1X4UA

Solution structure of the fyve domain from human fyve domain containing 27 isoform b protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
84
structure length
84
Chain Sequence
b'GSSGSSGRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger, FYVE domain containing 27 isoform b
publication title Solution structure of the FYVE domain from human FYVE domain containing 27 isoform b protein
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 5
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4uA01
3LQIA 4CCGX 4QF2A 2KWJA 2MIQA 1WEQA 1WGMA 4BHWA 2QIZA 3PURA 2MT5A 3O35A 3KNVA 2HYED 4FIPA 2VJFB 3DQVR 2VPBA 2LGKA 5G04B 3DPLR 4WZ3B 1G25A 1XWHA 2F42A 2K16A 3M62A 4ZDTA 4S3OB 2QJ0A 1F62A 1IYMA 3I2DA 2DX8A 2ECIA 4LADB 3ZTGA 4B86C 4TKPB 2LXHC 2PUYA 4L7XA 4N4FA 1WENA 2ECGA 2F6JA 2YT5A 2KWOA 2MUMA 3U5OA 5AIUA 2CSZA 2VJEB 5D1KB 4A4CA 1WIMA 2VPGA 2EGPA 4I7CA 3KV6A 1VFYA 2FSAA 3O34A 5J3XA 4ZQLA 4AVXA 3T7LA 3LQHA 3GV4A 4UI9B 4UP5A 2E6RA 2QICA 1ZBDB 4A4BA 1CHCA 4LJNA 5TBNA 4A49A 2G6QA 2VP7A 5DKAA 4L58A 3O70A 5LCWB 3MHHA 2CKLB 1HYIA 1JM7B 1WE9A 2KYUA 4UP0A 2AN6A 5FB1A 2PNXA 2LN0A 2FUIA 2YYRA 4YABA 4F52B 3C5KA 1X4IA 2KWNA 4FK5A 1WILA 2KR4A 4AYCB 4YBMA 3MHSA 3ZPV1 4NN2A 2NAAA 2KWKA 4YADA 5H9MA 3QZVA 4WZ0A 5H1UA 5KH9A 2M6MA 4WA6A 2KFTA 2ECTA 2Y1NA 2MD7B 4AUQB 2CT2A 5KH7A 2MNZA 2LRIC 3GL6A 2IDAA 4PTBA 3U5MA 2L43A 2YREA 1VD4A 5TDRA 2EA6A 3O33A 1WEEA 1FBVA 2MD8C 4LLBA 5DINA 5TDWA 3LQJA 4W4UA 3SOXA 2LGGA 1T1HA 2LQ6A 1K2FA 1WEWA 4FJCA 5D1LB 1HYJA 3ASLA 1FP0A 5G05B 5H1VA 4O64A 5D1MB 4AYCA 3M99A 5H1TA 4ZUXU 2KU3A 3SOWA 4Q6FA 4BBQA 4GB0A 4AP4A 5B8DA 2YSJA 4I7BA 2H0DB 5FEYA 3ZVZB 2KIZA 2D8SA 4X3GA 1WFKA 4GNFA 3N9NA 2VJFA 1LDJB 2C2VS 5C13A 1Z6UA 2YQMA 3L1ZB 1WESA 4V3KC 2G43A 2G45A 3U5PA 2VPEA 5B78A 4YBTA 4GNGA 1MM3A 2I50A 3L11A 5I3LA 4XI1A 1MM2A 2KGIA 5LKZA 3N9PA 2K1JA 2E6SA 5B76A 2VNFA 3FL2A 1Z2QA 2K17A 2CSYA 4B7YC 2VJEA 3O7AA 4LKAA 2L80A 2UZGA 4FO9A 2YW8A 5TRBA 2L0BA 1Z60A 2H0DA 2LGVA 2ECWA 5FERA 1E4UA 1JOCA 4IC2A 2LGLA 2YHNA 2ECNA 4R8PK 3VK6A 2OXQC 1WEOA 2EODA 4YAXA 2L75A 2RSDA 3SOUA 3ZVYA 2Y1MA 3HCUA 4MSXA 4IC3A 2LDRA 2CKLA 2LV9A 4QF3A 4GNEA 1JM7A 1RMDA 2C2LA 2L5UA 3PHDA 2KREA 3U5NA 5B79A 3N9OA 4R7EA 5B77A 2JMJA 2M85A 5LKXA 5B75A 4PPEA 3RPGC 3HTKC 3N9LA 4GNDA 5TABA 2JMDA 3PUQA 3HCTA 3KV5A 5EYAF 3ZYQA 2YSMA 3KQIA 2YURA 4A0CD 3N9MA 1X4JA 4YC9A 3O37A 4R2YA 3T6RA 5LKTA 4WZ2A 1VYXA 3ZNIA 2ECVA 