2YW8A

Crystal structure of human run and fyve domain-containing protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
KDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUN and FYVE domain-containing protein 1
publication title Crystal structure of human RUN and FYVE domain-containing protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yw8A00
4GNGA 2L80A 2G45A 4XI1A 4YATA 4N4FA 3N9NA 5LKTA 2KIZA 3DQVR 5DINA 1JM7A 5D1LB 2VJFA 3I2DA 5D1KB 2HYED 5LKZA 2ECIA 1BORA 1U6GB 2QIZA 3LRQA 3EB5A 4MVTA 2KREA 2YQLA 3U5MA 2UZGA 4I7CA 1WGMA 4LLBA 3T7LA 2EGPA 2F42A 2VJFB 4L58A 2JMDA 5G04B 2ECTA 2MD7B 5C13A 3N9LA 2BAYA 2YUCA 4GNDA 3V43A 2YURA 2KU3A 3U5NA 2CT2A 4C9ZA 4WZ3B 3KNVA 4UI9B 3NG2A 5AITA 1WEOA 1N87A 2KGGA 5H9MA 2VPGA 1WE9A 3RPGC 3O35A 5B78A 2VPBA 4CA1A 2XEUA 3LQJA 4UP0A 4X3GA 3PURA 3L1ZB 4V3KC 5FB0A 3C5KA 5D1MB 4I7DA 2LDRA 4WZ0A 4WZ2A 4IC3A 4R2YA 5FEYA 4AYCA 3HCSA 2LGKA 1ZBDB 1HYJA 1G25A 1MM3A 3VK6A 1FBVA 2K16A 1WILA 4Q6FA 5TBNA 4V3LC 3HCTA 2KYUA 2L75A 5H1UA 2C2VS 3ZPVE 3U5PA 4GB0A 5B75A 2YSMA 4AYCB 4ZUXU 2XB1A 5JG6A 2MD8C 2JMJA 4B7YC 3MHHA 2AN6A 1JOCA 3O37A 3MHSA 2K1JA 2CSYA 2E6SA 2LXHC 3PUQA 5EYAF 5B76A 5G05B 4GNEA 1RMDA 2CSZA 3RPGB 5LCWB 5LKUA 3M62A 2KWKA 2VJEB 3FL2A 3ASLA 2LV9A 1V87A 2LGLA 1WEQA 1Z60A 4BHWA 2FUIA 2F6JA 2IDAA 2YW8A 1F62A 4B86C 1JM7B 3M63A 4R7EA 2M6MA 3O34A 4LK9A 2QICA 1X4JA 2LGVA 2MNYA 4S3OC 3O33A 3L11A 1FP0A 2RI7A 4QF3A 3O70A 2Y1MA 3N9MA 2FSAA 2PUYA 4W4UA 4MSXA 1LDKC 3SOXA 5C11A 2RSDA 4FK5A 2KE1A 2F6NA 4TKPB 2YHNA 2KWJA 4I7BA 1X4UA 4IC2A 4F52B 2JMIA 1WESA 4NN2A 2EODA 2MIQA 1WEMA 2D8SA 1Z6UA 3KV5A 3M99A 1MM2A 5FB1A 1WEUA 1Z2QA 4LKAA 5G0FA 4N3WA 2FUUA 2KWNA 3SOWA 3SHBA 4YAXA 2KR4A 3U5OA 5B8DA 2PNXA 4PPEA 1VD4A 4YADA 2ZETC 4FJCA 1WEWA 2ECJA 2YREA 2G43A 1LDJB 2KWOA 4R8PK 3EB6A 1E4UA 3L1XA 5KH3A 2MA6A 3ZVYA 3O36A 4YBSA 2K4DA 2MA5A 2KFTA 3ZPV1 4BBQA 4A4BA 5TDWA 2C2LA 2LGGA 4YABA 3SOUA 4YBMA 2NAAA 2YT5A 2VPDA 1WFKA 3C6WA 3HTKC 5KH9A 3ZVZB 5TDRA 3GV4A 4FO9A 2M85A 2YQMA 2MNZA 3RTRB 3LQIA 4P5OB 4GNFA 2L43A 2LXPC 2M1RA 2ECVA 3KQIA 4ZQLA 5H1TA 3PHDA 3N9QA 2H0DA 2L5UA 3QZVA 1WENA 2QJ0A 1WEEA 5LKXA 3KV6A 2KGIA 2YSJA 5FERA 5TABA 2VNFA 2LRIC 3GL6A 5I3LA 2ECGA 4LADB 2H0DB 2MUMA 4A4CA 4AP4A 2CKLA 4QF2A 5B79A 2DX8A 4UP5A 4CCGX 1WEPA 2EA6A 2Y1NA 3IHPA 4YC9A 4AVXA 4A0CD 1WEVA 2M3HA 5J3XA 3N9PA 2JRJA 3T6RA 4L7XA 5KH7A 1CHCA 2MT5A 5B77A 2CKLB 3O7AA 4LJNA 3N9OA 4AUQB 2YHOA 3ZTGA 2LN0A 1IYMA 2YU4A 4A49A 1T1HA 2HDPA 2OXQC 2ECWA 2E6RA 1XWHA 2VP7A 4YBTA 2LQ6A 2YYRA 1X4IA 2I50A 4O64A 3ZNIA 1K2FA 1VYXA 4S3OB 1WIMA 5DKAA 1HYIA 4WA6A 3DPLR 4ZDTA 3HCUA 2K17A 3ZYQA 2Y43A 5TRBA 2ECNA 1DVPA 1VFYA 5AIUA 3LQHA 2L0BA 4FIPA 2VPEA 5H1VA 2G6QA 2VJEA 4PTBA
