1X4UA

Solution structure of the fyve domain from human fyve domain containing 27 isoform b protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
84
structure length
84
Chain Sequence
GSSGSSGRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger, FYVE domain containing 27 isoform b
publication title Solution structure of the FYVE domain from human FYVE domain containing 27 isoform b protein
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 5
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4uA01
4YBTA 1WENA 1Z6UA 3U5MA 5TABA 3ZPVE 1VFYA 4GB0A 1WEMA 2MD8C 2KIZA 4I7CA 4IC2A 1WEOA 2CKLA 3C5KA 1VD4A 2VJFA 2NAAA 2ECJA 3T7LA 3M99A 2VJEA 3N9LA 2XEUA 5LKUA 3N9QA 2VPBA 1RMDA 2M6MA 2VPEA 1Z60A 2ECGA 4AYCA 2YT5A 4ZDTA 4S3OB 2EODA 3KNVA 3EB5A 2CKLB 5C13A 1BORA 2M3HA 1WEPA 2I50A 4CA1A 3FL2A 3IHPA 5TRBA 4QF2A 2KWKA 2XB1A 4L7XA 4N4FA 2AN6A 2BAYA 4BHWA 2OXQC 3NG2A 1E4UA 2L5UA 3L1ZB 3O35A 1XWHA 4YADA 2L0BA 4A4CA 2L80A 2EGPA 1T1HA 5B78A 4QF3A 4AYCB 3O33A 2LGKA 4W4UA 2KFTA 2JMIA 2YUCA 4YAXA 2LV9A 1WE9A 1WEEA 2ZETC 4B86C 4C9ZA 2MUMA 1X4IA 1JM7A 4GNDA 3KQIA 2MNYA 2C2VS 1LDKC 2YW8A 1WEQA 2G6QA 3ZVZB 5G05B 2IDAA 4YBSA 4YABA 4FO9A 2CSYA 5EYAF 3U5NA 2VNFA 2LGLA 4WZ3B 4UP0A 3HCTA 5FERA 3DPLR 4P5OB 2G45A 2MD7B 3LQHA 2F42A 1FBVA 5D1MB 4I7BA 1G25A 2ECNA 3ZVYA 2VPDA 4MVTA 5AITA 4I7DA 4R7EA 4LADB 4TKPB 2D8SA 1IYMA 5DINA 2KWJA 2EA6A 2RI7A 3KV6A 2K4DA 4NN2A 2Y1NA 1JOCA 4UP5A 2LRIC 2YU4A 4FJCA 2DX8A 3GL6A 1MM2A 1MM3A 3L1XA 4O64A 2VJFB 3HCUA 2KE1A 1X4UA 2CSZA 2VPGA 4V3LC 5D1LB 1HYIA 5KH9A 1U6GB 4AUQB 2L43A 4LKAA 1WFKA 2VJEB 2FSAA 2YREA 3HTKC 3V43A 4LJNA 1FP0A 1CHCA 4X3GA 2YQLA 5D1KB 4LLBA 4ZUXU 5TBNA 2YHNA 2YQMA 2L75A 2ECVA 2KGIA 2H0DA 4CCGX 2YSJA 5G0FA 4BBQA 4PTBA 3M62A 5B8DA 4L58A 3O36A 5LKZA 1HYJA 3EB6A 2PUYA 4A49A 3LQIA 2K17A 3KV5A 4YC9A 5LKXA 3L11A 3U5OA 2LXHC 3RPGC 4WA6A 5B79A 2KREA 3ZYQA 2PNXA 2Y1MA 2LGVA 4AVXA 2YURA 5G04B 3N9NA 1WEVA 