2YW8A

Crystal structure of human run and fyve domain-containing protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
61
structure length
61
Chain Sequence
KDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUN and FYVE domain-containing protein 1
publication title Crystal structure of human RUN and FYVE domain-containing protein
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 11
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2yw8A00
3MHHA 3GL6A 2C2LA 1WILA 3N9QA 3U5PA 2L43A 4CCGX 4QF2A 2M6MA 4YBMA 5TABA 2E6RA 2YREA 3HCSA 5FB0A 4ZDTA 4B7YC 4YBSA 1HYIA 3QZVA 2LRIC 4FJCA 3RPGB 3L11A 4Q6FA 3N9OA 2CKLA 2YSMA 1X4IA 2QICA 5G0FA 2YUCA 4WZ0A 5AITA 2L75A 2MIQA 2KWJA 2LXPC 3HCTA 3RTRB 3KQIA 3T6RA 2L0BA 1WEWA 2I50A 3U5NA 5D1KB 2ECJA 4BHWA 2YQMA 4W4UA 4GNEA 2LGVA 1HYJA 1ZBDB 4A0CD 3MHSA 2ECWA 1WEOA 1JOCA 3N9PA 2LXHC 4WZ3B 5H1UA 2KFTA 1WESA 1WEMA 1RMDA 4LLBA 4MSXA 4GB0A 2VJFA 2KYUA 3ZNIA 2G6QA 2L80A 2K16A 4N4FA 1WFKA 4YABA 1IYMA 2VP7A 4GNDA 4YATA 4XI1A 2Y43A 3N9MA 5I3LA 2PUYA 3GV4A 1WEVA 3LQJA 5DKAA 3SHBA 5FERA 2BAYA 4R2YA 3T7LA 2MD8C 3DPLR 3O34A 2XB1A 5D1LB 3KV5A 3LQIA 5JG6A 5TDWA 1VFYA 5B8DA 4F52B 1Z6UA 2EODA 2AN6A 5C11A 2F6NA 4LKAA 5LKUA 1FBVA 2LV9A 3LQHA 5AIUA 2Y1NA 1WENA 2OXQC 1Z2QA 3KNVA 4FIPA 2LGLA 3SOXA 2VJEA 2YHOA 2H0DB 1MM2A 4PTBA 5LKZA 3U5OA 3O70A 3M62A 4L7XA 2ECVA 3O7AA 2KREA 3NG2A 2M1RA 3SOWA 2YHNA 4A49A 4A4CA 4YBTA 2YSJA 2CKLB 2CSZA 1XWHA 4L58A 4TKPB 2K4DA 3M99A 1T1HA 5B79A 1CHCA 2VPBA 2KWOA 1BORA 2XEUA 5TBNA 2LGKA 1LDKC 5D1MB 4X3GA 2D8SA 4YAXA 1VD4A 2FUUA 4ZQLA 5J3XA 2RSDA 3C6WA 2EGPA 4BBQA 2KU3A 4MVTA 4AVXA 4P5OB 3C5KA 3N9LA 3I2DA 2MA6A 1LDJB 2MA5A 2KIZA 2VJFB 3ZPV1 2FUIA 3ZYQA 2VPDA 2LQ6A 2K1JA 3ZTGA 4B86C 2C2VS 1WIMA 2KWKA 4IC3A 1FP0A 2E6SA 2VPGA 4UP5A 2IDAA 1X4UA 2DX8A 3EB5A 2KE1A 1JM7A 4AYCB 5H9MA 2YQLA 5H1VA 3ZVYA 1N87A 3ASLA 2G43A 2ECIA 2HYED 1DVPA 2MD7B 4LJNA 2YT5A 5KH3A 2KGIA 2ECTA 4LADB 4V3KC 5B77A 4NN2A 3O35A 3N9NA 2CT2A 2G45A 2JMIA 2EA6A 2LN0A 4O64A 3HCUA 4UI9B 1G25A 3L1ZB 2MT5A 2YW8A 4I7DA 2JMJA 2VJEB 5EYAF 1WE9A 5FEYA 3M63A 3PURA 4YC9A 2JMDA 4S3OC 1WEPA 4GNGA 2H0DA 5B76A 3RPGC 4V3LC 2YYRA 2MUMA 2KGGA 3LRQA 4S3OB 5KH9A 2CSYA 4AUQB 4CA1A 4LK9A 2VPEA 5TRBA 1WGMA 1V87A 5G04B 5TDRA 1WEUA 2RI7A 3ZPVE 2Y1MA 2NAAA 3O33A 5KH7A 4N3WA 2JRJA 5B78A 2LDRA 5LKTA 3O36A 4YADA 2HDPA 5H1TA 1WEEA 4I7BA 2PNXA 2L5UA 1VYXA 4QF3A 1F62A 3IHPA 5LKXA 3DQVR 2YU4A 