1WEUA 3EB5A 3LRQA 2XEUA 1U6GB 2KE1A 3L1XA 1WEMA 4I7DA 2MA6A 4LK9A 2VPDA 4YATA 1X4UA 3N9QA 2RI7A 5KH3A 3C6WA 2FUUA 4V3LC 4S3OC 2ZETC 5G0FA 1LDKC 1WEPA 2JMIA 2KGGA 2YUCA 2HDPA 1N87A 2YU4A 2F6NA 2Y43A 4MVTA 2BAYA 2ECJA 3SHBA 3NG2A 5LKUA 5AITA 1WEVA 2MNYA 3V43A 2YHOA 1BORA 3RPGB 2JRJA 2M1RA 3EB6A 2LXPC 4C9ZA 2YQLA 3IHPA 2XB1A 3M63A 5FB0A 2K4DA 3HCSA 2MA5A 3RTRB 4CA1A 4YBSA 1V87A 3O36A 5C11A 1DVPA 2M3HA 4P5OB 4N3WA 5JG6A 3ZPVE
chains in the Genus database with same CATH superfamily
3M7KA 3LQIA 4CCGX 4QF2A 2KWJA 2MIQA 1WEQA 1WGMA 4BHWA 2QIZA 3PURA 2MT5A 3O35A 2XOZA 2XP0A 3KNVA 2HYED 4FIPA 2VJFB 3DQVR 2VPBA 2LGKA 2B0OE 5G04B 3DPLR 4WZ3B 2XOYA 1G25A 1XWHA 2F42A 2K16A 3M62A 4ZDTA 4S3OB 2QJ0A 1F62A 1IYMA 3E2DA 3I2DA 2DX8A 2ECIA 2EXUA 4LADB 5SVIB 3ZTGA 4B86C 4TKPB 2LXHC 2PUYA 4L7XA 4N4FA 1WENA 4F1PA 2ECGA 2CONA 2OWAA 2F6JA 2YT5A 2JUNA 2KWOA 2EGMA 2MUMA 3U5OA 5AIUA 2CSZA 2VJEB 5D1KB 4A4CA 4H9DA 1WIMA 2YVRA 2VPGA 2EGPA 4I7CA 3KV6A 1VFYA 4OGEA 2FSAA 3O34A 5J3XA 4ZQLA 4AVXA 3T7LA 3LQHA 3GV4A 4UI9B 4UP5A 2E6RA 2QICA 1ZBDB 4A4BA 1CHCA 4LJNA 5TBNA 4A49A 2G6QA 2VP7A 5DKAA 4L58A 3O70A 5LCWB 2DSMA 3MHHA 2CKLB 1HYIA 1JM7B 1WE9A 2KYUA 4UP0A 2AN6A 5FB1A 2PNXA 2LN0A 2FUIA 2YYRA 4YABA 4F52B 3C5KA 1X4IA 3H7HA 2KWNA 3T9KA 4FK5A 2M13A 1WILA 2FD4A 2KR4A 4AYCB 4YBMA 3MHSA 3ZPV1 4Z0RA 4NN2A 2NAAA 2KWKA 2CRRA 4YADA 5H9MA 3QZVA 4WZ0A 5H1UA 5KH9A 2IQJA 2M6MA 4WA6A 2KFTA 2ECTA 2FFWA 2Y1NA 2MD7B 4AUQB 2CT2A 5KH7A 2MNZA 2LRIC 3LVQE 3SUBA 3GL6A 2IDAA 4PTBA 3U5MA 2L43A 2YREA 1VD4A 5TDRA 2XOCA 4O62A 2EA6A 3O33A 1WEEA 1FBVA 2MD8C 4LLBA 5DINA 2KKXA 5TDWA 3LQJA 4W4UA 3SOXA 2LGGA 1T1HA 2LQ6A 1K2FA 1WEWA 4FJCA 5D1LB 1HYJA 3ASLA 1FP0A 2CSVA 5G05B 5H1VA 4O64A 5D1MB 4AYCA 3M99A 5H1TA 4ZUXU 2KU3A 3SOWA 4Q6FA 5SVYA 4BBQA 4GB0A 4AP4A 5B8DA 2YSJA 4I7BA 2H0DB 5FEYA 3ZVZB 2KIZA 3FEHA 2D8SA 4X3GA 1WFKA 4GNFA 3N9NA 2VJFA 1LDJB 2C2VS 5C13A 1Z6UA 2YQMA 3L1ZB 1WESA 4V3KC 2CRWA 5K3QA 2G43A 2G45A 3U5PA 2VPEA 5B78A 4YBTA 4GNGA 1MM3A 2I50A 2LAUA 5SVIA 3L11A 5I3LA 4XI1A 1MM2A 2KGIA 5LKZA 2L7PA 3FJUB 3N9PA 2K1JA 2MKEA 2E6SA 5B76A 2VNFA 2D8UA 3FL2A 1Z2QA 2K17A 2CSYA 3LVRE 4B7YC 2VJEA 3O7AA 4LKAA 4Z0OA 2L80A 2UZGA 4FO9A 1MBMA 2YW8A 5TRBA 2L0BA 1Z60A 2H0DA 2LGVA 3MDBC 3O47A 2ECWA 3PLWA 5FERA 1E4UA 1JOCA 4IC2A 2LGLA 2YHNA 2ECNA 4R8PK 3VK6A 2OXQC 3FM8C 3JUEA 1WEOA 2EODA 4YAXA 2L75A 4OGCA 2RSDA 3SOUA 3ZVYA 3FANA 2Y1MA 3HCUA 2E61A 4MSXA 4IC3A 2LDRA 