3I2DA 2VP7A 4FIPA 4Q6FA 2KWOA 5LCWB 1WILA 4UI9B 2QICA 3ZTGA 2FUUA 4PPEA 3O37A 1JM7B 3MHSA 4A4BA 1Z2QA 3PHDA 3MHHA 2KU3A 3PUQA 1WIMA 2M1RA 4YATA 1ZBDB 5H9MA 1DVPA 5DKAA 2F6JA 3SOWA 1WESA 1LDJB 3HCSA 2ECIA 3QZVA 3T6RA 2JRJA 2KYUA 5AIUA 1K2FA 3LQJA 3SOXA 5TDWA 5FEYA 3M63A 2G43A 3SOUA 1WEWA 4YBMA 4WZ2A 2FUIA 5B76A 4XI1A 5JG6A 2F6NA 2KGGA 4WZ0A 2LGGA 5KH7A 3U5PA 2KR4A 2UZGA 2MA5A 2JMJA 2KWNA 3VK6A 4R8PK 3SHBA 1F62A 2YHOA 2MT5A 2LQ6A 2ECTA 4N3WA 2MIQA 4ZQLA 2MA6A 3O34A 1WEUA 4IC3A 4V3KC 3RTRB 5J3XA 2M85A 3N9OA 4GNFA 2HDPA 3N9MA 2YSMA 4AP4A 2RSDA 4R2YA 2LXPC 4S3OC 2YYRA 1X4JA 5B77A 2HYED 2ECWA 4FK5A 3N9PA 2K1JA 3RPGB 3ZPV1 1V87A 3O7AA 3PURA 1WGMA 5FB0A 4GNEA 5H1UA 4MSXA 5KH3A 2JMDA 2LN0A 3C6WA 5H1TA 2Y43A 2C2LA 4B7YC 2QJ0A 4F52B 3ZNIA 5LKTA 3O70A 2CT2A 4GNGA 3DQVR 2E6SA 1N87A 4LK9A 5C11A 4A0CD 5I3LA 5FB1A 3LRQA 2K16A 1VYXA 2E6RA 2H0DB 5B75A 2QIZA 5TDRA 2MNZA 5H1VA 2LDRA 3ASLA 3GV4A
chains in the Genus database with same CATH superfamily
4YBTA 1WENA 1Z6UA 3U5MA 5TABA 3ZPVE 1VFYA 4GB0A 1WEMA 2MD8C 2XOZA 2KIZA 4I7CA 4IC2A 1WEOA 2CKLA 3C5KA 1VD4A 2VJFA 2NAAA 2ECJA 4Z0RA 3T7LA 3M99A 3H7HA 3O47A 2VJEA 3N9LA 2XEUA 5LKUA 3N9QA 5SVIA 5SVYA 2VPBA 1RMDA 2M6MA 3T9KA 2VPEA 1Z60A 2ECGA 4AYCA 2YT5A 2XP0A 4ZDTA 4S3OB 2EODA 3KNVA 3EB5A 2CKLB 5C13A 1BORA 2M3HA 1WEPA 2I50A 4CA1A 3FL2A 3IHPA 5TRBA 4QF2A 2KWKA 2E61A 2XB1A 4L7XA 3DWDA 4N4FA 2AN6A 3LVRE 2BAYA 4BHWA 2OXQC 3NG2A 4O62A 1E4UA 2L5UA 3L1ZB 3O35A 1XWHA 4YADA 2L0BA 4A4CA 3LJUX 2L80A 2EGPA 1T1HA 5B78A 4QF3A 4AYCB 4OGCA 3O33A 3DDTA 2LGKA 4W4UA 2KFTA 2JMIA 2YUCA 4YAXA 2B0OE 2LV9A 1WE9A 1WEEA 2ZETC 4B86C 4C9ZA 4H9DA 2CRWA 2MUMA 1X4IA 1JM7A 4GNDA 3KQIA 2MNYA 2C2VS 1LDKC 2YW8A 1WEQA 2G6QA 3ZVZB 5G05B 2IDAA 4YBSA 4YABA 4FO9A 2CSYA 5EYAF 3U5NA 2VNFA 2XOCA 2LGLA 4WZ3B 4UP0A 3HCTA 5FERA 3DPLR 4P5OB 2G45A 2MD7B 3LQHA 2EXUA 2F42A 2M13A 1FBVA 5D1MB 4I7BA 1G25A 2ECNA 3ZVYA 2VPDA 2KKYA 3SUBA 4MVTA 5AITA 