3PHDA 5LCWB 4R7EA 2ECGA 3V43A 1Z60A 2F42A 2F6JA 2KR4A 3EB6A 2QJ0A 5FB1A 3PUQA 1E4UA 2FSAA 3VK6A 2VNFA 4A4BA 4ZUXU 5B75A 3KV6A 3L1XA 1JM7B 4I7CA 5DINA 4R8PK 3FL2A 1WEQA 4PPEA 4AP4A 2M3HA 1K2FA 4FO9A 4FK5A 4IC2A 4C9ZA 2UZGA 4GNFA 4WA6A 4AYCA 2M85A 3ZVZB 5G05B 4WZ2A 2LGGA 4UP0A 2KWNA 2K17A 2MNZA 2QIZA 2ZETC 2YURA 2MNYA 1U6GB 3HTKC 3U5MA 5C13A 1MM3A 3SOUA 2ECNA 1X4JA 3O37A
chains in the Genus database with same CATH superfamily
3MHHA 3GL6A 2C2LA 1WILA 3N9QA 3U5PA 2L43A 4CCGX 4QF2A 4O62A 2M6MA 4YBMA 5TABA 2E6RA 2YREA 3HCSA 5FB0A 4ZDTA 4B7YC 4YBSA 1HYIA 5SVYA 3QZVA 2EXUA 2LRIC 4FJCA 3RPGB 3L11A 4Q6FA 3N9OA 2CKLA 2YSMA 5SVXA 1X4IA 2QICA 5G0FA 2YUCA 3Q1DA 4WZ0A 5K3QA 3LVRE 5AITA 2L75A 2MIQA 2KWJA 4F1PA 2LXPC 2B0OE 3HCTA 3RTRB 3KQIA 3T6RA 2IQJA 2L0BA 1WEWA 2I50A 2LAUA 3U5NA 5D1KB 2ECJA 4BHWA 2P57A 2YQMA 4W4UA 4GNEA 2LGVA 1HYJA 1ZBDB 4A0CD 3FAOA 3MHSA 2ECWA 1WEOA 1JOCA 3N9PA 2LXHC 2M13A 2XOZA 4WZ3B 3FANA 5H1UA 2KFTA 1WESA 1WEMA 1RMDA 4LLBA 4MSXA 4GB0A 2VJFA 3LDYA 2KYUA 3ZNIA 2G6QA 2L80A 2CSVA 2K16A 4N4FA 1WFKA 4YABA 1IYMA 2VP7A 4GNDA 4YATA 4XI1A 2Y43A 3N9MA 5I3LA 2PUYA 3GV4A 1WEVA 3LQJA 5DKAA 3SHBA 5FERA 2DSMA 2DJAA 2BAYA 4R2YA 3T7LA 2MD8C 3DPLR 3O34A 2XB1A 5D1LB 3KV5A 3LQIA 5JG6A 5TDWA 1VFYA 4Z0OA 3LJUX 5B8DA 4F52B 1Z6UA 3DDTA 2EODA 2AN6A 5C11A 2F6NA 4LKAA 5LKUA 1FBVA 2LV9A 3LQHA 5AIUA 2Y1NA 1WENA 2OXQC 3FEHA 1Z2QA 3KNVA 4FIPA 2LGLA 4OGCA 3SOXA 2VJEA 2YHOA 2H0DB 1MM2A 4PTBA 5LKZA 3PLWA 3U5OA 4OGEA 3O70A 3M62A 4L7XA 2ECVA 2OWAA 3O7AA 2KREA 3NG2A 2M1RA 3SOWA 2YHNA 4A49A 4A4CA 4YBTA 2YSJA 2CKLB 2CSZA 1XWHA 4L58A 2CRRA 4TKPB 2K4DA 3M99A 1T1HA 5B79A 1CHCA 2VPBA 2KWOA 1BORA 2XEUA 2YVRA 5TBNA 2LGKA 1LDKC 2CONA 5D1MB 4X3GA 2D8SA 4YAXA 1VD4A 2FUUA 4ZQLA 4H9DA 1MBMA 5J3XA 2RSDA 3C6WA 2EGPA 4Z0RA 4BBQA 2E61A 2KU3A 4MVTA 4AVXA 4P5OB 3C5KA 3N9LA 3I2DA 2MA6A 1LDJB 2MA5A 2KIZA 2VJFB 3ZPV1 2FUIA 3ZYQA 2VPDA 3JUEA 2LQ6A 3FJUB 2K1JA 3ZTGA 4B86C 2C2VS 2JUNA 1WIMA 2KWKA 4IC3A 1FP0A 2E6SA 3LVQE 2JM3A 2VPGA 4UP5A 2IDAA 2EGMA 3KDEC 1X4UA 2DX8A 2KKYA 3EB5A 2KE1A 2MKEA 1JM7A 5SVIA 4AYCB 3FM8C 5H9MA 2YQLA 5H1VA 3ZVYA 1N87A 3ASLA 2G43A 2ECIA 2HYED 4QQ4A 1DVPA 2MD7B 3M7KA 4LJNA 2YT5A 5KH3A 2KGIA 2ECTA 4LADB 4V3KC 5B77A 4NN2A 3O35A 3N9NA 2CT2A 2G45A 2RR4A 2JMIA 2EA6A 2LN0A 2D8UA 4O64A 3HCUA 4UI9B 1G25A 3L1ZB 2MT5A 2YW8A 4I7DA 2JMJA 2VJEB 5EYAF 1WE9A 5FEYA 3M63A 3PURA 4YC9A 3E2DA 2JMDA 4S3OC 1WEPA 4GNGA 