;  3ZYQ A;  4YBM A;  4YBS A;  3O36 A;  2JMD A;  3FL2 A;  5DKA A;  1HYI A;  4LLB A;  2YT5 A;  4C9Z A;  3T7L A;  3KNV A;  2EOD A;  3T6R A;  3I2D A;  1LDK C;  2HDP A;  2E6R A;  1BOR A;  3C6W A;  4GNF A;  2ECI A;  2QJ0 A;  5TAB A;  2KR4 A;  4WZ3 B;  2YRE A;  3O70 A;  2Y1N A;  5LCW B;  4UI9 B;  1V87 A;  1WES A;  1JM7 B;  3KQI A;  2YU4 A; 
#chains in the Genus database with same CATH topology
 2L75 A;  2H0D B;  3RPG B;  2VPG A;  2LGL A;  4WA6 A;  4X3G A;  2ECV A;  2C2V S;  3SOX A;  4YAD A;  2ECW A;  3QZV A;  5TBN A;  1K2F A;  2VNF A;  3ZPV 1;  3GL6 A;  2KE1 A;  2MNZ A;  4LK9 A;  2G43 A;  2F6J A;  2MKE A;  4B86 C;  4O62 A;  4BBQ A;  2KKY A;  4ZUX U;  1VD4 A;  3LVQ E;  2VP7 A;  3KV6 A;  3M62 A;  2QIC A;  4A4B A;  2MD7 B;  2PNX A;  4QF3 A;  2MA5 A;  4AP4 A;  4NN2 A;  1MM2 A;  2M6M A;  4LAD B;  1XWH A;  2M13 A;  2C2L A;  4L58 A;  1Z2Q A;  1Z60 A;  1ZBD B;  1VFY A;  3DWD A;  5FEY A;  3KDE C;  3PHD A;  3H7H A;  2YYR A;  3DPL R;  3MHH A;  2LDR A;  2RI7 A;  4WZ2 A;  4CA1 A;  2KRE A;  2YHO A;  3N9O A;  3O35 A;  2YW8 A;  2YSJ A;  5SVY A;  2VPE A;  5TRB A;  2Y43 A;  2HYE D;  2MD8 C;  3E2D A;  4OGC A;  4FO9 A;  2Y1M A;  1X4I A;  2CKL B;  5B76 A;  4H9D A;  2IDA A;  1WEV A;  3LDY A;  4A49 A;  2EA6 A;  3U5N A;  1F62 A;  2CRW A;  5H9M A;  3L11 A;  2L0B A;  2YQL A;  3GV4 A;  1WIL A;  5AIT A;  3ZNI A;  1HYJ A;  4Z0R A;  4GB0 A;  3ZVZ B;  1WEM A;  4Z0O A;  2JM3 A;  3HCT A;  3VK6 A;  5LKZ A;  2D8S A;  5I3L A;  5SVI B;  1DVP A;  2KGI A;  2K1J A;  2VJE B;  2FSA A;  1DCQ A;  4FJC A;  3LVR E;  4PPE A;  5FB1 A;  4WZ0 A;  1X4J A;  4GNG A;  4A0C D;  4BHW A;  3Q1D A;  2CT2 A;  2QIZ A;  4R8P K;  2ECG A;  3M63 A;  2LN0 A;  2E61 A;  2YVR A;  4YAX A;  2F42 A;  3FM8 C;  3O37 A;  5FB0 A;  2G6Q A;  5J3X A;  3SOU A;  2ECJ A;  2VPD A;  5B78 A;  3SUB A;  4F52 B;  2EXU A;  2MNY A;  3LRQ A;  4IC3 A;  2KFT A;  3M7K A;  4I7C A;  1FP0 A;  1T1H A;  2L43 A;  4AVX A;  3ZVY A;  2E6S A;  2KWK A;  2LGK A;  2CSV A;  1WIM A;  2LXP C;  4XI1 A;  2YUR A;  2AN6 A;  2I50 