4I7DA 4R7EA 4LADB 4TKPB 2D8SA 1IYMA 5DINA 2P57A 2L7PA 3FJUB 2KWJA 2EA6A 2JM3A 2RI7A 3KV6A 2K4DA 4NN2A 2Y1NA 3FEHA 1JOCA 4UP5A 2LRIC 2YU4A 4FJCA 2RR4A 2DX8A 3GL6A 3E2DA 1MM2A 1MM3A 3L1XA 4O64A 2VJFB 3HCUA 2KE1A 1X4UA 2CSZA 2VPGA 4V3LC 5D1LB 1HYIA 5KH9A 1U6GB 4AUQB 2L43A 4LKAA 1DCQA 1WFKA 2VJEB 2FSAA 2YREA 3HTKC 3V43A 4LJNA 1FP0A 3FAOA 4OGEA 1CHCA 5SVIB 3JUEA 4X3GA 2YQLA 5D1KB 4LLBA 4ZUXU 5TBNA 2YHNA 2YQMA 2DJAA 3M7KA 2DSMA 3FM8C 2MKEA 2L75A 2ECVA 3LDYA 1MBMA 2KGIA 2H0DA 4CCGX 2YSJA 2JUNA 5G0FA 4BBQA 4Z0OA 2CSVA 4PTBA 3M62A 5B8DA 4L58A 3O36A 3KDEC 5LKZA 1HYJA 3EB6A 2PUYA 4A49A 3LQIA 2K17A 3KV5A 4YC9A 5LKXA 3L11A 3U5OA 2LXHC 3RPGC 2LAUA 4WA6A 5B79A 2KREA 3ZYQA 2PNXA 2Y1MA 2LGVA 4AVXA 5K3QA 2YURA 5G04B 3N9NA 1WEVA 3I2DA 2VP7A 4FIPA 4Q6FA 2KWOA 2KKXA 5LCWB 1WILA 4UI9B 2QICA 3ZTGA 2FUUA 4PPEA 3O37A 1JM7B 3MHSA 4A4BA 1Z2QA 3PHDA 3MHHA 2KU3A 3PUQA 3MDBC 3FANA 1WIMA 3LVQE 2M1RA 4YATA 1ZBDB 5H9MA 1DVPA 5DKAA 2F6JA 3SOWA 2OWAA 1WESA 1LDJB 3HCSA 2ECIA 2FD4A 3QZVA 3T6RA 2JRJA 2KYUA 5SVXA 5AIUA 1K2FA 3LQJA 3SOXA 5TDWA 2YVRA 5FEYA 3M63A 2G43A 3SOUA 1WEWA 4YBMA 4WZ2A 2FUIA 5B76A 4XI1A 5JG6A 2F6NA 2KGGA 4WZ0A 2LGGA 5KH7A 3U5PA 2KR4A 2UZGA 2MA5A 2JMJA 2KWNA 3VK6A 4QQ4A 3SHBA 4R8PK 1F62A 2YHOA 2MT5A 2LQ6A 2ECTA 4N3WA 2MIQA 4ZQLA 2MA6A 3O34A 1WEUA 2FFWA 4IC3A 4V3KC 3RTRB 5J3XA 2IQJA 2M85A 3N9OA 4GNFA 2HDPA 3N9MA 2YSMA 4AP4A 2RSDA 4R2YA 2LXPC 4S3OC 2YYRA 1X4JA 5B77A 2CRRA 2D8UA 2HYED 2ECWA 4FK5A 3N9PA 2K1JA 3RPGB 3ZPV1 1V87A 3O7AA 3PURA 1WGMA 5FB0A 3PLWA 4GNEA 5H1UA 4MSXA 5KH3A 2JMDA 2LN0A 3C6WA 5H1TA 2Y43A 2C2LA 4B7YC 2QJ0A 4F52B 3ZNIA 5LKTA 3O70A 2CT2A 4GNGA 3DQVR 2EGMA 2E6SA 1N87A 4F1PA 4LK9A 5C11A 4A0CD 5I3LA 5FB1A 3LRQA 2XOYA 2CONA 2K16A 1VYXA 2E6RA 2H0DB 5B75A 2QIZA 3Q1DA 5TDRA 2MNZA 5H1VA 2LDRA 3ASLA 3GV4A
chains in the Genus database with same CATH topology