2H0DA 5B76A 3RPGC 4V3LC 2YYRA 2MUMA 2KGGA 3LRQA 4S3OB 5KH9A 2CSYA 4AUQB 4CA1A 2FD4A 4LK9A 2VPEA 5TRBA 1WGMA 1V87A 5G04B 5TDRA 1WEUA 2RI7A 3ZPVE 2KKXA 2Y1MA 2NAAA 3O33A 5KH7A 4N3WA 2JRJA 5B78A 3SUBA 2CRWA 2LDRA 5LKTA 3O36A 4YADA 2HDPA 1DCQA 5H1TA 1WEEA 4I7BA 2PNXA 2L5UA 1VYXA 4QF3A 1F62A 3IHPA 5LKXA 3DQVR 2YU4A 3PHDA 5LCWB 2XOCA 4R7EA 2ECGA 3V43A 1Z60A 2F42A 2F6JA 2KR4A 3EB6A 2QJ0A 3DWDA 5FB1A 3PUQA 2FFWA 1E4UA 2FSAA 3VK6A 2VNFA 2XOYA 4A4BA 4ZUXU 2XP0A 5B75A 3T9KA 3KV6A 3L1XA 1JM7B 5SVIB 4I7CA 5DINA 4R8PK 3FL2A 1WEQA 4PPEA 4AP4A 2M3HA 3H7HA 1K2FA 2L7PA 4FK5A 4FO9A 4IC2A 4C9ZA 2UZGA 4GNFA 4WA6A 4AYCA 2M85A 3ZVZB 5G05B 4WZ2A 2LGGA 4UP0A 2KWNA 2K17A 2MNZA 2QIZA 2ZETC 2YURA 3O47A 2MNYA 1U6GB 3HTKC 3MDBC 3U5MA 5C13A 1MM3A 3SOUA 2ECNA 1X4JA 3O37A
chains in the Genus database with same CATH topology
3MHHA 3GL6A 2C2LA 1WILA 3N9QA 3U5PA 2L43A 4CCGX 4QF2A 2M6MA 4YBMA 5TABA 2E6RA 2YREA 3HCSA 5FB0A 4ZDTA 4B7YC 4YBSA 1HYIA 3QZVA 2LRIC 4FJCA 3RPGB 3L11A 4Q6FA 3N9OA 2CKLA 2YSMA 1X4IA 2QICA 5G0FA 2YUCA 4WZ0A 5AITA 2L75A 2MIQA 2KWJA 2LXPC 3HCTA 3RTRB 3KQIA 3T6RA 2L0BA 1WEWA 2I50A 3U5NA 5D1KB 2ECJA 4BHWA 2YQMA 4W4UA 4GNEA 2LGVA 1HYJA 1ZBDB 4A0CD 3MHSA 2ECWA 1WEOA 1JOCA 3N9PA 2LXHC 4WZ3B 5H1UA 2KFTA 1WESA 1WEMA 1RMDA 4LLBA 4MSXA 4GB0A 2VJFA 2KYUA 3ZNIA 2G6QA 2L80A 2K16A 4N4FA 1WFKA 4YABA 1IYMA 2VP7A 4GNDA 4YATA 4XI1A 2Y43A 3N9MA 5I3LA 2PUYA 3GV4A 1WEVA 3LQJA 5DKAA 3SHBA 5FERA 2BAYA 4R2YA 3T7LA 2MD8C 3DPLR 3O34A 2XB1A 5D1LB 3KV5A 3LQIA 5JG6A 5TDWA 1VFYA 5B8DA 4F52B 1Z6UA 2EODA 2AN6A 5C11A 2F6NA 4LKAA 5LKUA 1FBVA 2LV9A 3LQHA 5AIUA 2Y1NA 1WENA 2OXQC 1Z2QA 3KNVA 4FIPA 2LGLA 3SOXA 2VJEA 2YHOA 2H0DB 1MM2A 4PTBA 5LKZA 3U5OA 3O70A 3M62A 4L7XA 2ECVA 3O7AA 2KREA 3NG2A 2M1RA 3SOWA 2YHNA 4A49A 4A4CA 4YBTA 2YSJA 2CKLB 2CSZA 1XWHA 4L58A 4TKPB 2K4DA 3M99A 1T1HA 5B79A 1CHCA 2VPBA 2KWOA 1BORA 2XEUA 5TBNA 2LGKA 1LDKC 5D1MB 4X3GA 2D8SA 4YAXA 1VD4A 2FUUA 4ZQLA 5J3XA 2RSDA 3C6WA 2EGPA 4BBQA 2KU3A 4MVTA 4AVXA 4P5OB 3C5KA 3N9LA 3I2DA 2MA6A 1LDJB 2MA5A 2KIZA 2VJFB 3ZPV1 2FUIA 3ZYQA 2VPDA 2LQ6A 2K1JA 3ZTGA 4B86C 2C2VS 1WIMA 2KWKA 4IC3A 1FP0A 2E6SA 2VPGA 4UP5A 2IDAA 1X4UA 2DX8A 3EB5A 2KE1A 1JM7A 4AYCB 5H9MA 2YQLA 5H1VA 3ZVYA 1N87A 3ASLA 2G43A 2ECIA 2HYED 1DVPA 2MD7B 4LJNA 2YT5A 5KH3A 2KGIA 2ECTA 4LADB 4V3KC 5B77A 4NN2A 3O35A 3N9NA 2CT2A 2G45A 2JMIA 2EA6A 2LN0A 4O64A 3HCUA 4UI9B 1G25A 3L1ZB 2MT5A 2YW8A 4I7DA 2JMJA 