1X4UA

Solution structure of the fyve domain from human fyve domain containing 27 isoform b protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
84
structure length
84
Chain Sequence
GSSGSSGRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the FYVE domain from human FYVE domain containing 27 isoform b protein
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Zinc finger, FYVE domain containing 27 isoform b
total genus 5
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4uA01
2RI7A 2H0DA 5H1VA 2EODA 2YSMA 4V3LC 4N3WA 5KH9A 2CKLB 3I2DA 4GNFA 4YADA 4AP4A 1JOCA 2C2VS 1CHCA 1VYXA 2XEUA 1MM3A 2C2LA 4CA1A 2HYED 2L75A 1WEVA 2ECTA 5TABA 2VPEA 3KNVA 1LDKC 2D8SA 2YUCA 2OXQC 2G45A 3U5PA 2LDRA 4IC3A 4A4BA 3VK6A 3O36A 2VJFA 3SOXA 5B79A 4F52B 2L5UA 2YHOA 1IYMA 2ECJA 4AUQB 4N4FA 2VPBA 2KFTA 2MD8C 1N87A 3N9OA 1WESA 1V87A 1T1HA 3O35A 5KH7A 5FB0A 2YT5A 1FP0A 3SOUA 2MA5A 1JM7A 2E6SA 2DX8A 4W4UA 3LQIA 1WEQA 1FBVA 3ZPVE 4P5OB 5J3XA 2M1RA 2KREA 3LRQA 2VJEA 5AITA 4B7YC 3M99A 1Z6UA 2L80A 2ECWA 1WFKA 3ZNIA 2LGVA 2FUUA 4LK9A 3HCSA 3RTRB 4PTBA 2YYRA 3O34A 2KWJA 2JMJA 1VD4A 2KR4A 4FO9A 4V3KC 4I7DA 3DQVR 1RMDA 2LGLA 2KYUA 3RPGC 4O64A 4MSXA 2MNZA 2G6QA 3ZYQA 3C6WA 4FK5A 2MT5A 4A0CD 4R2YA 4UP5A 1Z60A 2YQLA 5FEYA 1WE9A 3NG2A 5TRBA 2MA6A 2LGGA 4YABA 2VJFB 4L58A 4ZQLA 5G0FA 5C11A 2H0DB 1HYIA 2VNFA 2LQ6A 4UP0A 1WIMA 2KE1A 3N9PA 3DPLR 2K17A 2KGGA 1WEMA 2JMIA 2PUYA 3M63A 3C5KA 4IC2A 4LLBA 3T7LA 3SHBA 5C13A 2QJ0A 3HCTA 4NN2A 2ECIA 4I7BA 2JRJA 1VFYA 4LKAA 3O7AA 2MNYA 3U5MA 2M85A 4R8PK 4L7XA 2YW8A 5G05B 2L43A 3N9QA 4A49A 4X3GA 4WZ0A 2UZGA 5LKZA 5JG6A 3LQHA 3EB5A 1X4JA 5B8DA 4QF3A 3IHPA 1WEOA 2LXHC 2KIZA 2Y43A 2G43A 1Z2QA 2EA6A 5B78A 2YREA 3GV4A 2K4DA 3PURA 4LJNA 4S3OB 5G04B 5TDWA 3L1ZB 4ZDTA 5EYAF 5DINA 2VPDA 2CSZA 2QICA 2QIZA 5FERA 2LN0A 1E4UA 1WEEA 2NAAA 4AVXA 2RSDA 3U5OA 2YSJA 2VPGA 2BAYA 2KU3A 3QZVA 3L11A 1HYJA 3RPGB 1WILA 1WEUA 2MUMA 3MHHA 4WZ2A 2LV9A 4YAXA 5LKTA 2PNXA 4XI1A 3FL2A 1F62A 2AN6A 2F6NA 4YBMA 3SOWA 4Q6FA 5B77A 2MIQA 1X4UA 2FSAA 2ECGA 3N9MA 1X4IA 4GNGA 5H1TA 4UI9B 5DKAA 2EGPA 1G25A 3HTKC 5AIUA 4A4CA 1BORA 2E6RA 4YBTA 1WEWA 2LRIC 2XB1A 4FJCA 3ZTGA 5H9MA 3N9NA 5LCWB 2M3HA 5TDRA 1WEPA 3KV6A 5D1MB 5FB1A 5KH3A 4S3OC 2CKLA 2HDPA 3MHSA 4MVTA 5D1LB 5B75A 4ZUXU 2YU4A 3U5NA 4GNEA 2KWNA 3LQJA 2JMDA 2VJEB 3O33A 3PHDA 2LXPC 2ZETC 4YATA 1U6GB 2LGKA 3O37A 1K2FA 2KWOA 4LADB 2CT2A 4YBSA 2Y1NA 1JM7B 