A;  2XOY A;  3SOW A;  1WEU A;  1MBM A;  2VJF A;  5H1U A;  1WEP A;  2KKX A;  2CSY A;  2KWN A;  2RSD A;  2FUU A;  4PTB A;  5LKX A;  5FER A;  3O33 A;  3HTK C;  4AUQ B;  4LJN A;  2NAA A;  1N87 A;  3O7A A;  2FUI A;  3LQI A;  2YSM A;  5JG6 A;  3FAO A;  4GND A;  2DSM A;  4A4C A;  2LGV A;  1WEQ A;  4OGE A;  5B77 A;  4B7Y C;  2LV9 A;  2DX8 A;  4UP5 A;  4LKA A;  2CSZ A;  3MDB C;  2CKL A;  2JMI A;  5D1M B;  3RTR B;  2LQ6 A;  2MIQ A;  1WEN A;  5KH7 A;  4FK5 A;  3U5P A;  3N9M A;  3O47 A;  5H1V A;  2M3H A;  3L1X A;  2KU3 A;  1VYX A;  5G05 B;  4AYC A;  3N9N A;  4I7B A;  2KGG A;  5C13 A;  5G04 B;  4O64 A;  2XEU A;  3EB5 A;  3L1Z B;  2XB1 A;  2YUC A;  4R7E A;  3EB6 A;  1Z6U A;  1WE9 A;  3HCU A;  4S3O C;  4ZQL A;  3ZTG A;  5SVI A;  4UP0 A;  2K4D A;  4ZDT A;  3ZPV E;  1MM3 A;  3N9L A;  3PUQ A;  5H1T A;  2FFW A;  3FJU B;  5AIU A;  2XOZ A;  2JMJ A;  4F1P A;  5TDR A;  1JOC A;  1FBV A;  3KV5 A;  2IQJ A;  1IYM A;  1CHC A;  2EGP A;  2EGM A;  2JRJ A;  3JUE A;  2LXH C;  1JM7 A;  3O34 A;  2MT5 A;  2L80 A;  2H0D A;  5KH3 A;  4TKP B;  2DJA A;  2YHN A;  1LDJ B;  3SHB A;  2L7P A;  3N9Q A;  4QQ4 A;  2LRI C;  2F6N A;  1G25 A;  5LKU A;  4R2Y A;  2VPB A;  4S3O B;  2KYU A;  4YAB A;  2ECN A;  3U5O A;  2PUY A;  4FIP A;  5B79 A;  2LAU A;  3LQJ A;  3FAN A;  1WEO A;  1WEW A;  3DQV R;  4P5O B;  2KWO A;  3IHP A;  3V43 A;  5B75 A;  2OWA A;  2MA6 A;  2LGG A;  5KH9 A;  2UZG A;  3HCS A;  1E4U A;  4N3W A;  3LQH A;  5D1K B;  2XP0 A;  1U6G B;  2M1R A;  4V3K C;  2JUN A;  2M85 A;  5G0F A;  2K17 A;  5SVX A;  2B0O E;  2RR4 A;  2VJF B;  5D1L B;  2FD4 A;  1RMD A;  2BAY A;  4N4F A;  2KIZ A;  5TDW A;  1WEE A;  2L5U A;  3M99 A;  3N9P A;  4I7D A;  5DIN A;  2G45 A;  2P57 A;  3ASL A;  2ZET C;  5C11 A;  3T9K A;  3C5K A;  4GNE A;  3FEH A;  4YBT A;  3MHS A;  2K16 A;  1WGM A;  4MVT A;  2ECT A;  4MSX A;  5LKT A;  4QF2 A;  2KWJ A;  3LJU X;  4W4U A;  3DDT A;  4YC9 A;  4L7X A;  1WFK A;  5EYA F;  3PLW A;  4V3L C;  2CRR A;  2OXQ C;  2VJE A;  3RPG C;  3U5M A;  2MUM A;  4Q6F A;  4AYC