2VJEB 5EYAF 1WE9A 5FEYA 3M63A 3PURA 4YC9A 2JMDA 4S3OC 1WEPA 4GNGA 2H0DA 5B76A 3RPGC 4V3LC 2YYRA 2MUMA 2KGGA 3LRQA 4S3OB 5KH9A 2CSYA 4AUQB 4CA1A 4LK9A 2VPEA 5TRBA 1WGMA 1V87A 5G04B 5TDRA 1WEUA 2RI7A 3ZPVE 2Y1MA 2NAAA 3O33A 5KH7A 4N3WA 2JRJA 5B78A 2LDRA 5LKTA 3O36A 4YADA 2HDPA 5H1TA 1WEEA 4I7BA 2PNXA 2L5UA 1VYXA 4QF3A 1F62A 3IHPA 5LKXA 3DQVR 2YU4A 3PHDA 5LCWB 4R7EA 2ECGA 3V43A 1Z60A 2F42A 2F6JA 2KR4A 3EB6A 2QJ0A 5FB1A 3PUQA 1E4UA 2FSAA 3VK6A 2VNFA 4A4BA 4ZUXU 5B75A 3KV6A 3L1XA 1JM7B 4I7CA 5DINA 4R8PK 3FL2A 1WEQA 4PPEA 4AP4A 2M3HA 1K2FA 4FO9A 4FK5A 4IC2A 4C9ZA 2UZGA 4GNFA 4WA6A 4AYCA 2M85A 3ZVZB 5G05B 4WZ2A 2LGGA 4UP0A 2KWNA 2K17A 2MNZA 2QIZA 2ZETC 2YURA 2MNYA 1U6GB 3HTKC 3U5MA 5C13A 1MM3A 3SOUA 2ECNA 1X4JA 3O37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH A;  3GL6 A;  2C2L A;  1WIL A;  3N9Q A;  3U5P A;  2L43 A;  4CCG X;  4QF2 A;  2M6M A;  4YBM A;  5TAB A;  2E6R A;  2YRE A;  3HCS A;  5FB0 A;  4ZDT A;  4B7Y C;  4YBS A;  1HYI A;  3QZV A;  2LRI C;  4FJC A;  3RPG B;  3L11 A;  4Q6F A;  3N9O A;  2CKL A;  2YSM A;  1X4I A;  2QIC A;  5G0F A;  2YUC A;  4WZ0 A;  5AIT A;  2L75 A;  2MIQ A;  2KWJ A;  2LXP C;  3HCT A;  3RTR B;  3KQI A;  3T6R A;  2L0B A;  1WEW A;  2I50 A;  3U5N A;  5D1K B;  2ECJ A;  4BHW A;  2YQM A;  4W4U A;  4GNE A;  2LGV A;  1HYJ A;  1ZBD B;  4A0C D;  3MHS A;  2ECW A;  1WEO A;  1JOC A;  3N9P A;  2LXH C;  4WZ3 B;  5H1U A;  2KFT A;  1WES A;  1WEM A;  1RMD A;  4LLB A;  4MSX A;  4GB0 A;  2VJF A;  2KYU A;  3ZNI A;  2G6Q A;  2L80 A;  2K16 A;  4N4F A;  1WFK A;  4YAB A;  1IYM A;  2VP7 A;  4GND A;  4YAT A;  4XI1 A;  2Y43 A;  3N9M A;  5I3L A;  2PUY A;  3GV4 A;  1WEV A;  3LQJ A;  5DKA A;  3SHB A;  5FER A;  2BAY A;  4R2Y A;  3T7L A;  2MD8 C;  3DPL R;  3O34 A;  2XB1 A;  5D1L B;  3KV5 A;  3LQI A;  5JG6 A;  5TDW A;  1VFY A;  5B8D A;  4F52 B;  1Z6U A;  2EOD A;  2AN6 A;  5C11 A;  2F6N A;  4LKA A;  5LKU A;  1FBV A;  2LV9 A;  3LQH A;  5AIU A;  2Y1N A;  1WEN A;  2OXQ C;  1Z2Q A;  3KNV A;  4FIP A;  2LGL A;  3SOX A;  2VJE A;  2YHO A;  2H0D B;  1MM2 A;  4PTB A;  5LKZ A;  3U5O A;  3O70 A;  3M62 A;  4L7X A;  2ECV A;  3O7A A;  2KRE A;  3NG2 A;  2M1R A;  3SOW A;  2YHN A;  4A49 A;  4A4C A;  4YBT A;  2YSJ A;  2CKL B;  2CSZ A;  1XWH A;  4L58 A;  4TKP B;  2K4D A;  3M99 A;  1T1H A;  5B79 A;  1CHC A;  2VPB A;  2KWO A;  1BOR A;  2XEU A;  5TBN A;  2LGK A;  1LDK C;  5D1M B;  4X3G A;  2D8S A;  4YAX