3EB6A 1ZBDB 5I3LA 2I50A 2F42A 4GNDA 4WZ3B 3PUQA 4GB0A 4B86C 2K16A 4I7CA 5D1KB 3V43A 3GL6A 4YC9A 5LKXA 2YURA 2IDAA 5B76A 3L1XA 2ECVA 1WGMA 4AYCA 4CCGX 2MD7B 2CSYA 2F6JA 5H1UA 3ASLA 1LDJB 3ZPV1 1DVPA 2FUIA 4BHWA 2VP7A 3M62A 4R7EA 3KV5A 4QF2A 5TBNA 1XWHA 2ECNA 4PPEA 3N9LA 2YHNA 3O70A 1WENA 3HCUA 4C9ZA 2YQMA 3T6RA 5LKUA 2K1JA 2KGIA 2M6MA 3ZVYA 4TKPB 3ZVZB 4BBQA 3KQIA 2Y1MA 2L0BA 1MM2A 4FIPA 4WA6A 2KWKA 4AYCB
chains in the Genus database with same CATH superfamily
2RI7A 2H0DA 5H1VA 2EODA 2YSMA 4V3LC 4N3WA 5KH9A 2CKLB 3I2DA 3DWDA 4GNFA 4YADA 4AP4A 1JOCA 2C2VS 1CHCA 4O62A 3LVQE 1VYXA 2XEUA 1MM3A 2C2LA 4CA1A 2HYED 2L75A 4H9DA 1WEVA 2ECTA 5TABA 2VPEA 3KNVA 1LDKC 3FEHA 2D8SA 2YUCA 2OXQC 2G45A 5SVIB 3U5PA 2LDRA 3FAOA 4IC3A 4A4BA 3VK6A 3O36A 3MDBC 2VJFA 3SOXA 5B79A 2L7PA 4F52B 2L5UA 2EGMA 2KKYA 2YHOA 1IYMA 2ECJA 3LJUX 4AUQB 4N4FA 2VPBA 2KFTA 2MD8C 1N87A 2LAUA 2KKXA 3N9OA 1WESA 1V87A 1T1HA 3O35A 5KH7A 5FB0A 2YT5A 1FP0A 3SOUA 2MA5A 1JM7A 2E6SA 2DX8A 4W4UA 3LQIA 1WEQA 1FBVA 3ZPVE 4P5OB 3FM8C 5J3XA 2M1RA 2KREA 3LRQA 2VJEA 5AITA 4B7YC 3M99A 3FJUB 2YVRA 1Z6UA 2L80A 2ECWA 1WFKA 3ZNIA 2LGVA 2FUUA 4LK9A 3HCSA 3RTRB 4PTBA 1DCQA 2YYRA 3JUEA 3O34A 2KWJA 2JMJA 1VD4A 2KR4A 4FO9A 4V3KC 4I7DA 3DQVR 1RMDA 2LGLA 2KYUA 3RPGC 4OGCA 4O64A 4MSXA 2MNZA 2G6QA 3ZYQA 3C6WA 4FK5A 2MT5A 5SVYA 4A0CD 2JUNA 4R2YA 4UP5A 1Z60A 2YQLA 2JM3A 5FEYA 1WE9A 3NG2A 5TRBA 2MA6A 2LGGA 2CRWA 4YABA 2VJFB 2CONA 4L58A 2XOYA 4ZQLA 5G0FA 5C11A 2H0DB 1HYIA 2VNFA 2LQ6A 4UP0A 1WIMA 2KE1A 3N9PA 3DPLR 2K17A 2KGGA 1WEMA 2JMIA 2PUYA 3M63A 5K3QA 3C5KA 4IC2A 4LLBA 3T7LA 3SHBA 5C13A 2EXUA 2QJ0A 3HCTA 4NN2A 2ECIA 2P57A 4I7BA 2JRJA 3SUBA 1VFYA 4LKAA 3O7AA 2MNYA 3U5MA 2M85A 4R8PK 4L7XA 2YW8A 4Z0OA 5G05B 2L43A 3N9QA 4A49A 4X3GA 4WZ0A 2UZGA 5LKZA 3PLWA 5JG6A 3LQHA 3EB5A 1X4JA 5B8DA 4QF3A 3IHPA 1WEOA 3H7HA 2LXHC 2KIZA 2Y43A 2G43A 1Z2QA 2EA6A 5B78A 2YREA 3GV4A 2K4DA 3PURA 4LJNA 4S3OB 5G04B 5TDWA 3L1ZB 4ZDTA 5EYAF 5SVXA 5DINA 2VPDA 2CSZA 2QICA 2E61A 2QIZA 5FERA 2OWAA 2LN0A 1E4UA 3E2DA 1WEEA 2MKEA 2NAAA 1MBMA 3O47A 4AVXA 2RSDA 3U5OA 2YSJA 2VPGA 2BAYA 2KU3A 3QZVA 3L11A 1HYJA 3RPGB 1WILA 1WEUA 2MUMA 2XP0A 3MHHA 4QQ4A 4WZ2A 2LV9A 4YAXA 5LKTA 2PNXA 4XI1A 3FL2A 1F62A 2DJAA 2AN6A 2F6NA 4YBMA 2CSVA 3SOWA 4Q6FA 5B77A 2MIQA 1X4UA 2FSAA 2ECGA 3N9MA 1X4IA 4GNGA 5H1TA 2RR4A 4UI9B 5DKAA 2EGPA 1G25A 3HTKC 5AIUA 4A4CA 2FFWA 1BORA 2E6RA 4YBTA 1WEWA 3FANA 2LRIC 2XB1A 