4YBTA 1WENA 1Z6UA 3U5MA 5TABA 3ZPVE 1VFYA 4GB0A 1WEMA 2MD8C 2KIZA 4I7CA 4IC2A 1WEOA 2CKLA 3C5KA 1VD4A 2VJFA 2NAAA 2ECJA 3T7LA 3M99A 2VJEA 3N9LA 2XEUA 5LKUA 3N9QA 2VPBA 1RMDA 2M6MA 2VPEA 1Z60A 2ECGA 4AYCA 2YT5A 4ZDTA 4S3OB 2EODA 3KNVA 3EB5A 2CKLB 5C13A 1BORA 2M3HA 1WEPA 2I50A 4CA1A 3FL2A 3IHPA 5TRBA 4QF2A 2KWKA 2XB1A 4L7XA 4N4FA 2AN6A 2BAYA 4BHWA 2OXQC 3NG2A 1E4UA 2L5UA 3L1ZB 3O35A 1XWHA 4YADA 2L0BA 4A4CA 2L80A 2EGPA 1T1HA 5B78A 4QF3A 4AYCB 3O33A 2LGKA 4W4UA 2KFTA 2JMIA 2YUCA 4YAXA 2LV9A 1WE9A 1WEEA 2ZETC 4B86C 4C9ZA 2MUMA 1X4IA 1JM7A 4GNDA 3KQIA 2MNYA 2C2VS 1LDKC 2YW8A 1WEQA 2G6QA 3ZVZB 5G05B 2IDAA 4YBSA 4YABA 4FO9A 2CSYA 5EYAF 3U5NA 2VNFA 2LGLA 4WZ3B 4UP0A 3HCTA 5FERA 3DPLR 4P5OB 2G45A 2MD7B 3LQHA 2F42A 1FBVA 5D1MB 4I7BA 1G25A 2ECNA 3ZVYA 2VPDA 4MVTA 5AITA 4I7DA 4R7EA 4LADB 4TKPB 2D8SA 1IYMA 5DINA 2KWJA 2EA6A 2RI7A 3KV6A 2K4DA 4NN2A 2Y1NA 1JOCA 4UP5A 2LRIC 2YU4A 4FJCA 2DX8A 3GL6A 1MM2A 1MM3A 3L1XA 4O64A 2VJFB 3HCUA 2KE1A 1X4UA 2CSZA 2VPGA 4V3LC 5D1LB 1HYIA 5KH9A 1U6GB 4AUQB 2L43A 4LKAA 1WFKA 2VJEB 2FSAA 2YREA 3HTKC 3V43A 4LJNA 1FP0A 1CHCA 4X3GA 2YQLA 5D1KB 4LLBA 4ZUXU 5TBNA 2YHNA 2YQMA 2L75A 2ECVA 2KGIA 2H0DA 4CCGX 2YSJA 5G0FA 4BBQA 4PTBA 3M62A 5B8DA 4L58A 3O36A 5LKZA 1HYJA 3EB6A 2PUYA 4A49A 3LQIA 2K17A 3KV5A 4YC9A 5LKXA 3L11A 3U5OA 2LXHC 3RPGC 4WA6A 5B79A 2KREA 3ZYQA 2PNXA 2Y1MA 2LGVA 4AVXA 2YURA 5G04B 3N9NA 1WEVA 3I2DA 2VP7A 4FIPA 4Q6FA 2KWOA 5LCWB 1WILA 4UI9B 2QICA 3ZTGA 2FUUA 4PPEA 3O37A 1JM7B 3MHSA 4A4BA 1Z2QA 3PHDA 3MHHA 2KU3A 3PUQA 1WIMA 2M1RA 4YATA 1ZBDB 5H9MA 1DVPA 5DKAA 2F6JA 3SOWA 1WESA 1LDJB 3HCSA 2ECIA 3QZVA 3T6RA 2JRJA 2KYUA 5AIUA 1K2FA 3LQJA 3SOXA 5TDWA 5FEYA 3M63A 2G43A 3SOUA 1WEWA 4YBMA 4WZ2A 2FUIA 5B76A 4XI1A 5JG6A 2F6NA 2KGGA 4WZ0A 2LGGA 5KH7A 3U5PA 2KR4A 2UZGA 2MA5A 2JMJA 2KWNA 3VK6A 4R8PK 3SHBA 1F62A 2YHOA 2MT5A 2LQ6A 2ECTA 4N3WA 2MIQA 4ZQLA 2MA6A 3O34A 1WEUA 4IC3A 4V3KC 3RTRB 5J3XA 2M85A 3N9OA 4GNFA 2HDPA 3N9MA 2YSMA 4AP4A 2RSDA 4R2YA 2LXPC 4S3OC 2YYRA 1X4JA 5B77A 2HYED 2ECWA 