2CKLA 2LV9A 4QF3A 4GNEA 1JM7A 1RMDA 2C2LA 2L5UA 3PHDA 2KREA 3U5NA 5B79A 3N9OA 4R7EA 5B77A 2JMJA 2M85A 5LKXA 5B75A 4PPEA 3RPGC 3HTKC 3N9LA 4GNDA 5TABA 2JMDA 3PUQA 3HCTA 3KV5A 5EYAF 2KKYA 3ZYQA 2YSMA 3LDYA 3KQIA 2YURA 4A0CD 3N9MA 1X4JA 4YC9A 3O37A 4R2YA 3T6RA 5LKTA 4WZ2A 4QQ4A 3Q1DA 1VYXA 3ZNIA 2ECVA 1WEUA 3EB5A 3LRQA 2XEUA 1U6GB 2KE1A 3L1XA 1WEMA 4I7DA 2MA6A 4LK9A 2VPDA 4YATA 1X4UA 3N9QA 2RI7A 3KDEC 5KH3A 3C6WA 2FUUA 4V3LC 4S3OC 2ZETC 5G0FA 1LDKC 1WEPA 2JM3A 2JMIA 2KGGA 2YUCA 1N87A 2HDPA 2YU4A 2F6NA 2Y43A 2P57A 2BAYA 4MVTA 2ECJA 1DCQA 3SHBA 3DDTA 3NG2A 5LKUA 2DJAA 5AITA 2RR4A 3FAOA 1WEVA 5SVXA 2MNYA 3V43A 2YHOA 1BORA 3RPGB 2JRJA 2M1RA 3LJUX 3EB6A 2LXPC 4C9ZA 2YQLA 3IHPA 2XB1A 3M63A 2K4DA 5FB0A 3HCSA 2MA5A 3RTRB 4CA1A 3DWDA 4YBSA 1V87A 3O36A 5C11A 1DVPA 2M3HA 4P5OB 4N3WA 5JG6A 3ZPVE
chains in the Genus database with same CATH topology
3LQIA 4CCGX 4QF2A 2KWJA 2MIQA 1WEQA 1WGMA 4BHWA 2QIZA 3PURA 2MT5A 3O35A 3KNVA 2HYED 4FIPA 2VJFB 3DQVR 2VPBA 2LGKA 5G04B 3DPLR 4WZ3B 1G25A 1XWHA 2F42A 2K16A 3M62A 4ZDTA 4S3OB 2QJ0A 1F62A 1IYMA 3I2DA 2DX8A 2ECIA 4LADB 3ZTGA 4B86C 4TKPB 2LXHC 2PUYA 4L7XA 4N4FA 1WENA 2ECGA 2F6JA 2YT5A 2KWOA 2MUMA 3U5OA 5AIUA 2CSZA 2VJEB 5D1KB 4A4CA 1WIMA 2VPGA 2EGPA 4I7CA 3KV6A 1VFYA 2FSAA 3O34A 5J3XA 4ZQLA 4AVXA 3T7LA 3LQHA 3GV4A 4UI9B 4UP5A 2E6RA 2QICA 1ZBDB 4A4BA 1CHCA 4LJNA 5TBNA 4A49A 2G6QA 2VP7A 5DKAA 4L58A 3O70A 5LCWB 3MHHA 2CKLB 1HYIA 1JM7B 1WE9A 2KYUA 4UP0A 2AN6A 5FB1A 2PNXA 2LN0A 2FUIA 2YYRA 4YABA 4F52B 3C5KA 1X4IA 2KWNA 4FK5A 1WILA 2KR4A 4AYCB 4YBMA 3MHSA 3ZPV1 4NN2A 2NAAA 2KWKA 4YADA 5H9MA 3QZVA 4WZ0A 5H1UA 5KH9A 2M6MA 4WA6A 2KFTA 2ECTA 2Y1NA 2MD7B 4AUQB 2CT2A 5KH7A 2MNZA 2LRIC 3GL6A 2IDAA 4PTBA 3U5MA 2L43A 2YREA 1VD4A 5TDRA 2EA6A 3O33A 1WEEA 1FBVA 2MD8C 4LLBA 5DINA 5TDWA 3LQJA 4W4UA 3SOXA 2LGGA 1T1HA 2LQ6A 1K2FA 1WEWA 4FJCA 5D1LB 1HYJA 3ASLA 1FP0A 5G05B 5H1VA 4O64A 5D1MB 4AYCA 3M99A 5H1TA 4ZUXU 2KU3A 3SOWA 4Q6FA 4BBQA 4GB0A 4AP4A 5B8DA 2YSJA 4I7BA 2H0DB 5FEYA 3ZVZB 2KIZA 2D8SA 4X3GA 1WFKA 4GNFA 3N9NA 2VJFA 1LDJB 2C2VS 5C13A 1Z6UA 2YQMA 3L1ZB 1WESA 4V3KC 2G43A 2G45A 3U5PA 2VPEA 5B78A 4YBTA 4GNGA 1MM3A 2I50A 3L11A 5I3LA 4XI1A 1MM2A 2KGIA 5LKZA 3N9PA 2K1JA 2E6SA 5B76A 2VNFA 3FL2A 1Z2QA 2K17A 2CSYA 4B7YC 2VJEA 3O7AA 4LKAA 2L80A 2UZGA 4FO9A 2YW8A 5TRBA 2L0BA 1Z60A 2H0DA 2LGVA 2ECWA 5FERA 1E4UA 1JOCA 4IC2A 2LGLA 2YHNA 2ECNA 4R8PK 3VK6A 2OXQC 1WEOA 2EODA 4YAXA 