4FJCA 2IQJA 2M13A 3ZTGA 2CRRA 5H9MA 3N9NA 5LCWB 3KDEC 2M3HA 5TDRA 1WEPA 3KV6A 5D1MB 5FB1A 5KH3A 4S3OC 2CKLA 2HDPA 3MHSA 4MVTA 5D1LB 5B75A 4ZUXU 2YU4A 4Z0RA 3U5NA 4GNEA 2KWNA 3LQJA 2JMDA 2VJEB 3O33A 3PHDA 2D8UA 2LXPC 2ZETC 4YATA 1U6GB 2LGKA 3O37A 1K2FA 2KWOA 4LADB 2CT2A 4YBSA 2Y1NA 3Q1DA 1JM7B 3EB6A 1ZBDB 2DSMA 5I3LA 2I50A 4F1PA 2F42A 2B0OE 4GNDA 4WZ3B 3PUQA 4GB0A 4B86C 2XOCA 2K16A 4I7CA 5D1KB 3V43A 3GL6A 4YC9A 5LKXA 2YURA 3DDTA 2IDAA 5B76A 2XOZA 3L1XA 2ECVA 1WGMA 4AYCA 4CCGX 2MD7B 2CSYA 2F6JA 5H1UA 3LDYA 3ASLA 1LDJB 2FD4A 3ZPV1 1DVPA 2FUIA 4BHWA 5SVIA 2VP7A 3M62A 3M7KA 4R7EA 3KV5A 4QF2A 5TBNA 1XWHA 2ECNA 4PPEA 3LVRE 3N9LA 2YHNA 3O70A 1WENA 3HCUA 4C9ZA 2YQMA 3T6RA 5LKUA 2K1JA 2KGIA 2M6MA 4OGEA 3ZVYA 4TKPB 3ZVZB 4BBQA 3T9KA 3KQIA 2Y1MA 2L0BA 1MM2A 4FIPA 4WA6A 2KWKA 4AYCB
chains in the Genus database with same CATH topology
2RI7A 2H0DA 5H1VA 2EODA 2YSMA 4V3LC 4N3WA 5KH9A 2CKLB 3I2DA 4GNFA 4YADA 4AP4A 1JOCA 2C2VS 1CHCA 1VYXA 2XEUA 1MM3A 2C2LA 4CA1A 2HYED 2L75A 1WEVA 2ECTA 5TABA 2VPEA 3KNVA 1LDKC 2D8SA 2YUCA 2OXQC 2G45A 3U5PA 2LDRA 4IC3A 4A4BA 3VK6A 3O36A 2VJFA 3SOXA 5B79A 4F52B 2L5UA 2YHOA 1IYMA 2ECJA 4AUQB 4N4FA 2VPBA 2KFTA 2MD8C 1N87A 3N9OA 1WESA 1V87A 1T1HA 3O35A 5KH7A 5FB0A 2YT5A 1FP0A 3SOUA 2MA5A 1JM7A 2E6SA 2DX8A 4W4UA 3LQIA 1WEQA 1FBVA 3ZPVE 4P5OB 5J3XA 2M1RA 2KREA 3LRQA 2VJEA 5AITA 4B7YC 3M99A 1Z6UA 2L80A 2ECWA 1WFKA 3ZNIA 2LGVA 2FUUA 4LK9A 3HCSA 3RTRB 4PTBA 2YYRA 3O34A 2KWJA 2JMJA 1VD4A 2KR4A 4FO9A 4V3KC 4I7DA 3DQVR 1RMDA 2LGLA 2KYUA 3RPGC 4O64A 4MSXA 2MNZA 2G6QA 3ZYQA 3C6WA 4FK5A 2MT5A 4A0CD 4R2YA 4UP5A 1Z60A 2YQLA 5FEYA 1WE9A 3NG2A 5TRBA 2MA6A 2LGGA 4YABA 2VJFB 4L58A 4ZQLA 5G0FA 5C11A 2H0DB 1HYIA 2VNFA 2LQ6A 4UP0A 1WIMA 2KE1A 3N9PA 3DPLR 2K17A 2KGGA 1WEMA 2JMIA 2PUYA 3M63A 3C5KA 4IC2A 4LLBA 3T7LA 3SHBA 5C13A 2QJ0A 3HCTA 4NN2A 2ECIA 4I7BA 2JRJA 1VFYA 4LKAA 3O7AA 2MNYA 3U5MA 2M85A 4R8PK 4L7XA 2YW8A 5G05B 2L43A 3N9QA 4A49A 4X3GA 4WZ0A 2UZGA 5LKZA 5JG6A 3LQHA 3EB5A 1X4JA 5B8DA 4QF3A 3IHPA 1WEOA 2LXHC 2KIZA 2Y43A 2G43A 1Z2QA 2EA6A 5B78A 2YREA 3GV4A 2K4DA 3PURA 4LJNA 4S3OB 5G04B 5TDWA 3L1ZB 4ZDTA 5EYAF 5DINA 2VPDA 2CSZA 2QICA 2QIZA 5FERA 2LN0A 1E4UA 1WEEA 2NAAA 4AVXA 2RSDA 3U5OA 2YSJA 2VPGA 2BAYA 2KU3A 3QZVA 3L11A 1HYJA 3RPGB 1WILA 1WEUA 2MUMA 3MHHA 4WZ2A 2LV9A 4YAXA 5LKTA 2PNXA 4XI1A 3FL2A 1F62A 2AN6A 2F6NA 4YBMA 3SOWA 4Q6FA 5B77A 2MIQA 1X4UA 2FSAA 2ECGA 3N9MA 1X4IA 4GNGA 