4FK5A 3N9PA 2K1JA 3RPGB 3ZPV1 1V87A 3O7AA 3PURA 1WGMA 5FB0A 4GNEA 5H1UA 4MSXA 5KH3A 2JMDA 2LN0A 3C6WA 5H1TA 2Y43A 2C2LA 4B7YC 2QJ0A 4F52B 3ZNIA 5LKTA 3O70A 2CT2A 4GNGA 3DQVR 2E6SA 1N87A 4LK9A 5C11A 4A0CD 5I3LA 5FB1A 3LRQA 2K16A 1VYXA 2E6RA 2H0DB 5B75A 2QIZA 5TDRA 2MNZA 5H1VA 2LDRA 3ASLA 3GV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBT A;  1WEN A;  1Z6U A;  3U5M A;  5TAB A;  3ZPV E;  1VFY A;  4GB0 A;  1WEM A;  2MD8 C;  2KIZ A;  4I7C A;  4IC2 A;  1WEO A;  2CKL A;  3C5K A;  1VD4 A;  2VJF A;  2NAA A;  2ECJ A;  3T7L A;  3M99 A;  2VJE A;  3N9L A;  2XEU A;  5LKU A;  3N9Q A;  2VPB A;  1RMD A;  2M6M A;  2VPE A;  1Z60 A;  2ECG A;  4AYC A;  2YT5 A;  4ZDT A;  4S3O B;  2EOD A;  3KNV A;  3EB5 A;  2CKL B;  5C13 A;  1BOR A;  2M3H A;  1WEP A;  2I50 A;  4CA1 A;  3FL2 A;  3IHP A;  5TRB A;  4QF2 A;  2KWK A;  2XB1 A;  4L7X A;  4N4F A;  2AN6 A;  2BAY A;  4BHW A;  2OXQ C;  3NG2 A;  1E4U A;  2L5U A;  3L1Z B;  3O35 A;  1XWH A;  4YAD A;  2L0B A;  4A4C A;  2L80 A;  2EGP A;  1T1H A;  5B78 A;  4QF3 A;  4AYC B;  3O33 A;  2LGK A;  4W4U A;  2KFT A;  2JMI A;  2YUC A;  4YAX A;  2LV9 A;  1WE9 A;  1WEE A;  2ZET C;  4B86 C;  4C9Z A;  2MUM A;  1X4I A;  1JM7 A;  4GND A;  3KQI A;  2MNY A;  2C2V S;  1LDK C;  2YW8 A;  1WEQ A;  2G6Q A;  3ZVZ B;  5G05 B;  2IDA A;  4YBS A;  4YAB A;  4FO9 A;  2CSY A;  5EYA F;  3U5N A;  2VNF A;  2LGL A;  4WZ3 B;  4UP0 A;  3HCT A;  5FER A;  3DPL R;  4P5O B;  2G45 A;  2MD7 B;  3LQH A;  2F42 A;  1FBV A;  5D1M B;  4I7B A;  1G25 A;  2ECN A;  3ZVY A;  2VPD A;  4MVT A;  5AIT A;  4I7D A;  4R7E A;  4LAD B;  4TKP B;  2D8S A;  1IYM A;  5DIN A;  2KWJ A;  2EA6 A;  2RI7 A;  3KV6 A;  2K4D A;  4NN2 A;  2Y1N A;  1JOC A;  4UP5 A;  2LRI C;  2YU4 A;  4FJC A;  2DX8 A;  3GL6 A;  1MM2 A;  1MM3 A;  3L1X A;  4O64 A;  2VJF B;  3HCU A;  2KE1 A;  1X4U A;  2CSZ A;  2VPG A;  4V3L C;  5D1L B;  1HYI A;  5KH9 A;  1U6G B;  4AUQ B;  2L43 A;  4LKA A;  1WFK A;  