2L75A 2RSDA 3SOUA 3ZVYA 2Y1MA 3HCUA 4MSXA 4IC3A 2LDRA 2CKLA 2LV9A 4QF3A 4GNEA 1JM7A 1RMDA 2C2LA 2L5UA 3PHDA 2KREA 3U5NA 5B79A 3N9OA 4R7EA 5B77A 2JMJA 2M85A 5LKXA 5B75A 4PPEA 3RPGC 3HTKC 3N9LA 4GNDA 5TABA 2JMDA 3PUQA 3HCTA 3KV5A 5EYAF 3ZYQA 2YSMA 3KQIA 2YURA 4A0CD 3N9MA 1X4JA 4YC9A 3O37A 4R2YA 3T6RA 5LKTA 4WZ2A 1VYXA 3ZNIA 2ECVA 1WEUA 3EB5A 3LRQA 2XEUA 1U6GB 2KE1A 3L1XA 1WEMA 4I7DA 2MA6A 4LK9A 2VPDA 4YATA 1X4UA 3N9QA 2RI7A 5KH3A 3C6WA 2FUUA 4V3LC 4S3OC 2ZETC 5G0FA 1LDKC 1WEPA 2JMIA 2KGGA 2YUCA 2HDPA 1N87A 2YU4A 2F6NA 2Y43A 4MVTA 2BAYA 2ECJA 3SHBA 3NG2A 5LKUA 5AITA 1WEVA 2MNYA 3V43A 2YHOA 1BORA 3RPGB 2JRJA 2M1RA 3EB6A 2LXPC 4C9ZA 2YQLA 3IHPA 2XB1A 3M63A 5FB0A 2K4DA 3HCSA 2MA5A 3RTRB 4CA1A 4YBSA 1V87A 3O36A 5C11A 1DVPA 2M3HA 4P5OB 4N3WA 5JG6A 3ZPVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQI A;  4CCG X;  4QF2 A;  2KWJ A;  2MIQ A;  1WEQ A;  1WGM A;  4BHW A;  2QIZ A;  3PUR A;  2MT5 A;  3O35 A;  3KNV A;  2HYE D;  4FIP A;  2VJF B;  3DQV R;  2VPB A;  2LGK A;  5G04 B;  3DPL R;  4WZ3 B;  1G25 A;  1XWH A;  2F42 A;  2K16 A;  3M62 A;  4ZDT A;  4S3O B;  2QJ0 A;  1F62 A;  1IYM A;  3I2D A;  2DX8 A;  2ECI A;  4LAD B;  3ZTG A;  4B86 C;  4TKP B;  2LXH C;  2PUY A;  4L7X A;  4N4F A;  1WEN A;  2ECG A;  2F6J A;  2YT5 A;  2KWO A;  2MUM A;  3U5O A;  5AIU A;  2CSZ A;  2VJE B;  5D1K B;  4A4C A;  1WIM A;  2VPG A;  2EGP A;  4I7C A;  3KV6 A;  1VFY A;  2FSA A;  3O34 A;  5J3X A;  4ZQL A;  4AVX A;  3T7L A;  3LQH A;  3GV4 A;  4UI9 B;  4UP5 A;  2E6R A;  2QIC A;  1ZBD B;  4A4B A;  1CHC A;  4LJN A;  5TBN A;  4A49 A;  2G6Q A;  2VP7 A;  5DKA A;  4L58 A;  3O70 A;  5LCW B;  3MHH A;  2CKL B;  1HYI A;  1JM7 B;  1WE9 A;  2KYU A;  4UP0 A;  2AN6 A;  5FB1 A;  2PNX A;  2LN0 A;  2FUI A;  2YYR A;  4YAB A;  4F52 B;  3C5K A;  1X4I A;  2KWN A;  4FK5 A;  1WIL A;  2KR4 A;  4AYC B;  4YBM A;  3MHS A;  3ZPV 1;  4NN2 A;  2NAA A;  2KWK A;  4YAD A;  5H9M A;  3QZV A;  4WZ0 A;  5H1U A;  5KH9 A;  2M6M A;  4WA6 A;  2KFT A;  2ECT A;  2Y1N A;  2MD7 B;  4AUQ B;  2CT2 A;  5KH7 A;  2MNZ A;  2LRI C;  3GL6 A;  2IDA A;  4PTB A;  3U5M A;  2L43 A;  2YRE A;  1VD4 A;  5TDR A;  2EA6 A;  3O33 A;  1WEE A;  1FBV A;  2MD8 C;  4LLB A;  5DIN A;  5TDW A;  3LQJ A;  4W4U A;  3SOX A;  2LGG A;  1T1H A;  2LQ6 A;  1K2F A;  1WEW A;  4FJC A;  5D1L B;  1HYJ A;  3ASL A;  1FP0 A;  5G05 B;  5H1V A;  4O64 A;  5D1M B;  4AYC A;  3M99 A;  5H1T A;  4ZUX U;  2KU3 A;  