5H1TA 4UI9B 5DKAA 2EGPA 1G25A 3HTKC 5AIUA 4A4CA 1BORA 2E6RA 4YBTA 1WEWA 2LRIC 2XB1A 4FJCA 3ZTGA 5H9MA 3N9NA 5LCWB 2M3HA 5TDRA 1WEPA 3KV6A 5D1MB 5FB1A 5KH3A 4S3OC 2CKLA 2HDPA 3MHSA 4MVTA 5D1LB 5B75A 4ZUXU 2YU4A 3U5NA 4GNEA 2KWNA 3LQJA 2JMDA 2VJEB 3O33A 3PHDA 2LXPC 2ZETC 4YATA 1U6GB 2LGKA 3O37A 1K2FA 2KWOA 4LADB 2CT2A 4YBSA 2Y1NA 1JM7B 3EB6A 1ZBDB 5I3LA 2I50A 2F42A 4GNDA 4WZ3B 3PUQA 4GB0A 4B86C 2K16A 4I7CA 5D1KB 3V43A 3GL6A 4YC9A 5LKXA 2YURA 2IDAA 5B76A 3L1XA 2ECVA 1WGMA 4AYCA 4CCGX 2MD7B 2CSYA 2F6JA 5H1UA 3ASLA 1LDJB 3ZPV1 1DVPA 2FUIA 4BHWA 2VP7A 3M62A 4R7EA 3KV5A 4QF2A 5TBNA 1XWHA 2ECNA 4PPEA 3N9LA 2YHNA 3O70A 1WENA 3HCUA 4C9ZA 2YQMA 3T6RA 5LKUA 2K1JA 2KGIA 2M6MA 3ZVYA 4TKPB 3ZVZB 4BBQA 3KQIA 2Y1MA 2L0BA 1MM2A 4FIPA 4WA6A 2KWKA 4AYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI7 A;  2H0D A;  5H1V A;  2EOD A;  2YSM A;  4V3L C;  4N3W A;  5KH9 A;  2CKL B;  3I2D A;  4GNF A;  4YAD A;  4AP4 A;  1JOC A;  2C2V S;  1CHC A;  1VYX A;  2XEU A;  1MM3 A;  2C2L A;  4CA1 A;  2HYE D;  2L75 A;  1WEV A;  2ECT A;  5TAB A;  2VPE A;  3KNV A;  1LDK C;  2D8S A;  2YUC A;  2OXQ C;  2G45 A;  3U5P A;  2LDR A;  4IC3 A;  4A4B A;  3VK6 A;  3O36 A;  2VJF A;  3SOX A;  5B79 A;  4F52 B;  2L5U A;  2YHO A;  1IYM A;  2ECJ A;  4AUQ B;  4N4F A;  2VPB A;  2KFT A;  2MD8 C;  1N87 A;  3N9O A;  1WES A;  1V87 A;  1T1H A;  3O35 A;  5KH7 A;  5FB0 A;  2YT5 A;  1FP0 A;  3SOU A;  2MA5 A;  1JM7 A;  2E6S A;  2DX8 A;  4W4U A;  3LQI A;  1WEQ A;  1FBV A;  3ZPV E;  4P5O B;  5J3X A;  2M1R A;  2KRE A;  3LRQ A;  2VJE A;  5AIT A;  4B7Y C;  3M99 A;  1Z6U A;  2L80 A;  2ECW A;  1WFK A;  3ZNI A;  2LGV A;  2FUU A;  4LK9 A;  3HCS A;  3RTR B;  4PTB A;  2YYR A;  3O34 A;  2KWJ A;  2JMJ A;  1VD4 A;  2KR4 A;  4FO9 A;  4V3K C;  4I7D A;  3DQV R;  1RMD A;  2LGL A;  2KYU A;  3RPG C;  4O64 A;  4MSX A;  2MNZ A;  2G6Q A;  3ZYQ A;  3C6W A;  4FK5 A;  2MT5 A;  4A0C D;  4R2Y A;  4UP5 A;  1Z60 A;  2YQL A;  5FEY A;  1WE9 A;  3NG2 A;  5TRB A;  2MA6 A;  2LGG A;  4YAB A;  2VJF B;  4L58 A;  4ZQL A;  5G0F A;  5C11 A;  2H0D B;  1HYI A;  2VNF A;  2LQ6 A;  4UP0 A;  1WIM A;  2KE1 A;  3N9P A;  3DPL R;  2K17 A;  2KGG A;  1WEM A;  2JMI A;  2PUY A;  3M63 A;  3C5K A;  4IC2 A;  4LLB A;  3T7L A;  3SHB A;  5C13 A;  2QJ0 A;  3HCT A;  4NN2 A;  2ECI A;  4I7B A;  2JRJ A;  1VFY A;  4LKA A;  3O7A A;  2MNY A;  3U5M A;  2M85 A;  4R8P K;  4L7X A;  2YW8 A;  5G05 B;  2L43 A;  3N9Q