2VJE B;  2FSA A;  2YRE A;  3HTK C;  3V43 A;  4LJN A;  1FP0 A;  1CHC A;  4X3G A;  2YQL A;  5D1K B;  4LLB A;  4ZUX U;  5TBN A;  2YHN A;  2YQM A;  2L75 A;  2ECV A;  2KGI A;  2H0D A;  4CCG X;  2YSJ A;  5G0F A;  4BBQ A;  4PTB A;  3M62 A;  5B8D A;  4L58 A;  3O36 A;  5LKZ A;  1HYJ A;  3EB6 A;  2PUY A;  4A49 A;  3LQI A;  2K17 A;  3KV5 A;  4YC9 A;  5LKX A;  3L11 A;  3U5O A;  2LXH C;  3RPG C;  4WA6 A;  5B79 A;  2KRE A;  3ZYQ A;  2PNX A;  2Y1M A;  2LGV A;  4AVX A;  2YUR A;  5G04 B;  3N9N A;  1WEV A;  3I2D A;  2VP7 A;  4FIP A;  4Q6F A;  2KWO A;  5LCW B;  1WIL A;  4UI9 B;  2QIC A;  3ZTG A;  2FUU A;  4PPE A;  3O37 A;  1JM7 B;  3MHS A;  4A4B A;  1Z2Q A;  3PHD A;  3MHH A;  2KU3 A;  3PUQ A;  1WIM A;  2M1R A;  4YAT A;  1ZBD B;  5H9M A;  1DVP A;  5DKA A;  2F6J A;  3SOW A;  1WES A;  1LDJ B;  3HCS A;  2ECI A;  3QZV A;  3T6R A;  2JRJ A;  2KYU A;  5AIU A;  1K2F A;  3LQJ A;  3SOX A;  5TDW A;  5FEY A;  3M63 A;  2G43 A;  3SOU A;  1WEW A;  4YBM A;  4WZ2 A;  2FUI A;  5B76 A;  4XI1 A;  5JG6 A;  2F6N A;  2KGG A;  4WZ0 A;  2LGG A;  5KH7 A;  3U5P A;  2KR4 A;  2UZG A;  2MA5 A;  2JMJ A;  2KWN A;  3VK6 A;  4R8P K;  3SHB A;  1F62 A;  2YHO A;  2MT5 A;  2LQ6 A;  2ECT A;  4N3W A;  2MIQ A;  4ZQL A;  2MA6 A;  3O34 A;  1WEU A;  4IC3 A;  4V3K C;  3RTR B;  5J3X A;  2M85 A;  3N9O A;  4GNF A;  2HDP A;  3N9M A;  2YSM A;  4AP4 A;  2RSD A;  4R2Y A;  2LXP C;  4S3O C;  2YYR A;  1X4J A;  5B77 A;  2HYE D;  2ECW A;  4FK5 A;  3N9P A;  2K1J A;  3RPG B;  3ZPV 1;  1V87 A;  3O7A A;  3PUR A;  1WGM A;  5FB0 A;  4GNE A;  5H1U A;  4MSX A;  5KH3 A;  2JMD A;  2LN0 A;  3C6W A;  5H1T A;  2Y43 A;  2C2L A;  4B7Y C;  2QJ0 A;  4F52 B;  3ZNI A;  5LKT A;  3O70 A;  2CT2 A;  4GNG A;  3DQV R;  2E6S A;  1N87 A;  4LK9 A;  5C11 A;  4A0C D;  5I3L A;  5FB1 A;  3LRQ A;  2K16 A;  1VYX A;  2E6R A;  2H0D B;  5B75 A;  2QIZ A;  5TDR A;  2MNZ A;  5H1V A;  2LDR A;  3ASL A;  3GV4 A; 