3SOW A;  4Q6F A;  4BBQ A;  4GB0 A;  4AP4 A;  5B8D A;  2YSJ A;  4I7B A;  2H0D B;  5FEY A;  3ZVZ B;  2KIZ A;  2D8S A;  4X3G A;  1WFK A;  4GNF A;  3N9N A;  2VJF A;  1LDJ B;  2C2V S;  5C13 A;  1Z6U A;  2YQM A;  3L1Z B;  1WES A;  4V3K C;  2G43 A;  2G45 A;  3U5P A;  2VPE A;  5B78 A;  4YBT A;  4GNG A;  1MM3 A;  2I50 A;  3L11 A;  5I3L A;  4XI1 A;  1MM2 A;  2KGI A;  5LKZ A;  3N9P A;  2K1J A;  2E6S A;  5B76 A;  2VNF A;  3FL2 A;  1Z2Q A;  2K17 A;  2CSY A;  4B7Y C;  2VJE A;  3O7A A;  4LKA A;  2L80 A;  2UZG A;  4FO9 A;  2YW8 A;  5TRB A;  2L0B A;  1Z60 A;  2H0D A;  2LGV A;  2ECW A;  5FER A;  1E4U A;  1JOC A;  4IC2 A;  2LGL A;  2YHN A;  2ECN A;  4R8P K;  3VK6 A;  2OXQ C;  1WEO A;  2EOD A;  4YAX A;  2L75 A;  2RSD A;  3SOU A;  3ZVY A;  2Y1M A;  3HCU A;  4MSX A;  4IC3 A;  2LDR A;  2CKL A;  2LV9 A;  4QF3 A;  4GNE A;  1JM7 A;  1RMD A;  2C2L A;  2L5U A;  3PHD A;  2KRE A;  3U5N A;  5B79 A;  3N9O A;  4R7E A;  5B77 A;  2JMJ A;  2M85 A;  5LKX A;  5B75 A;  4PPE A;  3RPG C;  3HTK C;  3N9L A;  4GND A;  5TAB A;  2JMD A;  3PUQ A;  3HCT A;  3KV5 A;  5EYA F;  3ZYQ A;  2YSM A;  3KQI A;  2YUR A;  4A0C D;  3N9M A;  1X4J A;  4YC9 A;  3O37 A;  4R2Y A;  3T6R A;  5LKT A;  4WZ2 A;  1VYX A;  3ZNI A;  2ECV A;  1WEU A;  3EB5 A;  3LRQ A;  2XEU A;  1U6G B;  2KE1 A;  3L1X A;  1WEM A;  4I7D A;  2MA6 A;  4LK9 A;  2VPD A;  4YAT A;  1X4U A;  3N9Q A;  2RI7 A;  5KH3 A;  3C6W A;  2FUU A;  4V3L C;  4S3O C;  2ZET C;  5G0F A;  1LDK C;  1WEP A;  2JMI A;  2KGG A;  2YUC A;  2HDP A;  1N87 A;  2YU4 A;  2F6N A;  2Y43 A;  4MVT A;  2BAY A;  2ECJ A;  3SHB A;  3NG2 A;  5LKU A;  5AIT A;  1WEV A;  2MNY A;  3V43 A;  2YHO A;  1BOR A;  3RPG B;  2JRJ A;  2M1R A;  3EB6 A;  2LXP C;  4C9Z A;  2YQL A;  3IHP A;  2XB1 A;  3M63 A;  5FB0 A;  2K4D A;  3HCS A;  2MA5 A;  3RTR B;  4CA1 A;  4YBS A;  1V87 A;  3O36 A;  5C11 A;  1DVP A;  2M3H A;  4P5O B;  4N3W A;  5JG6 A;  3ZPV E; 
#chains in the Genus database with same CATH topology
 3M7K A;  3LQI A;  4CCG X;  4QF2 A;  2KWJ A;  2MIQ A;  1WEQ A;  1WGM A;  4BHW A;  2QIZ A;  3PUR A;  2MT5 A;  3O35 A;  2XOZ A;  2XP0 A;  3KNV A;  2HYE D;  4FIP A;  2VJF B;  3DQV R;  2VPB A;  2LGK A;  2B0O E;  5G04 B;  3DPL R;  4WZ3 B;  2XOY A;  1G25 A;  1XWH A;  2F42 A;  2K16 A;  3M62 A;  4ZDT A;  4S3O B;  2QJ0 A;  1F62 A;  1IYM A;  3E2D A;  3I2D A;  2DX8 A;  2ECI A;  2EXU A;  4LAD B;  5SVI B;  3ZTG A;  4B86 C;  4TKP B;  2LXH C;  2PUY