A;  4A49 A;  4X3G A;  4WZ0 A;  2UZG A;  5LKZ A;  5JG6 A;  3LQH A;  3EB5 A;  1X4J A;  5B8D A;  4QF3 A;  3IHP A;  1WEO A;  2LXH C;  2KIZ A;  2Y43 A;  2G43 A;  1Z2Q A;  2EA6 A;  5B78 A;  2YRE A;  3GV4 A;  2K4D A;  3PUR A;  4LJN A;  4S3O B;  5G04 B;  5TDW A;  3L1Z B;  4ZDT A;  5EYA F;  5DIN A;  2VPD A;  2CSZ A;  2QIC A;  2QIZ A;  5FER A;  2LN0 A;  1E4U A;  1WEE A;  2NAA A;  4AVX A;  2RSD A;  3U5O A;  2YSJ A;  2VPG A;  2BAY A;  2KU3 A;  3QZV A;  3L11 A;  1HYJ A;  3RPG B;  1WIL A;  1WEU A;  2MUM A;  3MHH A;  4WZ2 A;  2LV9 A;  4YAX A;  5LKT A;  2PNX A;  4XI1 A;  3FL2 A;  1F62 A;  2AN6 A;  2F6N A;  4YBM A;  3SOW A;  4Q6F A;  5B77 A;  2MIQ A;  1X4U A;  2FSA A;  2ECG A;  3N9M A;  1X4I A;  4GNG A;  5H1T A;  4UI9 B;  5DKA A;  2EGP A;  1G25 A;  3HTK C;  5AIU A;  4A4C A;  1BOR A;  2E6R A;  4YBT A;  1WEW A;  2LRI C;  2XB1 A;  4FJC A;  3ZTG A;  5H9M A;  3N9N A;  5LCW B;  2M3H A;  5TDR A;  1WEP A;  3KV6 A;  5D1M B;  5FB1 A;  5KH3 A;  4S3O C;  2CKL A;  2HDP A;  3MHS A;  4MVT A;  5D1L B;  5B75 A;  4ZUX U;  2YU4 A;  3U5N A;  4GNE A;  2KWN A;  3LQJ A;  2JMD A;  2VJE B;  3O33 A;  3PHD A;  2LXP C;  2ZET C;  4YAT A;  1U6G B;  2LGK A;  3O37 A;  1K2F A;  2KWO A;  4LAD B;  2CT2 A;  4YBS A;  2Y1N A;  1JM7 B;  3EB6 A;  1ZBD B;  5I3L A;  2I50 A;  2F42 A;  4GND A;  4WZ3 B;  3PUQ A;  4GB0 A;  4B86 C;  2K16 A;  4I7C A;  5D1K B;  3V43 A;  3GL6 A;  4YC9 A;  5LKX A;  2YUR A;  2IDA A;  5B76 A;  3L1X A;  2ECV A;  1WGM A;  4AYC A;  4CCG X;  2MD7 B;  2CSY A;  2F6J A;  5H1U A;  3ASL A;  1LDJ B;  3ZPV 1;  1DVP A;  2FUI A;  4BHW A;  2VP7 A;  3M62 A;  4R7E A;  3KV5 A;  4QF2 A;  5TBN A;  1XWH A;  2ECN A;  4PPE A;  3N9L A;  2YHN A;  3O70 A;  1WEN A;  3HCU A;  4C9Z A;  2YQM A;  3T6R A;  5LKU A;  2K1J A;  2KGI A;  2M6M A;  3ZVY A;  4TKP B;  3ZVZ B;  4BBQ A;  3KQI A;  2Y1M A;  2L0B A;  1MM2 A;  4FIP A;  4WA6 A;  2KWK A;  4AYC B; 
#chains in the Genus database with same CATH topology
 2RI7 A;  2H0D A;  5H1V A;  2EOD A;  2YSM A;  4V3L C;  4N3W A;  5KH9 A;  2CKL B;  3I2D A;  3DWD A;  4GNF A;  4YAD A;  4AP4 A;  1JOC A;  2C2V S;  1CHC A;  4O62 A;  3LVQ E;  1VYX A;  2XEU A;  1MM3 A;  2C2L A;  4CA1 A;  2HYE D;  2L75 A;  4H9D A;  1WEV A;  2ECT A;  5TAB A;  2VPE A;  3KNV A;  1LDK C;  3FEH A;  2D8S A;  2YUC A;  2OXQ C;  2G45 A;  5SVI B;  3U5P A;  2LDR A;  3FAO A;  4IC3 A;  4A4B A;  3VK6 A;  3O36 A;  3MDB C;  2VJF A;  3SOX A;  5B79 