A;  1VD4 A;  2FUU A;  4ZQL A;  5J3X A;  2RSD A;  3C6W A;  2EGP A;  4BBQ A;  2KU3 A;  4MVT A;  4AVX A;  4P5O B;  3C5K A;  3N9L A;  3I2D A;  2MA6 A;  1LDJ B;  2MA5 A;  2KIZ A;  2VJF B;  3ZPV 1;  2FUI A;  3ZYQ A;  2VPD A;  2LQ6 A;  2K1J A;  3ZTG A;  4B86 C;  2C2V S;  1WIM A;  2KWK A;  4IC3 A;  1FP0 A;  2E6S A;  2VPG A;  4UP5 A;  2IDA A;  1X4U A;  2DX8 A;  3EB5 A;  2KE1 A;  1JM7 A;  4AYC B;  5H9M A;  2YQL A;  5H1V A;  3ZVY A;  1N87 A;  3ASL A;  2G43 A;  2ECI A;  2HYE D;  1DVP A;  2MD7 B;  4LJN A;  2YT5 A;  5KH3 A;  2KGI A;  2ECT A;  4LAD B;  4V3K C;  5B77 A;  4NN2 A;  3O35 A;  3N9N A;  2CT2 A;  2G45 A;  2JMI A;  2EA6 A;  2LN0 A;  4O64 A;  3HCU A;  4UI9 B;  1G25 A;  3L1Z B;  2MT5 A;  2YW8 A;  4I7D A;  2JMJ A;  2VJE B;  5EYA F;  1WE9 A;  5FEY A;  3M63 A;  3PUR A;  4YC9 A;  2JMD A;  4S3O C;  1WEP A;  4GNG A;  2H0D A;  5B76 A;  3RPG C;  4V3L C;  2YYR A;  2MUM A;  2KGG A;  3LRQ A;  4S3O B;  5KH9 A;  2CSY A;  4AUQ B;  4CA1 A;  4LK9 A;  2VPE A;  5TRB A;  1WGM A;  1V87 A;  5G04 B;  5TDR A;  1WEU A;  2RI7 A;  3ZPV E;  2Y1M A;  2NAA A;  3O33 A;  5KH7 A;  4N3W A;  2JRJ A;  5B78 A;  2LDR A;  5LKT A;  3O36 A;  4YAD A;  2HDP A;  5H1T A;  1WEE A;  4I7B A;  2PNX A;  2L5U A;  1VYX A;  4QF3 A;  1F62 A;  3IHP A;  5LKX A;  3DQV R;  2YU4 A;  3PHD A;  5LCW B;  4R7E A;  2ECG A;  3V43 A;  1Z60 A;  2F42 A;  2F6J A;  2KR4 A;  3EB6 A;  2QJ0 A;  5FB1 A;  3PUQ A;  1E4U A;  2FSA A;  3VK6 A;  2VNF A;  4A4B A;  4ZUX U;  5B75 A;  3KV6 A;  3L1X A;  1JM7 B;  4I7C A;  5DIN A;  4R8P K;  3FL2 A;  1WEQ A;  4PPE A;  4AP4 A;  2M3H A;  1K2F A;  4FO9 A;  4FK5 A;  4IC2 A;  4C9Z A;  2UZG A;  4GNF A;  4WA6 A;  4AYC A;  2M85 A;  3ZVZ B;  5G05 B;  4WZ2 A;  2LGG A;  4UP0 A;  2KWN A;  2K17 A;  2MNZ A;  2QIZ A;  2ZET C;  2YUR A;  2MNY A;  1U6G B;  3HTK C;  3U5M A;  5C13 A;  1MM3 A;  3SOU A;  2ECN A;  1X4J A;  3O37 A; 
#chains in the Genus database with same CATH topology
 3MHH A;  3GL6 A;  2C2L A;  1WIL A;  3N9Q A;  3U5P A;  2L43 A;  4CCG X;  4QF2 A;  4O62 A;  2M6M A;  4YBM A;  5TAB A;  2E6R A;  2YRE A;  3HCS A;  5FB0 A;  4ZDT A;  4B7Y C;  4YBS A;  1HYI A;  5SVY A;  3QZV A;  2EXU A;  2LRI C;  4FJC A;  3RPG B;  3L11 A;  4Q6F A;  3N9O A;  2CKL A;  2YSM A;  5SVX A;  1X4I A;  2QIC A;  5G0F A;  2YUC A;  3Q1D A;  4WZ0 A;  5K3Q A;  3LVR E;  5AIT A;  2L75 A;  2MIQ A;  2KWJ A;  4F1P A;  2LXP C;  2B0O E;  3HCT A;  3RTR B;  3KQI A;  