chains in the Genus database with same CATH superfamily
4GNGA 2L80A 2G45A 4XI1A 4YATA 4N4FA 4OGEA 3N9NA 5LKTA 3SUBA 2KIZA 3DQVR 5DINA 1JM7A 5D1LB 2VJFA 3I2DA 5D1KB 2HYED 2EGMA 5LKZA 2ECIA 1BORA 1U6GB 2QIZA 3LRQA 3EB5A 4MVTA 2KREA 2YQLA 3U5MA 2UZGA 4I7CA 1WGMA 4LLBA 3T7LA 1DCQA 5SVIA 2EGPA 2F42A 2VJFB 3Q1DA 5K3QA 4L58A 2JMDA 5G04B 2ECTA 2MD7B 5C13A 3N9LA 2BAYA 2YUCA 3DWDA 4GNDA 3V43A 2YURA 2KU3A 3U5NA 2CT2A 4C9ZA 4WZ3B 3KNVA 3LVRE 4UI9B 3NG2A 5AITA 1WEOA 1N87A 2KGGA 5H9MA 2VPGA 1WE9A 3RPGC 3O35A 5B78A 2VPBA 4CA1A 2XEUA 3LQJA 3LVQE 4UP0A 3FAOA 4X3GA 3PURA 3L1ZB 4V3KC 5FB0A 3FM8C 2B0OE 3C5KA 5D1MB 4I7DA 2LDRA 4WZ0A 4WZ2A 4IC3A 4R2YA 5FEYA 4AYCA 3HCSA 2LGKA 1ZBDB 1HYJA 1G25A 1MM3A 3VK6A 1FBVA 2K16A 4Q6FA 1WILA 3JUEA 5TBNA 4V3LC 3HCTA 2KYUA 2L75A 5H1UA 2C2VS 3ZPVE 3U5PA 4GB0A 5B75A 2YSMA 4AYCB 4ZUXU 2XB1A 5JG6A 2MD8C 2JMJA 3T9KA 4B7YC 3MHHA 2AN6A 1JOCA 3O37A 3MHSA 2K1JA 2CSYA 2E6SA 2LXHC 3PUQA 5EYAF 2OWAA 5B76A 5G05B 4GNEA 1RMDA 2CSZA 3RPGB 1MBMA 5LCWB 2MKEA 5LKUA 3M62A 2KWKA 2XP0A 2VJEB 3FL2A 3ASLA 2LV9A 1V87A 2LGLA 2XOCA 1WEQA 1Z60A 4BHWA 2FUIA 2F6JA 2IDAA 2YW8A 1F62A 4B86C 1JM7B 3M63A 4R7EA 2M6MA 3O34A 4LK9A 2QICA 1X4JA 2LGVA 2MNYA 4S3OC 3O33A 3KDEC 3L11A 1FP0A 4OGCA 2RI7A 4QF3A 3O70A 5SVIB 2Y1MA 3N9MA 2FSAA 2PUYA 4W4UA 4MSXA 1LDKC 3SOXA 5C11A 2RSDA 2DSMA 4FK5A 2KE1A 2F6NA 4TKPB 2JM3A 2YHNA 2KWJA 4I7BA 1X4UA 3FJUB 4IC2A 4F52B 3FANA 2JMIA 1WESA 3FEHA 4NN2A 2EODA 2LAUA 2MIQA 1WEMA 2D8SA 1Z6UA 3KV5A 3M99A 1MM2A 5FB1A 1WEUA 1Z2QA 4LKAA 5G0FA 4N3WA 2FUUA 2KWNA 3SOWA 3SHBA 4YAXA 2KR4A 3U5OA 2M13A 5B8DA 2PNXA 4PPEA 1VD4A 2XOZA 3PLWA 4YADA 2ZETC 4FJCA 4QQ4A 1WEWA 2ECJA 2YREA 2G43A 1LDJB 2YVRA 2KWOA 4R8PK 3EB6A 1E4UA 3L1XA 4Z0RA 5KH3A 2MA6A 3ZVYA 3O36A 3DDTA 4YBSA 2K4DA 2MA5A 3M7KA 2KFTA 3ZPV1 4BBQA 4A4BA 5TDWA 2C2LA 2LGGA 4YABA 2CRRA 3O47A 3SOUA 2CRWA 4YBMA 2NAAA 2YT5A 2VPDA 1WFKA 3C6WA 2L7PA 3HTKC 5KH9A 3ZVZB 5TDRA 3LJUX 3GV4A 4FO9A 2M85A 2YQMA 2MNZA 5SVYA 3RTRB 3LQIA 4P5OB 4GNFA 2L43A 2LXPC 2M1RA 2ECVA 3KQIA 4ZQLA 5H1TA 2E61A 3PHDA 3N9QA 2H0DA 2L5UA 3QZVA 1WENA 2QJ0A 1WEEA 5LKXA 3KV6A 