#chains in the Genus database with same CATH topology
 4YBT A;  1WEN A;  1Z6U A;  3U5M A;  5TAB A;  3ZPV E;  1VFY A;  4GB0 A;  1WEM A;  2MD8 C;  2XOZ A;  2KIZ A;  4I7C A;  4IC2 A;  1WEO A;  2CKL A;  3C5K A;  1VD4 A;  2VJF A;  2NAA A;  2ECJ A;  4Z0R A;  3T7L A;  3M99 A;  3H7H A;  3O47 A;  2VJE A;  3N9L A;  2XEU A;  5LKU A;  3N9Q A;  5SVI A;  5SVY A;  2VPB A;  1RMD A;  2M6M A;  3T9K A;  2VPE A;  1Z60 A;  2ECG A;  4AYC A;  2YT5 A;  2XP0 A;  4ZDT A;  4S3O B;  2EOD A;  3KNV A;  3EB5 A;  2CKL B;  5C13 A;  1BOR A;  2M3H A;  1WEP A;  2I50 A;  4CA1 A;  3FL2 A;  3IHP A;  5TRB A;  4QF2 A;  2KWK A;  2E61 A;  2XB1 A;  4L7X A;  3DWD A;  4N4F A;  2AN6 A;  3LVR E;  2BAY A;  4BHW A;  2OXQ C;  3NG2 A;  4O62 A;  1E4U A;  2L5U A;  3L1Z B;  3O35 A;  1XWH A;  4YAD A;  2L0B A;  4A4C A;  3LJU X;  2L80 A;  2EGP A;  1T1H A;  5B78 A;  4QF3 A;  4AYC B;  4OGC A;  3O33 A;  3DDT A;  2LGK A;  4W4U A;  2KFT A;  2JMI A;  2YUC A;  4YAX A;  2B0O E;  2LV9 A;  1WE9 A;  1WEE A;  2ZET C;  4B86 C;  4C9Z A;  4H9D A;  2CRW A;  2MUM A;  1X4I A;  1JM7 A;  4GND A;  3KQI A;  2MNY A;  2C2V S;  1LDK C;  2YW8 A;  1WEQ A;  2G6Q A;  3ZVZ B;  5G05 B;  2IDA A;  4YBS A;  4YAB A;  4FO9 A;  2CSY A;  5EYA F;  3U5N A;  2VNF A;  2XOC A;  2LGL A;  4WZ3 B;  4UP0 A;  3HCT A;  5FER A;  3DPL R;  4P5O B;  2G45 A;  2MD7 B;  3LQH A;  2EXU A;  2F42 A;  2M13 A;  1FBV A;  5D1M B;  4I7B A;  1G25 A;  2ECN A;  3ZVY A;  2VPD A;  2KKY A;  3SUB A;  4MVT A;  5AIT A;  4I7D A;  4R7E A;  4LAD B;  4TKP B;  2D8S A;  1IYM A;  5DIN A;  2P57 A;  2L7P A;  3FJU B;  2KWJ A;  2EA6 A;  2JM3 A;  2RI7 A;  3KV6 A;  2K4D A;  4NN2 A;  2Y1N A;  3FEH A;  1JOC A;  4UP5 A;  2LRI C;  2YU4 A;  4FJC A;  2RR4 A;  2DX8 A;  3GL6 A;  3E2D A;  1MM2 A;  1MM3 A;  3L1X A;  4O64 A;  2VJF B;  3HCU A;  2KE1 A;  1X4U A;  2CSZ A;  2VPG A;  4V3L C;  5D1L B;  1HYI A;  5KH9 A;  1U6G B;  4AUQ B;  2L43 A;  4LKA A;  1DCQ A;  1WFK A;  2VJE B;  2FSA A;  2YRE A;  3HTK