3T6R A;  2IQJ A;  2L0B A;  1WEW A;  2I50 A;  2LAU A;  3U5N A;  5D1K B;  2ECJ A;  4BHW A;  2P57 A;  2YQM A;  4W4U A;  4GNE A;  2LGV A;  1HYJ A;  1ZBD B;  4A0C D;  3FAO A;  3MHS A;  2ECW A;  1WEO A;  1JOC A;  3N9P A;  2LXH C;  2M13 A;  2XOZ A;  4WZ3 B;  3FAN A;  5H1U A;  2KFT A;  1WES A;  1WEM A;  1RMD A;  4LLB A;  4MSX A;  4GB0 A;  2VJF A;  3LDY A;  2KYU A;  3ZNI A;  2G6Q A;  2L80 A;  2CSV A;  2K16 A;  4N4F A;  1WFK A;  4YAB A;  1IYM A;  2VP7 A;  4GND A;  4YAT A;  4XI1 A;  2Y43 A;  3N9M A;  5I3L A;  2PUY A;  3GV4 A;  1WEV A;  3LQJ A;  5DKA A;  3SHB A;  5FER A;  2DSM A;  2DJA A;  2BAY A;  4R2Y A;  3T7L A;  2MD8 C;  3DPL R;  3O34 A;  2XB1 A;  5D1L B;  3KV5 A;  3LQI A;  5JG6 A;  5TDW A;  1VFY A;  4Z0O A;  3LJU X;  5B8D A;  4F52 B;  1Z6U A;  3DDT A;  2EOD A;  2AN6 A;  5C11 A;  2F6N A;  4LKA A;  5LKU A;  1FBV A;  2LV9 A;  3LQH A;  5AIU A;  2Y1N A;  1WEN A;  2OXQ C;  3FEH A;  1Z2Q A;  3KNV A;  4FIP A;  2LGL A;  4OGC A;  3SOX A;  2VJE A;  2YHO A;  2H0D B;  1MM2 A;  4PTB A;  5LKZ A;  3PLW A;  3U5O A;  4OGE A;  3O70 A;  3M62 A;  4L7X A;  2ECV A;  2OWA A;  3O7A A;  2KRE A;  3NG2 A;  2M1R A;  3SOW A;  2YHN A;  4A49 A;  4A4C A;  4YBT A;  2YSJ A;  2CKL B;  2CSZ A;  1XWH A;  4L58 A;  2CRR A;  4TKP B;  2K4D A;  3M99 A;  1T1H A;  5B79 A;  1CHC A;  2VPB A;  2KWO A;  1BOR A;  2XEU A;  2YVR A;  5TBN A;  2LGK A;  1LDK C;  2CON A;  5D1M B;  4X3G A;  2D8S A;  4YAX A;  1VD4 A;  2FUU A;  4ZQL A;  4H9D A;  1MBM A;  5J3X A;  2RSD A;  3C6W A;  2EGP A;  4Z0R A;  4BBQ A;  2E61 A;  2KU3 A;  4MVT A;  4AVX A;  4P5O B;  3C5K A;  3N9L A;  3I2D A;  2MA6 A;  1LDJ B;  2MA5 A;  2KIZ A;  2VJF B;  3ZPV 1;  2FUI A;  3ZYQ A;  2VPD A;  3JUE A;  2LQ6 A;  3FJU B;  2K1J A;  3ZTG A;  4B86 C;  2C2V S;  2JUN A;  1WIM A;  2KWK A;  4IC3 A;  1FP0 A;  2E6S A;  3LVQ E;  2JM3 A;  2VPG A;  4UP5 A;  2IDA A;  2EGM A;  3KDE C;  1X4U A;  2DX8 A;  2KKY A;  3EB5 A;  2KE1 A;  2MKE A;  1JM7 A;  5SVI A;  4AYC B;  3FM8 C;  5H9M A;  2YQL A;  5H1V A;  3ZVY A;  1N87 A;  3ASL A;  2G43 A;  2ECI A;  2HYE D;  4QQ4 A;  1DVP A;  2MD7 B;  3M7K A;  4LJN A;  2YT5 A;  5KH3 A;  2KGI A;  2ECT A;  4LAD B;  4V3K C;  5B77 A;  4NN2 A;  3O35 A;  3N9N A;  2CT2 A;  2G45 A;  2RR4 A;  2JMI A;  2EA6 A;  2LN0 A;  2D8U A;  4O64 A;  3HCU A;  4UI9 B;  1G25 A;  3L1Z B;  2MT5 A;  2YW8 A;  4I7D A;  2JMJ A;  2VJE B;  5EYA F;  1WE9 A;  5FEY A;  3M63 A;  3PUR A;  4YC9 