2KGIA 2YSJA 2CSVA 5TABA 5FERA 2VNFA 2LRIC 2RR4A 3GL6A 2FD4A 5I3LA 2XOYA 2ECGA 4LADB 2H0DB 2MUMA 4A4CA 4AP4A 2CONA 2CKLA 4QF2A 5B79A 2DX8A 3LDYA 4UP5A 2FFWA 2JUNA 4CCGX 1WEPA 2EA6A 2Y1NA 3IHPA 4YC9A 2DJAA 4AVXA 4A0CD 1WEVA 2M3HA 5J3XA 5SVXA 3N9PA 3E2DA 2JRJA 3T6RA 2KKXA 4L7XA 5KH7A 1CHCA 2MT5A 5B77A 2P57A 2CKLB 3O7AA 4LJNA 3H7HA 3N9OA 4AUQB 2YHOA 3ZTGA 2KKYA 2LN0A 1IYMA 4H9DA 2YU4A 4A49A 1T1HA 2HDPA 2OXQC 2ECWA 2E6RA 1XWHA 2VP7A 4YBTA 2LQ6A 2YYRA 1X4IA 2I50A 4O64A 3ZNIA 1K2FA 1VYXA 4S3OB 1WIMA 5DKAA 1HYIA 2IQJA 4Z0OA 2EXUA 4WA6A 3DPLR 4ZDTA 3HCUA 2K17A 3ZYQA 2Y43A 5TRBA 2ECNA 3MDBC 1DVPA 1VFYA 5AIUA 3LQHA 4O62A 2L0BA 4FIPA 2VPEA 5H1VA 2G6QA 2VJEA 2D8UA 4PTBA 4F1PA
chains in the Genus database with same CATH topology
4GNGA 2L80A 2G45A 4XI1A 4YATA 4N4FA 3N9NA 5LKTA 2KIZA 3DQVR 5DINA 1JM7A 5D1LB 2VJFA 3I2DA 5D1KB 2HYED 5LKZA 2ECIA 1BORA 1U6GB 2QIZA 3LRQA 3EB5A 4MVTA 2KREA 2YQLA 3U5MA 2UZGA 4I7CA 1WGMA 4LLBA 3T7LA 2EGPA 2F42A 2VJFB 4L58A 2JMDA 5G04B 2ECTA 2MD7B 5C13A 3N9LA 2BAYA 2YUCA 4GNDA 3V43A 2YURA 2KU3A 3U5NA 2CT2A 4C9ZA 4WZ3B 3KNVA 4UI9B 3NG2A 5AITA 1WEOA 1N87A 2KGGA 5H9MA 2VPGA 1WE9A 3RPGC 3O35A 5B78A 2VPBA 4CA1A 2XEUA 3LQJA 4UP0A 4X3GA 3PURA 3L1ZB 4V3KC 5FB0A 3C5KA 5D1MB 4I7DA 2LDRA 4WZ0A 4WZ2A 4IC3A 4R2YA 5FEYA 4AYCA 3HCSA 2LGKA 1ZBDB 1HYJA 1G25A 1MM3A 3VK6A 1FBVA 2K16A 1WILA 4Q6FA 5TBNA 4V3LC 3HCTA 2KYUA 2L75A 5H1UA 2C2VS 3ZPVE 3U5PA 4GB0A 5B75A 2YSMA 4AYCB 4ZUXU 2XB1A 5JG6A 2MD8C 2JMJA 4B7YC 3MHHA 2AN6A 1JOCA 3O37A 3MHSA 2K1JA 2CSYA 2E6SA 2LXHC 3PUQA 5EYAF 5B76A 5G05B 4GNEA 1RMDA 2CSZA 3RPGB 5LCWB 5LKUA 3M62A 2KWKA 2VJEB 3FL2A 3ASLA 2LV9A 1V87A 2LGLA 1WEQA 1Z60A 4BHWA 2FUIA 2F6JA 2IDAA 2YW8A 1F62A 4B86C 1JM7B 3M63A 4R7EA 2M6MA 3O34A 4LK9A 2QICA 1X4JA 2LGVA 2MNYA 4S3OC 3O33A 3L11A 1FP0A 2RI7A 4QF3A 3O70A 2Y1MA 3N9MA 2FSAA 2PUYA 4W4UA 4MSXA 1LDKC 3SOXA 5C11A 2RSDA 4FK5A 2KE1A 2F6NA 4TKPB 2YHNA 2KWJA 4I7BA 1X4UA 4IC2A 4F52B 2JMIA 1WESA 4NN2A 2EODA 2MIQA 1WEMA 2D8SA 1Z6UA 3KV5A 3M99A 1MM2A 5FB1A 1WEUA 1Z2QA 4LKAA 5G0FA 4N3WA 2FUUA 2KWNA 3SOWA 3SHBA 4YAXA 2KR4A 3U5OA 5B8DA 2PNXA 4PPEA 1VD4A 4YADA 2ZETC 4FJCA 1WEWA 2ECJA 2YREA 2G43A 1LDJB 2KWOA 4R8PK 3EB6A 1E4UA 3L1XA 5KH3A 2MA6A 3ZVYA 3O36A 4YBSA 2K4DA 2MA5A 2KFTA 3ZPV1 4BBQA 4A4BA 5TDWA 2C2LA 2LGGA 4YABA 3SOUA 4YBMA 2NAAA 2YT5A 2VPDA 1WFKA 3C6WA 3HTKC 5KH9A 3ZVZB 5TDRA 3GV4A 4FO9A 2M85A 2YQMA 2MNZA 3RTRB 