A;  2L7P A;  4F52 B;  2L5U A;  2EGM A;  2KKY A;  2YHO A;  1IYM A;  2ECJ A;  3LJU X;  4AUQ B;  4N4F A;  2VPB A;  2KFT A;  2MD8 C;  1N87 A;  2LAU A;  2KKX A;  3N9O A;  1WES A;  1V87 A;  1T1H A;  3O35 A;  5KH7 A;  5FB0 A;  2YT5 A;  1FP0 A;  3SOU A;  2MA5 A;  1JM7 A;  2E6S A;  2DX8 A;  4W4U A;  3LQI A;  1WEQ A;  1FBV A;  3ZPV E;  4P5O B;  3FM8 C;  5J3X A;  2M1R A;  2KRE A;  3LRQ A;  2VJE A;  5AIT A;  4B7Y C;  3M99 A;  3FJU B;  2YVR A;  1Z6U A;  2L80 A;  2ECW A;  1WFK A;  3ZNI A;  2LGV A;  2FUU A;  4LK9 A;  3HCS A;  3RTR B;  4PTB A;  1DCQ A;  2YYR A;  3JUE A;  3O34 A;  2KWJ A;  2JMJ A;  1VD4 A;  2KR4 A;  4FO9 A;  4V3K C;  4I7D A;  3DQV R;  1RMD A;  2LGL A;  2KYU A;  3RPG C;  4OGC A;  4O64 A;  4MSX A;  2MNZ A;  2G6Q A;  3ZYQ A;  3C6W A;  4FK5 A;  2MT5 A;  5SVY A;  4A0C D;  2JUN A;  4R2Y A;  4UP5 A;  1Z60 A;  2YQL A;  2JM3 A;  5FEY A;  1WE9 A;  3NG2 A;  5TRB A;  2MA6 A;  2LGG A;  2CRW A;  4YAB A;  2VJF B;  2CON A;  4L58 A;  2XOY A;  4ZQL A;  5G0F A;  5C11 A;  2H0D B;  1HYI A;  2VNF A;  2LQ6 A;  4UP0 A;  1WIM A;  2KE1 A;  3N9P A;  3DPL R;  2K17 A;  2KGG A;  1WEM A;  2JMI A;  2PUY A;  3M63 A;  5K3Q A;  3C5K A;  4IC2 A;  4LLB A;  3T7L A;  3SHB A;  5C13 A;  2EXU A;  2QJ0 A;  3HCT A;  4NN2 A;  2ECI A;  2P57 A;  4I7B A;  2JRJ A;  3SUB A;  1VFY A;  4LKA A;  3O7A A;  2MNY A;  3U5M A;  2M85 A;  4R8P K;  4L7X A;  2YW8 A;  4Z0O A;  5G05 B;  2L43 A;  3N9Q A;  4A49 A;  4X3G A;  4WZ0 A;  2UZG A;  5LKZ A;  3PLW A;  5JG6 A;  3LQH A;  3EB5 A;  1X4J A;  5B8D A;  4QF3 A;  3IHP A;  1WEO A;  3H7H A;  2LXH C;  2KIZ A;  2Y43 A;  2G43 A;  1Z2Q A;  2EA6 A;  5B78 A;  2YRE A;  3GV4 A;  2K4D A;  3PUR A;  4LJN A;  4S3O B;  5G04 B;  5TDW A;  3L1Z B;  4ZDT A;  5EYA F;  5SVX A;  5DIN A;  2VPD A;  2CSZ A;  2QIC A;  2E61 A;  2QIZ A;  5FER A;  2OWA A;  2LN0 A;  1E4U A;  3E2D A;  1WEE A;  2MKE A;  2NAA A;  1MBM A;  3O47 A;  4AVX A;  2RSD A;  3U5O A;  2YSJ A;  2VPG A;  2BAY A;  2KU3 A;  3QZV A;  3L11 A;  1HYJ A;  3RPG B;  1WIL A;  1WEU A;  2MUM A;  2XP0 A;  3MHH A;  4QQ4 A;  4WZ2 A;  2LV9 A;  4YAX A;  5LKT A;  2PNX A;  4XI1 A;  3FL2 A;  1F62 A;  2DJA A;  2AN6 A;  2F6N A;  4YBM A;  2CSV A;  3SOW A;  4Q6F A;  5B77 A;  2MIQ A;  1X4U A;  2FSA A;  2ECG A;  3N9M A;  1X4I A;  4GNG A;  5H1T A;  2RR4 A;  4UI9 B;  5DKA A;  2EGP A;  1G25 A;  3HTK C;  5AIU A;  4A4C A;  2FFW A;  1BOR A;  2E6R A;  4YBT A;  1WEW A;  3FAN A;  2LRI