A;  4L7X A;  4N4F A;  1WEN A;  4F1P A;  2ECG A;  2CON A;  2OWA A;  2F6J A;  2YT5 A;  2JUN A;  2KWO A;  2EGM A;  2MUM A;  3U5O A;  5AIU A;  2CSZ A;  2VJE B;  5D1K B;  4A4C A;  4H9D A;  1WIM A;  2YVR A;  2VPG A;  2EGP A;  4I7C A;  3KV6 A;  1VFY A;  4OGE A;  2FSA A;  3O34 A;  5J3X A;  4ZQL A;  4AVX A;  3T7L A;  3LQH A;  3GV4 A;  4UI9 B;  4UP5 A;  2E6R A;  2QIC A;  1ZBD B;  4A4B A;  1CHC A;  4LJN A;  5TBN A;  4A49 A;  2G6Q A;  2VP7 A;  5DKA A;  4L58 A;  3O70 A;  5LCW B;  2DSM A;  3MHH A;  2CKL B;  1HYI A;  1JM7 B;  1WE9 A;  2KYU A;  4UP0 A;  2AN6 A;  5FB1 A;  2PNX A;  2LN0 A;  2FUI A;  2YYR A;  4YAB A;  4F52 B;  3C5K A;  1X4I A;  3H7H A;  2KWN A;  3T9K A;  4FK5 A;  2M13 A;  1WIL A;  2FD4 A;  2KR4 A;  4AYC B;  4YBM A;  3MHS A;  3ZPV 1;  4Z0R A;  4NN2 A;  2NAA A;  2KWK A;  2CRR A;  4YAD A;  5H9M A;  3QZV A;  4WZ0 A;  5H1U A;  5KH9 A;  2IQJ A;  2M6M A;  4WA6 A;  2KFT A;  2ECT A;  2FFW A;  2Y1N A;  2MD7 B;  4AUQ B;  2CT2 A;  5KH7 A;  2MNZ A;  2LRI C;  3LVQ E;  3SUB A;  3GL6 A;  2IDA A;  4PTB A;  3U5M A;  2L43 A;  2YRE A;  1VD4 A;  5TDR A;  2XOC A;  4O62 A;  2EA6 A;  3O33 A;  1WEE A;  1FBV A;  2MD8 C;  4LLB A;  5DIN A;  2KKX A;  5TDW A;  3LQJ A;  4W4U A;  3SOX A;  2LGG A;  1T1H A;  2LQ6 A;  1K2F A;  1WEW A;  4FJC A;  5D1L B;  1HYJ A;  3ASL A;  1FP0 A;  2CSV A;  5G05 B;  5H1V A;  4O64 A;  5D1M B;  4AYC A;  3M99 A;  5H1T A;  4ZUX U;  2KU3 A;  3SOW A;  4Q6F A;  5SVY A;  4BBQ A;  4GB0 A;  4AP4 A;  5B8D A;  2YSJ A;  4I7B A;  2H0D B;  5FEY A;  3ZVZ B;  2KIZ A;  3FEH A;  2D8S A;  4X3G A;  1WFK A;  4GNF A;  3N9N A;  2VJF A;  1LDJ B;  2C2V S;  5C13 A;  1Z6U A;  2YQM A;  3L1Z B;  1WES A;  4V3K C;  2CRW A;  5K3Q A;  2G43 A;  2G45 A;  3U5P A;  2VPE A;  5B78 A;  4YBT A;  4GNG A;  1MM3 A;  2I50 A;  2LAU A;  5SVI A;  3L11 A;  5I3L A;  4XI1 A;  1MM2 A;  2KGI A;  5LKZ A;  2L7P A;  3FJU B;  3N9P A;  2K1J A;  2MKE A;  2E6S A;  5B76 A;  2VNF A;  2D8U A;  3FL2 A;  1Z2Q A;  2K17 A;  2CSY A;  3LVR E;  4B7Y C;  2VJE A;  3O7A A;  4LKA A;  4Z0O A;  2L80 A;  2UZG A;  4FO9 A;  1MBM A;  2YW8 A;  5TRB A;  2L0B A;  1Z60 A;  2H0D A;  2LGV A;  3MDB C;  3O47 A;  2ECW A;  3PLW A;  5FER A;  1E4U A;  1JOC A;  4IC2 A;  2LGL A;  2YHN A;  2ECN A;  4R8P K;  3VK6 A;  2OXQ C;  3FM8 C;  3JUE A;  1WEO A;  2EOD A;  4YAX A;  2L75 A;  4OGC A;  2RSD A;  3SOU A;  3ZVY A;  3FAN A;  2Y1M A;  3HCU A;  2E61 A;  4MSX A;  4IC3 A;  2LDR A;  