3LQIA 4P5OB 4GNFA 2L43A 2LXPC 2M1RA 2ECVA 3KQIA 4ZQLA 5H1TA 3PHDA 3N9QA 2H0DA 2L5UA 3QZVA 1WENA 2QJ0A 1WEEA 5LKXA 3KV6A 2KGIA 2YSJA 5FERA 5TABA 2VNFA 2LRIC 3GL6A 5I3LA 2ECGA 4LADB 2H0DB 2MUMA 4A4CA 4AP4A 2CKLA 4QF2A 5B79A 2DX8A 4UP5A 4CCGX 1WEPA 2EA6A 2Y1NA 3IHPA 4YC9A 4AVXA 4A0CD 1WEVA 2M3HA 5J3XA 3N9PA 2JRJA 3T6RA 4L7XA 5KH7A 1CHCA 2MT5A 5B77A 2CKLB 3O7AA 4LJNA 3N9OA 4AUQB 2YHOA 3ZTGA 2LN0A 1IYMA 2YU4A 4A49A 1T1HA 2HDPA 2OXQC 2ECWA 2E6RA 1XWHA 2VP7A 4YBTA 2LQ6A 2YYRA 1X4IA 2I50A 4O64A 3ZNIA 1K2FA 1VYXA 4S3OB 1WIMA 5DKAA 1HYIA 4WA6A 3DPLR 4ZDTA 3HCUA 2K17A 3ZYQA 2Y43A 5TRBA 2ECNA 1DVPA 1VFYA 5AIUA 3LQHA 2L0BA 4FIPA 2VPEA 5H1VA 2G6QA 2VJEA 4PTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNG A;  2L80 A;  2G45 A;  4XI1 A;  4YAT A;  4N4F A;  3N9N A;  5LKT A;  2KIZ A;  3DQV R;  5DIN A;  1JM7 A;  5D1L B;  2VJF A;  3I2D A;  5D1K B;  2HYE D;  5LKZ A;  2ECI A;  1BOR A;  1U6G B;  2QIZ A;  3LRQ A;  3EB5 A;  4MVT A;  2KRE A;  2YQL A;  3U5M A;  2UZG A;  4I7C A;  1WGM A;  4LLB A;  3T7L A;  2EGP A;  2F42 A;  2VJF B;  4L58 A;  2JMD A;  5G04 B;  2ECT A;  2MD7 B;  5C13 A;  3N9L A;  2BAY A;  2YUC A;  4GND A;  3V43 A;  2YUR A;  2KU3 A;  3U5N A;  2CT2 A;  4C9Z A;  4WZ3 B;  3KNV A;  4UI9 B;  3NG2 A;  5AIT A;  1WEO A;  1N87 A;  2KGG A;  5H9M A;  2VPG A;  1WE9 A;  3RPG C;  3O35 A;  5B78 A;  2VPB A;  4CA1 A;  2XEU A;  3LQJ A;  4UP0 A;  4X3G A;  3PUR A;  3L1Z B;  4V3K C;  5FB0 A;  3C5K A;  5D1M B;  4I7D A;  2LDR A;  4WZ0 A;  4WZ2 A;  4IC3 A;  4R2Y A;  5FEY A;  4AYC A;  3HCS A;  2LGK A;  1ZBD B;  1HYJ A;  1G25 A;  1MM3 A;  3VK6 A;  1FBV A;  2K16 A;  1WIL A;  4Q6F A;  5TBN A;  4V3L C;  3HCT A;  2KYU A;  2L75 A;  5H1U A;  2C2V S;  3ZPV E;  3U5P A;  4GB0 A;  5B75 A;  2YSM A;  4AYC B;  4ZUX U;  2XB1 A;  5JG6 A;  2MD8 C;  2JMJ A;  4B7Y C;  3MHH A;  2AN6 A;  1JOC A;  3O37 A;  3MHS A;  2K1J A;  2CSY A;  2E6S A;  2LXH C;  3PUQ A;  5EYA F;  5B76 A;  5G05 B;  4GNE A;  1RMD A;  2CSZ A;  3RPG B;  5LCW B;  5LKU A;  3M62 A;  2KWK A;  2VJE B;  3FL2 A;  3ASL A;  2LV9 A;  1V87 A;  2LGL A;  1WEQ A;  1Z60 A;  4BHW A;  2FUI A;  2F6J A;  2IDA A;  2YW8 A;  1F62 A;  4B86 C;  1JM7 B;  3M63 A;  4R7E A;  2M6M A;  3O34 A;  4LK9 A;  2QIC A;  1X4J A;  2LGV A;  2MNY A;  4S3O C;  3O33 A;  3L11 A;  1FP0 A;  2RI7 A;  4QF3 A;  3O70 A;  2Y1M A;  3N9M A;  2FSA A;  2PUY A;  4W4U A;  4MSX A;  1LDK C;  3SOX A;  