B;  4IC2 A;  4CCG X;  4YAT A;  1X4U A;  3PUR A;  5K3Q A;  3NG2 A;  5B8D A;  2YQM A;  3ZYQ A;  4YBM A;  4YBS A;  3O36 A;  2JMD A;  3FL2 A;  5DKA A;  1HYI A;  4LLB A;  2YT5 A;  4C9Z A;  3T7L A;  3KNV A;  2EOD A;  3T6R A;  2D8U A;  1LDK C;  3I2D A;  2HDP A;  2CON A;  2E6R A;  1BOR A;  3C6W A;  4GNF A;  2ECI A;  2QJ0 A;  5TAB A;  2KR4 A;  4WZ3 B;  2YRE A;  3O70 A;  2Y1N A;  5LCW B;  4UI9 B;  1V87 A;  1WES A;  1JM7 B;  3KQI A;  2YU4 A;  2XOC A; 
#chains in the Genus database with same CATH homology
 2L75 A;  2H0D B;  3RPG B;  2VPG A;  2LGL A;  4WA6 A;  4X3G A;  2ECV A;  2C2V S;  3SOX A;  4YAD A;  2ECW A;  3QZV A;  5TBN A;  1K2F A;  2VNF A;  3ZPV 1;  3GL6 A;  2KE1 A;  2MNZ A;  4LK9 A;  2G43 A;  2F6J A;  4B86 C;  4BBQ A;  4ZUX U;  1VD4 A;  2VP7 A;  3KV6 A;  3M62 A;  2QIC A;  4A4B A;  2MD7 B;  2PNX A;  4QF3 A;  2MA5 A;  4AP4 A;  4NN2 A;  1MM2 A;  2M6M A;  4LAD B;  1XWH A;  2C2L A;  4L58 A;  1Z2Q A;  1Z60 A;  1ZBD B;  1VFY A;  5FEY A;  3PHD A;  2YYR A;  3DPL R;  3MHH A;  2LDR A;  2RI7 A;  4WZ2 A;  4CA1 A;  2KRE A;  2YHO A;  3N9O A;  3O35 A;  2YW8 A;  2YSJ A;  2VPE A;  5TRB A;  2Y43 A;  2HYE D;  2MD8 C;  4FO9 A;  2Y1M A;  1X4I A;  2CKL B;  5B76 A;  2IDA A;  1WEV A;  4A49 A;  2EA6 A;  3U5N A;  1F62 A;  5H9M A;  3L11 A;  2L0B A;  2YQL A;  3GV4 A;  1WIL A;  5AIT A;  3ZNI A;  1HYJ A;  4GB0 A;  3ZVZ B;  1WEM A;  3HCT A;  3VK6 A;  5LKZ A;  2D8S A;  5I3L A;  1DVP A;  2KGI A;  2K1J A;  2VJE B;  2FSA A;  4FJC A;  4PPE A;  5FB1 A;  4WZ0 A;  1X4J A;  4GNG A;  4A0C D;  4BHW A;  2CT2 A;  2QIZ A;  4R8P K;  2ECG A;  3M63 A;  2LN0 A;  4YAX A;  2F42 A;  3O37 A;  5FB0 A;  2G6Q A;  5J3X A;  3SOU A;  2ECJ A;  2VPD A;  5B78 A;  4F52 B;  2MNY A;  4IC3 A;  3LRQ A;  2KFT A;  4I7C A;  1FP0 A;  1T1H A;  2L43 A;  4AVX A;  3ZVY A;  2E6S A;  2KWK A;  2LGK A;  1WIM A;  2LXP C;  4XI1 A;  2YUR A;  2AN6 A;  2I50 A;  3SOW A;  1WEU A;  2VJF A;  5H1U A;  1WEP A;  2CSY A;  2KWN A;  2RSD A;  2FUU A;  4PTB A;  5LKX A;  5FER A;  3O33 A;  3HTK C;  4AUQ B;  4LJN