2CKL A;  2LV9 A;  4QF3 A;  4GNE A;  1JM7 A;  1RMD A;  2C2L A;  2L5U A;  3PHD A;  2KRE A;  3U5N A;  5B79 A;  3N9O A;  4R7E A;  5B77 A;  2JMJ A;  2M85 A;  5LKX A;  5B75 A;  4PPE A;  3RPG C;  3HTK C;  3N9L A;  4GND A;  5TAB A;  2JMD A;  3PUQ A;  3HCT A;  3KV5 A;  5EYA F;  2KKY A;  3ZYQ A;  2YSM A;  3LDY A;  3KQI A;  2YUR A;  4A0C D;  3N9M A;  1X4J A;  4YC9 A;  3O37 A;  4R2Y A;  3T6R A;  5LKT A;  4WZ2 A;  4QQ4 A;  3Q1D A;  1VYX A;  3ZNI A;  2ECV A;  1WEU A;  3EB5 A;  3LRQ A;  2XEU A;  1U6G B;  2KE1 A;  3L1X A;  1WEM A;  4I7D A;  2MA6 A;  4LK9 A;  2VPD A;  4YAT A;  1X4U A;  3N9Q A;  2RI7 A;  3KDE C;  5KH3 A;  3C6W A;  2FUU A;  4V3L C;  4S3O C;  2ZET C;  5G0F A;  1LDK C;  1WEP A;  2JM3 A;  2JMI A;  2KGG A;  2YUC A;  1N87 A;  2HDP A;  2YU4 A;  2F6N A;  2Y43 A;  2P57 A;  2BAY A;  4MVT A;  2ECJ A;  1DCQ A;  3SHB A;  3DDT A;  3NG2 A;  5LKU A;  2DJA A;  5AIT A;  2RR4 A;  3FAO A;  1WEV A;  5SVX A;  2MNY A;  3V43 A;  2YHO A;  1BOR A;  3RPG B;  2JRJ A;  2M1R A;  3LJU X;  3EB6 A;  2LXP C;  4C9Z A;  2YQL A;  3IHP A;  2XB1 A;  3M63 A;  2K4D A;  5FB0 A;  3HCS A;  2MA5 A;  3RTR B;  4CA1 A;  3DWD A;  4YBS A;  1V87 A;  3O36 A;  5C11 A;  1DVP A;  2M3H A;  4P5O B;  4N3W A;  5JG6 A;  3ZPV E; 
#chains in the Genus database with same CATH homology
 3LQI A;  4CCG X;  4QF2 A;  2KWJ A;  2MIQ A;  1WEQ A;  1WGM A;  4BHW A;  2QIZ A;  3PUR A;  2MT5 A;  3O35 A;  3KNV A;  2HYE D;  4FIP A;  2VJF B;  3DQV R;  2VPB A;  2LGK A;  5G04 B;  3DPL R;  4WZ3 B;  1G25 A;  1XWH A;  2F42 A;  2K16 A;  3M62 A;  4ZDT A;  4S3O B;  2QJ0 A;  1F62 A;  1IYM A;  3I2D A;  2DX8 A;  2ECI A;  4LAD B;  3ZTG A;  4B86 C;  4TKP B;  2LXH C;  2PUY A;  4L7X A;  4N4F A;  1WEN A;  2ECG A;  2F6J A;  2YT5 A;  2KWO A;  2MUM A;  3U5O A;  5AIU A;  2CSZ A;  2VJE B;  5D1K B;  4A4C A;  1WIM A;  2VPG A;  2EGP A;  4I7C A;  3KV6 A;  1VFY A;  2FSA A;  3O34 A;  5J3X A;  4ZQL A;  4AVX A;  3T7L A;  3LQH A;  3GV4 A;  4UI9 B;  4UP5 A;  2E6R A;  2QIC A;  1ZBD B;  4A4B A;  1CHC A;  4LJN A;  5TBN A;  4A49 A;  2G6Q A;  2VP7 A;  5DKA A;  4L58 A;  3O70 A;  5LCW B;  3MHH A;  2CKL B;  1HYI A;  1JM7 B;  1WE9 A;  2KYU A;  4UP0 A;  2AN6 A;  5FB1 A;  2PNX A;  2LN0 A;  2FUI A;  2YYR A;  4YAB A;  4F52 B;  3C5K A;  1X4I A;  2KWN A;  4FK5 A;  1WIL A;  2KR4 A;  4AYC B;  4YBM A;  3MHS A;  3ZPV 1;  4NN2 A;  2NAA A;  2KWK A;  4YAD A;  5H9M A;  3QZV A;  4WZ0 A;  5H1U A;  5KH9 A;  