5C11 A;  2RSD A;  4FK5 A;  2KE1 A;  2F6N A;  4TKP B;  2YHN A;  2KWJ A;  4I7B A;  1X4U A;  4IC2 A;  4F52 B;  2JMI A;  1WES A;  4NN2 A;  2EOD A;  2MIQ A;  1WEM A;  2D8S A;  1Z6U A;  3KV5 A;  3M99 A;  1MM2 A;  5FB1 A;  1WEU A;  1Z2Q A;  4LKA A;  5G0F A;  4N3W A;  2FUU A;  2KWN A;  3SOW A;  3SHB A;  4YAX A;  2KR4 A;  3U5O A;  5B8D A;  2PNX A;  4PPE A;  1VD4 A;  4YAD A;  2ZET C;  4FJC A;  1WEW A;  2ECJ A;  2YRE A;  2G43 A;  1LDJ B;  2KWO A;  4R8P K;  3EB6 A;  1E4U A;  3L1X A;  5KH3 A;  2MA6 A;  3ZVY A;  3O36 A;  4YBS A;  2K4D A;  2MA5 A;  2KFT A;  3ZPV 1;  4BBQ A;  4A4B A;  5TDW A;  2C2L A;  2LGG A;  4YAB A;  3SOU A;  4YBM A;  2NAA A;  2YT5 A;  2VPD A;  1WFK A;  3C6W A;  3HTK C;  5KH9 A;  3ZVZ B;  5TDR A;  3GV4 A;  4FO9 A;  2M85 A;  2YQM A;  2MNZ A;  3RTR B;  3LQI A;  4P5O B;  4GNF A;  2L43 A;  2LXP C;  2M1R A;  2ECV A;  3KQI A;  4ZQL A;  5H1T A;  3PHD A;  3N9Q A;  2H0D A;  2L5U A;  3QZV A;  1WEN A;  2QJ0 A;  1WEE A;  5LKX A;  3KV6 A;  2KGI A;  2YSJ A;  5FER A;  5TAB A;  2VNF A;  2LRI C;  3GL6 A;  5I3L A;  2ECG A;  4LAD B;  2H0D B;  2MUM A;  4A4C A;  4AP4 A;  2CKL A;  4QF2 A;  5B79 A;  2DX8 A;  4UP5 A;  4CCG X;  1WEP A;  2EA6 A;  2Y1N A;  3IHP A;  4YC9 A;  4AVX A;  4A0C D;  1WEV A;  2M3H A;  5J3X A;  3N9P A;  2JRJ A;  3T6R A;  4L7X A;  5KH7 A;  1CHC A;  2MT5 A;  5B77 A;  2CKL B;  3O7A A;  4LJN A;  3N9O A;  4AUQ B;  2YHO A;  3ZTG A;  2LN0 A;  1IYM A;  2YU4 A;  4A49 A;  1T1H A;  2HDP A;  2OXQ C;  2ECW A;  2E6R A;  1XWH A;  2VP7 A;  4YBT A;  2LQ6 A;  2YYR A;  1X4I A;  2I50 A;  4O64 A;  3ZNI A;  1K2F A;  1VYX A;  4S3O B;  1WIM A;  5DKA A;  1HYI A;  4WA6 A;  3DPL R;  4ZDT A;  3HCU A;  2K17 A;  3ZYQ A;  2Y43 A;  5TRB A;  2ECN A;  1DVP A;  1VFY A;  5AIU A;  3LQH A;  2L0B A;  4FIP A;  2VPE A;  5H1V A;  2G6Q A;  2VJE A;  4PTB A; 
#chains in the Genus database with same CATH topology
 4GNG A;  2L80 A;  2G45 A;  4XI1 A;  4YAT A;  4N4F A;  4OGE A;  3N9N A;  5LKT A;  3SUB A;  2KIZ A;  3DQV R;  5DIN A;  1JM7 A;  5D1L B;  2VJF A;  3I2D A;  5D1K B;  2HYE D;  2EGM A;  5LKZ A;  2ECI A;  1BOR A;  1U6G B;  2QIZ A;  3LRQ A;  3EB5 A;  4MVT A;  2KRE A;  2YQL A;  3U5M A;  2UZG A;  4I7C A;  1WGM A;  4LLB A;  3T7L A;  1DCQ A;  5SVI A;  2EGP A;  2F42 A;  2VJF B;  3Q1D A;  5K3Q A;  4L58 A;  2JMD A;  5G04 B;  2ECT A;  2MD7 B;  5C13 A;  3N9L A;  2BAY A;  2YUC A;  3DWD A;  4GND A;  3V43 A;  