A;  3E2D A;  2JMD A;  4S3O C;  1WEP A;  4GNG A;  2H0D A;  5B76 A;  3RPG C;  4V3L C;  2YYR A;  2MUM A;  2KGG A;  3LRQ A;  4S3O B;  5KH9 A;  2CSY A;  4AUQ B;  4CA1 A;  2FD4 A;  4LK9 A;  2VPE A;  5TRB A;  1WGM A;  1V87 A;  5G04 B;  5TDR A;  1WEU A;  2RI7 A;  3ZPV E;  2KKX A;  2Y1M A;  2NAA A;  3O33 A;  5KH7 A;  4N3W A;  2JRJ A;  5B78 A;  3SUB A;  2CRW A;  2LDR A;  5LKT A;  3O36 A;  4YAD A;  2HDP A;  1DCQ A;  5H1T A;  1WEE A;  4I7B A;  2PNX A;  2L5U A;  1VYX A;  4QF3 A;  1F62 A;  3IHP A;  5LKX A;  3DQV R;  2YU4 A;  3PHD A;  5LCW B;  2XOC A;  4R7E A;  2ECG A;  3V43 A;  1Z60 A;  2F42 A;  2F6J A;  2KR4 A;  3EB6 A;  2QJ0 A;  3DWD A;  5FB1 A;  3PUQ A;  2FFW A;  1E4U A;  2FSA A;  3VK6 A;  2VNF A;  2XOY A;  4A4B A;  4ZUX U;  2XP0 A;  5B75 A;  3T9K A;  3KV6 A;  3L1X A;  1JM7 B;  5SVI B;  4I7C A;  5DIN A;  4R8P K;  3FL2 A;  1WEQ A;  4PPE A;  4AP4 A;  2M3H A;  3H7H A;  1K2F A;  2L7P A;  4FK5 A;  4FO9 A;  4IC2 A;  4C9Z A;  2UZG A;  4GNF A;  4WA6 A;  4AYC A;  2M85 A;  3ZVZ B;  5G05 B;  4WZ2 A;  2LGG A;  4UP0 A;  2KWN A;  2K17 A;  2MNZ A;  2QIZ A;  2ZET C;  2YUR A;  3O47 A;  2MNY A;  1U6G B;  3HTK C;  3MDB C;  3U5M A;  5C13 A;  1MM3 A;  3SOU A;  2ECN A;  1X4J A;  3O37 A; 
#chains in the Genus database with same CATH homology
 3MHH A;  3GL6 A;  2C2L A;  1WIL A;  3N9Q A;  3U5P A;  2L43 A;  4CCG X;  4QF2 A;  2M6M A;  4YBM A;  5TAB A;  2E6R A;  2YRE A;  3HCS A;  5FB0 A;  4ZDT A;  4B7Y C;  4YBS A;  1HYI A;  3QZV A;  2LRI C;  4FJC A;  3RPG B;  3L11 A;  4Q6F A;  3N9O A;  2CKL A;  2YSM A;  1X4I A;  2QIC A;  5G0F A;  2YUC A;  4WZ0 A;  5AIT A;  2L75 A;  2MIQ A;  2KWJ A;  2LXP C;  3HCT A;  3RTR B;  3KQI A;  3T6R A;  2L0B A;  1WEW A;  2I50 A;  3U5N A;  5D1K B;  2ECJ A;  4BHW A;  2YQM A;  4W4U A;  4GNE A;  2LGV A;  1HYJ A;  1ZBD B;  4A0C D;  3MHS A;  2ECW A;  1WEO A;  1JOC A;  3N9P A;  2LXH C;  4WZ3 B;  5H1U A;  2KFT A;  1WES A;  1WEM A;  1RMD A;  4LLB A;  4MSX A;  4GB0 A;  2VJF A;  2KYU A;  3ZNI A;  2G6Q A;  2L80 A;  2K16 A;  4N4F A;  1WFK A;  4YAB A;  1IYM A;  2VP7 A;  4GND A;  4YAT A;  4XI1 A;  2Y43 A;  3N9M A;  5I3L A;  2PUY A;  3GV4 A;  1WEV A;  3LQJ A;  5DKA A;  3SHB A;  5FER A;  2BAY A;  4R2Y A;  3T7L A;  2MD8 C;  3DPL R;  3O34 A;  2XB1 A;  5D1L B;  3KV5 A;  3LQI A;  5JG6 A;  5TDW A;  1VFY A;  5B8D A;  4F52 B;  1Z6U A;  2EOD A;  2AN6 A;  5C11 A;  2F6N A;  4LKA A;  5LKU A;  1FBV A;  2LV9 A;  