A;  2NAA A;  1N87 A;  3O7A A;  2FUI A;  3LQI A;  2YSM A;  5JG6 A;  4GND A;  4A4C A;  2LGV A;  1WEQ A;  5B77 A;  4B7Y C;  2LV9 A;  2DX8 A;  4UP5 A;  4LKA A;  2CSZ A;  2CKL A;  2JMI A;  5D1M B;  3RTR B;  2LQ6 A;  2MIQ A;  1WEN A;  5KH7 A;  4FK5 A;  3U5P A;  3N9M A;  5H1V A;  2M3H A;  3L1X A;  2KU3 A;  1VYX A;  5G05 B;  4AYC A;  3N9N A;  4I7B A;  2KGG A;  5C13 A;  5G04 B;  4O64 A;  2XEU A;  3EB5 A;  3L1Z B;  2XB1 A;  2YUC A;  4R7E A;  3EB6 A;  1Z6U A;  1WE9 A;  3HCU A;  4S3O C;  4ZQL A;  3ZTG A;  4UP0 A;  2K4D A;  4ZDT A;  3ZPV E;  1MM3 A;  3N9L A;  3PUQ A;  5H1T A;  5AIU A;  2JMJ A;  5TDR A;  1JOC A;  1FBV A;  3KV5 A;  1IYM A;  1CHC A;  2EGP A;  2JRJ A;  2LXH C;  1JM7 A;  3O34 A;  2MT5 A;  2L80 A;  2H0D A;  5KH3 A;  4TKP B;  2YHN A;  1LDJ B;  3SHB A;  3N9Q A;  2LRI C;  2F6N A;  1G25 A;  5LKU A;  4R2Y A;  2VPB A;  4S3O B;  2KYU A;  4YAB A;  2ECN A;  3U5O A;  2PUY A;  4FIP A;  5B79 A;  3LQJ A;  1WEO A;  1WEW A;  3DQV R;  4P5O B;  2KWO A;  3IHP A;  3V43 A;  5B75 A;  2MA6 A;  2LGG A;  5KH9 A;  2UZG A;  3HCS A;  1E4U A;  4N3W A;  3LQH A;  5D1K B;  1U6G B;  2M1R A;  4V3K C;  2M85 A;  5G0F A;  2K17 A;  2VJF B;  5D1L B;  1RMD A;  2BAY A;  4N4F A;  2KIZ A;  5TDW A;  1WEE A;  2L5U A;  3M99 A;  3N9P A;  4I7D A;  5DIN A;  2G45 A;  3ASL A;  2ZET C;  5C11 A;  3C5K A;  4GNE A;  4YBT A;  3MHS A;  2K16 A;  1WGM A;  4MVT A;  2ECT A;  4MSX A;  5LKT A;  4QF2 A;  2KWJ A;  4W4U A;  4YC9 A;  4L7X A;  1WFK A;  5EYA F;  4V3L C;  2OXQ C;  2VJE A;  3RPG C;  3U5M A;  2MUM A;  4Q6F A;  4AYC B;  4IC2 A;  4CCG X;  4YAT A;  1X4U A;  3PUR A;  3NG2 A;  5B8D A;  2YQM A;  3ZYQ A;  4YBM A;  4YBS A;  3O36 A;  2JMD A;  3FL2 A;  5DKA A;  1HYI A;  4LLB A;  2YT5 A;  4C9Z A;  3T7L A;  3KNV A;  2EOD A;  3T6R A;  3I2D A;  1LDK C;  2HDP A;  2E6R A;  1BOR A;  3C6W A;  4GNF A;  2ECI A;  2QJ0 A;  5TAB A;  2KR4 A;  4WZ3 B;  2YRE A;  3O70 A;  2Y1N A;  5LCW B;  4UI9 B;  1V87 A;  1WES A;  1JM7 B;  3KQI A;  2YU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...