2YUR A;  2KU3 A;  3U5N A;  2CT2 A;  4C9Z A;  4WZ3 B;  3KNV A;  3LVR E;  4UI9 B;  3NG2 A;  5AIT A;  1WEO A;  1N87 A;  2KGG A;  5H9M A;  2VPG A;  1WE9 A;  3RPG C;  3O35 A;  5B78 A;  2VPB A;  4CA1 A;  2XEU A;  3LQJ A;  3LVQ E;  4UP0 A;  3FAO A;  4X3G A;  3PUR A;  3L1Z B;  4V3K C;  5FB0 A;  3FM8 C;  2B0O E;  3C5K A;  5D1M B;  4I7D A;  2LDR A;  4WZ0 A;  4WZ2 A;  4IC3 A;  4R2Y A;  5FEY A;  4AYC A;  3HCS A;  2LGK A;  1ZBD B;  1HYJ A;  1G25 A;  1MM3 A;  3VK6 A;  1FBV A;  2K16 A;  4Q6F A;  1WIL A;  3JUE A;  5TBN A;  4V3L C;  3HCT A;  2KYU A;  2L75 A;  5H1U A;  2C2V S;  3ZPV E;  3U5P A;  4GB0 A;  5B75 A;  2YSM A;  4AYC B;  4ZUX U;  2XB1 A;  5JG6 A;  2MD8 C;  2JMJ A;  3T9K A;  4B7Y C;  3MHH A;  2AN6 A;  1JOC A;  3O37 A;  3MHS A;  2K1J A;  2CSY A;  2E6S A;  2LXH C;  3PUQ A;  5EYA F;  2OWA A;  5B76 A;  5G05 B;  4GNE A;  1RMD A;  2CSZ A;  3RPG B;  1MBM A;  5LCW B;  2MKE A;  5LKU A;  3M62 A;  2KWK A;  2XP0 A;  2VJE B;  3FL2 A;  3ASL A;  2LV9 A;  1V87 A;  2LGL A;  2XOC A;  1WEQ A;  1Z60 A;  4BHW A;  2FUI A;  2F6J A;  2IDA A;  2YW8 A;  1F62 A;  4B86 C;  1JM7 B;  3M63 A;  4R7E A;  2M6M A;  3O34 A;  4LK9 A;  2QIC A;  1X4J A;  2LGV A;  2MNY A;  4S3O C;  3O33 A;  3KDE C;  3L11 A;  1FP0 A;  4OGC A;  2RI7 A;  4QF3 A;  3O70 A;  5SVI B;  2Y1M A;  3N9M A;  2FSA A;  2PUY A;  4W4U A;  4MSX A;  1LDK C;  3SOX A;  5C11 A;  2RSD A;  2DSM A;  4FK5 A;  2KE1 A;  2F6N A;  4TKP B;  2JM3 A;  2YHN A;  2KWJ A;  4I7B A;  1X4U A;  3FJU B;  4IC2 A;  4F52 B;  3FAN A;  2JMI A;  1WES A;  3FEH A;  4NN2 A;  2EOD A;  2LAU A;  2MIQ A;  1WEM A;  2D8S A;  1Z6U A;  3KV5 A;  3M99 A;  1MM2 A;  5FB1 A;  1WEU A;  1Z2Q A;  4LKA A;  5G0F A;  4N3W A;  2FUU A;  2KWN A;  3SOW A;  3SHB A;  4YAX A;  2KR4 A;  3U5O A;  2M13 A;  5B8D A;  2PNX A;  4PPE A;  1VD4 A;  2XOZ A;  3PLW A;  4YAD A;  2ZET C;  4FJC A;  4QQ4 A;  1WEW A;  2ECJ A;  2YRE A;  2G43 A;  1LDJ B;  2YVR A;  2KWO A;  4R8P K;  3EB6 A;  1E4U A;  3L1X A;  4Z0R A;  5KH3 A;  2MA6 A;  3ZVY A;  3O36 A;  3DDT A;  4YBS A;  2K4D A;  2MA5 A;  3M7K A;  2KFT A;  3ZPV 1;  4BBQ A;  4A4B A;  5TDW A;  2C2L A;  2LGG A;  4YAB A;  2CRR A;  3O47 A;  3SOU A;  2CRW A;  4YBM A;  2NAA A;  2YT5 A;  2VPD A;  1WFK A;  3C6W A;  2L7P A;  3HTK C;  5KH9 A;  3ZVZ B;  5TDR A;  3LJU X;  3GV4 A;  4FO9 A;  2M85 A;  2YQM A;  2MNZ A;  5SVY A;  3RTR B;  3LQI A;  4P5O B;  4GNF A;  2L43 A;  2LXP C;  