3LQH A;  5AIU A;  2Y1N A;  1WEN A;  2OXQ C;  1Z2Q A;  3KNV A;  4FIP A;  2LGL A;  3SOX A;  2VJE A;  2YHO A;  2H0D B;  1MM2 A;  4PTB A;  5LKZ A;  3U5O A;  3O70 A;  3M62 A;  4L7X A;  2ECV A;  3O7A A;  2KRE A;  3NG2 A;  2M1R A;  3SOW A;  2YHN A;  4A49 A;  4A4C A;  4YBT A;  2YSJ A;  2CKL B;  2CSZ A;  1XWH A;  4L58 A;  4TKP B;  2K4D A;  3M99 A;  1T1H A;  5B79 A;  1CHC A;  2VPB A;  2KWO A;  1BOR A;  2XEU A;  5TBN A;  2LGK A;  1LDK C;  5D1M B;  4X3G A;  2D8S A;  4YAX A;  1VD4 A;  2FUU A;  4ZQL A;  5J3X A;  2RSD A;  3C6W A;  2EGP A;  4BBQ A;  2KU3 A;  4MVT A;  4AVX A;  4P5O B;  3C5K A;  3N9L A;  3I2D A;  2MA6 A;  1LDJ B;  2MA5 A;  2KIZ A;  2VJF B;  3ZPV 1;  2FUI A;  3ZYQ A;  2VPD A;  2LQ6 A;  2K1J A;  3ZTG A;  4B86 C;  2C2V S;  1WIM A;  2KWK A;  4IC3 A;  1FP0 A;  2E6S A;  2VPG A;  4UP5 A;  2IDA A;  1X4U A;  2DX8 A;  3EB5 A;  2KE1 A;  1JM7 A;  4AYC B;  5H9M A;  2YQL A;  5H1V A;  3ZVY A;  1N87 A;  3ASL A;  2G43 A;  2ECI A;  2HYE D;  1DVP A;  2MD7 B;  4LJN A;  2YT5 A;  5KH3 A;  2KGI A;  2ECT A;  4LAD B;  4V3K C;  5B77 A;  4NN2 A;  3O35 A;  3N9N A;  2CT2 A;  2G45 A;  2JMI A;  2EA6 A;  2LN0 A;  4O64 A;  3HCU A;  4UI9 B;  1G25 A;  3L1Z B;  2MT5 A;  2YW8 A;  4I7D A;  2JMJ A;  2VJE B;  5EYA F;  1WE9 A;  5FEY A;  3M63 A;  3PUR A;  4YC9 A;  2JMD A;  4S3O C;  1WEP A;  4GNG A;  2H0D A;  5B76 A;  3RPG C;  4V3L C;  2YYR A;  2MUM A;  2KGG A;  3LRQ A;  4S3O B;  5KH9 A;  2CSY A;  4AUQ B;  4CA1 A;  4LK9 A;  2VPE A;  5TRB A;  1WGM A;  1V87 A;  5G04 B;  5TDR A;  1WEU A;  2RI7 A;  3ZPV E;  2Y1M A;  2NAA A;  3O33 A;  5KH7 A;  4N3W A;  2JRJ A;  5B78 A;  2LDR A;  5LKT A;  3O36 A;  4YAD A;  2HDP A;  5H1T A;  1WEE A;  4I7B A;  2PNX A;  2L5U A;  1VYX A;  4QF3 A;  1F62 A;  3IHP A;  5LKX A;  3DQV R;  2YU4 A;  3PHD A;  5LCW B;  4R7E A;  2ECG A;  3V43 A;  1Z60 A;  2F42 A;  2F6J A;  2KR4 A;  3EB6 A;  2QJ0 A;  5FB1 A;  3PUQ A;  1E4U A;  2FSA A;  3VK6 A;  2VNF A;  4A4B A;  4ZUX U;  5B75 A;  3KV6 A;  3L1X A;  1JM7 B;  4I7C A;  5DIN A;  4R8P K;  3FL2 A;  1WEQ A;  4PPE A;  4AP4 A;  2M3H A;  1K2F A;  4FO9 A;  4FK5 A;  4IC2 A;  4C9Z A;  2UZG A;  4GNF A;  4WA6 A;  4AYC A;  2M85 A;  3ZVZ B;  5G05 B;  4WZ2 A;  2LGG A;  4UP0 A;  2KWN A;  2K17 A;  2MNZ A;  2QIZ A;  2ZET C;  2YUR A;  2MNY A;  1U6G B;  3HTK C;  3U5M A;  5C13 A;  1MM3 A;  3SOU A;  2ECN A;  1X4J A;  3O37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...