2M6M A;  4WA6 A;  2KFT A;  2ECT A;  2Y1N A;  2MD7 B;  4AUQ B;  2CT2 A;  5KH7 A;  2MNZ A;  2LRI C;  3GL6 A;  2IDA A;  4PTB A;  3U5M A;  2L43 A;  2YRE A;  1VD4 A;  5TDR A;  2EA6 A;  3O33 A;  1WEE A;  1FBV A;  2MD8 C;  4LLB A;  5DIN A;  5TDW A;  3LQJ A;  4W4U A;  3SOX A;  2LGG A;  1T1H A;  2LQ6 A;  1K2F A;  1WEW A;  4FJC A;  5D1L B;  1HYJ A;  3ASL A;  1FP0 A;  5G05 B;  5H1V A;  4O64 A;  5D1M B;  4AYC A;  3M99 A;  5H1T A;  4ZUX U;  2KU3 A;  3SOW A;  4Q6F A;  4BBQ A;  4GB0 A;  4AP4 A;  5B8D A;  2YSJ A;  4I7B A;  2H0D B;  5FEY A;  3ZVZ B;  2KIZ A;  2D8S A;  4X3G A;  1WFK A;  4GNF A;  3N9N A;  2VJF A;  1LDJ B;  2C2V S;  5C13 A;  1Z6U A;  2YQM A;  3L1Z B;  1WES A;  4V3K C;  2G43 A;  2G45 A;  3U5P A;  2VPE A;  5B78 A;  4YBT A;  4GNG A;  1MM3 A;  2I50 A;  3L11 A;  5I3L A;  4XI1 A;  1MM2 A;  2KGI A;  5LKZ A;  3N9P A;  2K1J A;  2E6S A;  5B76 A;  2VNF A;  3FL2 A;  1Z2Q A;  2K17 A;  2CSY A;  4B7Y C;  2VJE A;  3O7A A;  4LKA A;  2L80 A;  2UZG A;  4FO9 A;  2YW8 A;  5TRB A;  2L0B A;  1Z60 A;  2H0D A;  2LGV A;  2ECW A;  5FER A;  1E4U A;  1JOC A;  4IC2 A;  2LGL A;  2YHN A;  2ECN A;  4R8P K;  3VK6 A;  2OXQ C;  1WEO A;  2EOD A;  4YAX A;  2L75 A;  2RSD A;  3SOU A;  3ZVY A;  2Y1M A;  3HCU A;  4MSX A;  4IC3 A;  2LDR A;  2CKL A;  2LV9 A;  4QF3 A;  4GNE A;  1JM7 A;  1RMD A;  2C2L A;  2L5U A;  3PHD A;  2KRE A;  3U5N A;  5B79 A;  3N9O A;  4R7E A;  5B77 A;  2JMJ A;  2M85 A;  5LKX A;  5B75 A;  4PPE A;  3RPG C;  3HTK C;  3N9L A;  4GND A;  5TAB A;  2JMD A;  3PUQ A;  3HCT A;  3KV5 A;  5EYA F;  3ZYQ A;  2YSM A;  3KQI A;  2YUR A;  4A0C D;  3N9M A;  1X4J A;  4YC9 A;  3O37 A;  4R2Y A;  3T6R A;  5LKT A;  4WZ2 A;  1VYX A;  3ZNI A;  2ECV A;  1WEU A;  3EB5 A;  3LRQ A;  2XEU A;  1U6G B;  2KE1 A;  3L1X A;  1WEM A;  4I7D A;  2MA6 A;  4LK9 A;  2VPD A;  4YAT A;  1X4U A;  3N9Q A;  2RI7 A;  5KH3 A;  3C6W A;  2FUU A;  4V3L C;  4S3O C;  2ZET C;  5G0F A;  1LDK C;  1WEP A;  2JMI A;  2KGG A;  2YUC A;  2HDP A;  1N87 A;  2YU4 A;  2F6N A;  2Y43 A;  4MVT A;  2BAY A;  2ECJ A;  3SHB A;  3NG2 A;  5LKU A;  5AIT A;  1WEV A;  2MNY A;  3V43 A;  2YHO A;  1BOR A;  3RPG B;  2JRJ A;  2M1R A;  3EB6 A;  2LXP C;  4C9Z A;  2YQL A;  3IHP A;  2XB1 A;  3M63 A;  5FB0 A;  2K4D A;  3HCS A;  2MA5 A;  3RTR B;  4CA1 A;  4YBS A;  1V87 A;  3O36 A;  5C11 A;  1DVP A;  2M3H A;  4P5O B;  4N3W A;  5JG6 A;  3ZPV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...