2M1R A;  2ECV A;  3KQI A;  4ZQL A;  5H1T A;  2E61 A;  3PHD A;  3N9Q A;  2H0D A;  2L5U A;  3QZV A;  1WEN A;  2QJ0 A;  1WEE A;  5LKX A;  3KV6 A;  2KGI A;  2YSJ A;  2CSV A;  5TAB A;  5FER A;  2VNF A;  2LRI C;  2RR4 A;  3GL6 A;  2FD4 A;  5I3L A;  2XOY A;  2ECG A;  4LAD B;  2H0D B;  2MUM A;  4A4C A;  4AP4 A;  2CON A;  2CKL A;  4QF2 A;  5B79 A;  2DX8 A;  3LDY A;  4UP5 A;  2FFW A;  2JUN A;  4CCG X;  1WEP A;  2EA6 A;  2Y1N A;  3IHP A;  4YC9 A;  2DJA A;  4AVX A;  4A0C D;  1WEV A;  2M3H A;  5J3X A;  5SVX A;  3N9P A;  3E2D A;  2JRJ A;  3T6R A;  2KKX A;  4L7X A;  5KH7 A;  1CHC A;  2MT5 A;  5B77 A;  2P57 A;  2CKL B;  3O7A A;  4LJN A;  3H7H A;  3N9O A;  4AUQ B;  2YHO A;  3ZTG A;  2KKY A;  2LN0 A;  1IYM A;  4H9D A;  2YU4 A;  4A49 A;  1T1H A;  2HDP A;  2OXQ C;  2ECW A;  2E6R A;  1XWH A;  2VP7 A;  4YBT A;  2LQ6 A;  2YYR A;  1X4I A;  2I50 A;  4O64 A;  3ZNI A;  1K2F A;  1VYX A;  4S3O B;  1WIM A;  5DKA A;  1HYI A;  2IQJ A;  4Z0O A;  2EXU A;  4WA6 A;  3DPL R;  4ZDT A;  3HCU A;  2K17 A;  3ZYQ A;  2Y43 A;  5TRB A;  2ECN A;  3MDB C;  1DVP A;  1VFY A;  5AIU A;  3LQH A;  4O62 A;  2L0B A;  4FIP A;  2VPE A;  5H1V A;  2G6Q A;  2VJE A;  2D8U A;  4PTB A;  4F1P A; 
#chains in the Genus database with same CATH homology
 4GNG A;  2L80 A;  2G45 A;  4XI1 A;  4YAT A;  4N4F A;  3N9N A;  5LKT A;  2KIZ A;  3DQV R;  5DIN A;  1JM7 A;  5D1L B;  2VJF A;  3I2D A;  5D1K B;  2HYE D;  5LKZ A;  2ECI A;  1BOR A;  1U6G B;  2QIZ A;  3LRQ A;  3EB5 A;  4MVT A;  2KRE A;  2YQL A;  3U5M A;  2UZG A;  4I7C A;  1WGM A;  4LLB A;  3T7L A;  2EGP A;  2F42 A;  2VJF B;  4L58 A;  2JMD A;  5G04 B;  2ECT A;  2MD7 B;  5C13 A;  3N9L A;  2BAY A;  2YUC A;  4GND A;  3V43 A;  2YUR A;  2KU3 A;  3U5N A;  2CT2 A;  4C9Z A;  4WZ3 B;  3KNV A;  4UI9 B;  3NG2 A;  5AIT A;  1WEO A;  1N87 A;  2KGG A;  5H9M A;  2VPG A;  1WE9 A;  3RPG C;  3O35 A;  5B78 A;  2VPB A;  4CA1 A;  2XEU A;  3LQJ A;  4UP0 A;  4X3G A;  3PUR A;  3L1Z B;  4V3K C;  5FB0 A;  3C5K A;  5D1M B;  4I7D A;  2LDR A;  4WZ0 A;  4WZ2 A;  4IC3 A;  4R2Y A;  5FEY A;  4AYC A;  3HCS A;  2LGK A;  1ZBD B;  1HYJ A;  1G25 A;  1MM3 A;  3VK6 A;  1FBV A;  2K16 A;  1WIL A;  4Q6F A;  5TBN A;  4V3L C;  3HCT A;  2KYU A;  2L75 A;  5H1U A;  2C2V S;  3ZPV E;  3U5P A;  4GB0 A;  5B75 A;  2YSM A;  4AYC B;  4ZUX U;  2XB1 A;  5JG6 A;  2MD8 C;  2JMJ A;  4B7Y C;  3MHH A;  2AN6 A;  1JOC A;  3O37 A;  3MHS A;  2K1J