C;  2XB1 A;  4FJC A;  2IQJ A;  2M13 A;  3ZTG A;  2CRR A;  5H9M A;  3N9N A;  5LCW B;  3KDE C;  2M3H A;  5TDR A;  1WEP A;  3KV6 A;  5D1M B;  5FB1 A;  5KH3 A;  4S3O C;  2CKL A;  2HDP A;  3MHS A;  4MVT A;  5D1L B;  5B75 A;  4ZUX U;  2YU4 A;  4Z0R A;  3U5N A;  4GNE A;  2KWN A;  3LQJ A;  2JMD A;  2VJE B;  3O33 A;  3PHD A;  2D8U A;  2LXP C;  2ZET C;  4YAT A;  1U6G B;  2LGK A;  3O37 A;  1K2F A;  2KWO A;  4LAD B;  2CT2 A;  4YBS A;  2Y1N A;  3Q1D A;  1JM7 B;  3EB6 A;  1ZBD B;  2DSM A;  5I3L A;  2I50 A;  4F1P A;  2F42 A;  2B0O E;  4GND A;  4WZ3 B;  3PUQ A;  4GB0 A;  4B86 C;  2XOC A;  2K16 A;  4I7C A;  5D1K B;  3V43 A;  3GL6 A;  4YC9 A;  5LKX A;  2YUR A;  3DDT A;  2IDA A;  5B76 A;  2XOZ A;  3L1X A;  2ECV A;  1WGM A;  4AYC A;  4CCG X;  2MD7 B;  2CSY A;  2F6J A;  5H1U A;  3LDY A;  3ASL A;  1LDJ B;  2FD4 A;  3ZPV 1;  1DVP A;  2FUI A;  4BHW A;  5SVI A;  2VP7 A;  3M62 A;  3M7K A;  4R7E A;  3KV5 A;  4QF2 A;  5TBN A;  1XWH A;  2ECN A;  4PPE A;  3LVR E;  3N9L A;  2YHN A;  3O70 A;  1WEN A;  3HCU A;  4C9Z A;  2YQM A;  3T6R A;  5LKU A;  2K1J A;  2KGI A;  2M6M A;  4OGE A;  3ZVY A;  4TKP B;  3ZVZ B;  4BBQ A;  3T9K A;  3KQI A;  2Y1M A;  2L0B A;  1MM2 A;  4FIP A;  4WA6 A;  2KWK A;  4AYC B; 
#chains in the Genus database with same CATH homology
 2RI7 A;  2H0D A;  5H1V A;  2EOD A;  2YSM A;  4V3L C;  4N3W A;  5KH9 A;  2CKL B;  3I2D A;  4GNF A;  4YAD A;  4AP4 A;  1JOC A;  2C2V S;  1CHC A;  1VYX A;  2XEU A;  1MM3 A;  2C2L A;  4CA1 A;  2HYE D;  2L75 A;  1WEV A;  2ECT A;  5TAB A;  2VPE A;  3KNV A;  1LDK C;  2D8S A;  2YUC A;  2OXQ C;  2G45 A;  3U5P A;  2LDR A;  4IC3 A;  4A4B A;  3VK6 A;  3O36 A;  2VJF A;  3SOX A;  5B79 A;  4F52 B;  2L5U A;  2YHO A;  1IYM A;  2ECJ A;  4AUQ B;  4N4F A;  2VPB A;  2KFT A;  2MD8 C;  1N87 A;  3N9O A;  1WES A;  1V87 A;  1T1H A;  3O35 A;  5KH7 A;  5FB0 A;  2YT5 A;  1FP0 A;  3SOU A;  2MA5 A;  1JM7 A;  2E6S A;  2DX8 A;  4W4U A;  3LQI A;  1WEQ A;  1FBV A;  3ZPV E;  4P5O B;  5J3X A;  2M1R A;  2KRE A;  3LRQ A;  2VJE A;  5AIT A;  4B7Y C;  3M99 A;  1Z6U A;  2L80 A;  2ECW A;  1WFK A;  3ZNI A;  2LGV A;  2FUU A;  4LK9 A;  3HCS A;  3RTR B;  4PTB A;  2YYR A;  3O34 A;  2KWJ A;  2JMJ A;  1VD4 A;  2KR4 A;  4FO9 A;  4V3K C;  4I7D A;  3DQV R;  1RMD A;  2LGL A;  2KYU A;  3RPG C;  4O64 A;  4MSX A;  2MNZ A;  2G6Q A;  3ZYQ A;  3C6W A;  4FK5 A;  2MT5 A;  4A0C D;  4R2Y A;  4UP5 A;  1Z60 A;  2YQL A;  5FEY