A;  2CSY A;  2E6S A;  2LXH C;  3PUQ A;  5EYA F;  5B76 A;  5G05 B;  4GNE A;  1RMD A;  2CSZ A;  3RPG B;  5LCW B;  5LKU A;  3M62 A;  2KWK A;  2VJE B;  3FL2 A;  3ASL A;  2LV9 A;  1V87 A;  2LGL A;  1WEQ A;  1Z60 A;  4BHW A;  2FUI A;  2F6J A;  2IDA A;  2YW8 A;  1F62 A;  4B86 C;  1JM7 B;  3M63 A;  4R7E A;  2M6M A;  3O34 A;  4LK9 A;  2QIC A;  1X4J A;  2LGV A;  2MNY A;  4S3O C;  3O33 A;  3L11 A;  1FP0 A;  2RI7 A;  4QF3 A;  3O70 A;  2Y1M A;  3N9M A;  2FSA A;  2PUY A;  4W4U A;  4MSX A;  1LDK C;  3SOX A;  5C11 A;  2RSD A;  4FK5 A;  2KE1 A;  2F6N A;  4TKP B;  2YHN A;  2KWJ A;  4I7B A;  1X4U A;  4IC2 A;  4F52 B;  2JMI A;  1WES A;  4NN2 A;  2EOD A;  2MIQ A;  1WEM A;  2D8S A;  1Z6U A;  3KV5 A;  3M99 A;  1MM2 A;  5FB1 A;  1WEU A;  1Z2Q A;  4LKA A;  5G0F A;  4N3W A;  2FUU A;  2KWN A;  3SOW A;  3SHB A;  4YAX A;  2KR4 A;  3U5O A;  5B8D A;  2PNX A;  4PPE A;  1VD4 A;  4YAD A;  2ZET C;  4FJC A;  1WEW A;  2ECJ A;  2YRE A;  2G43 A;  1LDJ B;  2KWO A;  4R8P K;  3EB6 A;  1E4U A;  3L1X A;  5KH3 A;  2MA6 A;  3ZVY A;  3O36 A;  4YBS A;  2K4D A;  2MA5 A;  2KFT A;  3ZPV 1;  4BBQ A;  4A4B A;  5TDW A;  2C2L A;  2LGG A;  4YAB A;  3SOU A;  4YBM A;  2NAA A;  2YT5 A;  2VPD A;  1WFK A;  3C6W A;  3HTK C;  5KH9 A;  3ZVZ B;  5TDR A;  3GV4 A;  4FO9 A;  2M85 A;  2YQM A;  2MNZ A;  3RTR B;  3LQI A;  4P5O B;  4GNF A;  2L43 A;  2LXP C;  2M1R A;  2ECV A;  3KQI A;  4ZQL A;  5H1T A;  3PHD A;  3N9Q A;  2H0D A;  2L5U A;  3QZV A;  1WEN A;  2QJ0 A;  1WEE A;  5LKX A;  3KV6 A;  2KGI A;  2YSJ A;  5FER A;  5TAB A;  2VNF A;  2LRI C;  3GL6 A;  5I3L A;  2ECG A;  4LAD B;  2H0D B;  2MUM A;  4A4C A;  4AP4 A;  2CKL A;  4QF2 A;  5B79 A;  2DX8 A;  4UP5 A;  4CCG X;  1WEP A;  2EA6 A;  2Y1N A;  3IHP A;  4YC9 A;  4AVX A;  4A0C D;  1WEV A;  2M3H A;  5J3X A;  3N9P A;  2JRJ A;  3T6R A;  4L7X A;  5KH7 A;  1CHC A;  2MT5 A;  5B77 A;  2CKL B;  3O7A A;  4LJN A;  3N9O A;  4AUQ B;  2YHO A;  3ZTG A;  2LN0 A;  1IYM A;  2YU4 A;  4A49 A;  1T1H A;  2HDP A;  2OXQ C;  2ECW A;  2E6R A;  1XWH A;  2VP7 A;  4YBT A;  2LQ6 A;  2YYR A;  1X4I A;  2I50 A;  4O64 A;  3ZNI A;  1K2F A;  1VYX A;  4S3O B;  1WIM A;  5DKA A;  1HYI A;  4WA6 A;  3DPL R;  4ZDT A;  3HCU A;  2K17 A;  3ZYQ A;  2Y43 A;  5TRB A;  2ECN A;  1DVP A;  1VFY A;  5AIU A;  3LQH A;  2L0B A;  4FIP A;  2VPE A;  5H1V A;  2G6Q A;  2VJE A;  4PTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...