A;  1WE9 A;  3NG2 A;  5TRB A;  2MA6 A;  2LGG A;  4YAB A;  2VJF B;  4L58 A;  4ZQL A;  5G0F A;  5C11 A;  2H0D B;  1HYI A;  2VNF A;  2LQ6 A;  4UP0 A;  1WIM A;  2KE1 A;  3N9P A;  3DPL R;  2K17 A;  2KGG A;  1WEM A;  2JMI A;  2PUY A;  3M63 A;  3C5K A;  4IC2 A;  4LLB A;  3T7L A;  3SHB A;  5C13 A;  2QJ0 A;  3HCT A;  4NN2 A;  2ECI A;  4I7B A;  2JRJ A;  1VFY A;  4LKA A;  3O7A A;  2MNY A;  3U5M A;  2M85 A;  4R8P K;  4L7X A;  2YW8 A;  5G05 B;  2L43 A;  3N9Q A;  4A49 A;  4X3G A;  4WZ0 A;  2UZG A;  5LKZ A;  5JG6 A;  3LQH A;  3EB5 A;  1X4J A;  5B8D A;  4QF3 A;  3IHP A;  1WEO A;  2LXH C;  2KIZ A;  2Y43 A;  2G43 A;  1Z2Q A;  2EA6 A;  5B78 A;  2YRE A;  3GV4 A;  2K4D A;  3PUR A;  4LJN A;  4S3O B;  5G04 B;  5TDW A;  3L1Z B;  4ZDT A;  5EYA F;  5DIN A;  2VPD A;  2CSZ A;  2QIC A;  2QIZ A;  5FER A;  2LN0 A;  1E4U A;  1WEE A;  2NAA A;  4AVX A;  2RSD A;  3U5O A;  2YSJ A;  2VPG A;  2BAY A;  2KU3 A;  3QZV A;  3L11 A;  1HYJ A;  3RPG B;  1WIL A;  1WEU A;  2MUM A;  3MHH A;  4WZ2 A;  2LV9 A;  4YAX A;  5LKT A;  2PNX A;  4XI1 A;  3FL2 A;  1F62 A;  2AN6 A;  2F6N A;  4YBM A;  3SOW A;  4Q6F A;  5B77 A;  2MIQ A;  1X4U A;  2FSA A;  2ECG A;  3N9M A;  1X4I A;  4GNG A;  5H1T A;  4UI9 B;  5DKA A;  2EGP A;  1G25 A;  3HTK C;  5AIU A;  4A4C A;  1BOR A;  2E6R A;  4YBT A;  1WEW A;  2LRI C;  2XB1 A;  4FJC A;  3ZTG A;  5H9M A;  3N9N A;  5LCW B;  2M3H A;  5TDR A;  1WEP A;  3KV6 A;  5D1M B;  5FB1 A;  5KH3 A;  4S3O C;  2CKL A;  2HDP A;  3MHS A;  4MVT A;  5D1L B;  5B75 A;  4ZUX U;  2YU4 A;  3U5N A;  4GNE A;  2KWN A;  3LQJ A;  2JMD A;  2VJE B;  3O33 A;  3PHD A;  2LXP C;  2ZET C;  4YAT A;  1U6G B;  2LGK A;  3O37 A;  1K2F A;  2KWO A;  4LAD B;  2CT2 A;  4YBS A;  2Y1N A;  1JM7 B;  3EB6 A;  1ZBD B;  5I3L A;  2I50 A;  2F42 A;  4GND A;  4WZ3 B;  3PUQ A;  4GB0 A;  4B86 C;  2K16 A;  4I7C A;  5D1K B;  3V43 A;  3GL6 A;  4YC9 A;  5LKX A;  2YUR A;  2IDA A;  5B76 A;  3L1X A;  2ECV A;  1WGM A;  4AYC A;  4CCG X;  2MD7 B;  2CSY A;  2F6J A;  5H1U A;  3ASL A;  1LDJ B;  3ZPV 1;  1DVP A;  2FUI A;  4BHW A;  2VP7 A;  3M62 A;  4R7E A;  3KV5 A;  4QF2 A;  5TBN A;  1XWH A;  2ECN A;  4PPE A;  3N9L A;  2YHN A;  3O70 A;  1WEN A;  3HCU A;  4C9Z A;  2YQM A;  3T6R A;  5LKU A;  2K1J A;  2KGI A;  2M6M A;  3ZVY A;  4TKP B;  3ZVZ B;  4BBQ A;  3KQI A;  2Y1M A;  2L0B A;  1MM2 A;  4FIP A;  4WA6 A;  2KWK A;  4AYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...