C;  3V43 A;  4LJN A;  1FP0 A;  3FAO A;  4OGE A;  1CHC A;  5SVI B;  3JUE A;  4X3G A;  2YQL A;  5D1K B;  4LLB A;  4ZUX U;  5TBN A;  2YHN A;  2YQM A;  2DJA A;  3M7K A;  2DSM A;  3FM8 C;  2MKE A;  2L75 A;  2ECV A;  3LDY A;  1MBM A;  2KGI A;  2H0D A;  4CCG X;  2YSJ A;  2JUN A;  5G0F A;  4BBQ A;  4Z0O A;  2CSV A;  4PTB A;  3M62 A;  5B8D A;  4L58 A;  3O36 A;  3KDE C;  5LKZ A;  1HYJ A;  3EB6 A;  2PUY A;  4A49 A;  3LQI A;  2K17 A;  3KV5 A;  4YC9 A;  5LKX A;  3L11 A;  3U5O A;  2LXH C;  3RPG C;  2LAU A;  4WA6 A;  5B79 A;  2KRE A;  3ZYQ A;  2PNX A;  2Y1M A;  2LGV A;  4AVX A;  5K3Q A;  2YUR A;  5G04 B;  3N9N A;  1WEV A;  3I2D A;  2VP7 A;  4FIP A;  4Q6F A;  2KWO A;  2KKX A;  5LCW B;  1WIL A;  4UI9 B;  2QIC A;  3ZTG A;  2FUU A;  4PPE A;  3O37 A;  1JM7 B;  3MHS A;  4A4B A;  1Z2Q A;  3PHD A;  3MHH A;  2KU3 A;  3PUQ A;  3MDB C;  3FAN A;  1WIM A;  3LVQ E;  2M1R A;  4YAT A;  1ZBD B;  5H9M A;  1DVP A;  5DKA A;  2F6J A;  3SOW A;  2OWA A;  1WES A;  1LDJ B;  3HCS A;  2ECI A;  2FD4 A;  3QZV A;  3T6R A;  2JRJ A;  2KYU A;  5SVX A;  5AIU A;  1K2F A;  3LQJ A;  3SOX A;  5TDW A;  2YVR A;  5FEY A;  3M63 A;  2G43 A;  3SOU A;  1WEW A;  4YBM A;  4WZ2 A;  2FUI A;  5B76 A;  4XI1 A;  5JG6 A;  2F6N A;  2KGG A;  4WZ0 A;  2LGG A;  5KH7 A;  3U5P A;  2KR4 A;  2UZG A;  2MA5 A;  2JMJ A;  2KWN A;  3VK6 A;  4QQ4 A;  3SHB A;  4R8P K;  1F62 A;  2YHO A;  2MT5 A;  2LQ6 A;  2ECT A;  4N3W A;  2MIQ A;  4ZQL A;  2MA6 A;  3O34 A;  1WEU A;  2FFW A;  4IC3 A;  4V3K C;  3RTR B;  5J3X A;  2IQJ A;  2M85 A;  3N9O A;  4GNF A;  2HDP A;  3N9M A;  2YSM A;  4AP4 A;  2RSD A;  4R2Y A;  2LXP C;  4S3O C;  2YYR A;  1X4J A;  5B77 A;  2CRR A;  2D8U A;  2HYE D;  2ECW A;  4FK5 A;  3N9P A;  2K1J A;  3RPG B;  3ZPV 1;  1V87 A;  3O7A A;  3PUR A;  1WGM A;  5FB0 A;  3PLW A;  4GNE A;  5H1U A;  4MSX A;  5KH3 A;  2JMD A;  2LN0 A;  3C6W A;  5H1T A;  2Y43 A;  2C2L A;  4B7Y C;  2QJ0 A;  4F52 B;  3ZNI A;  5LKT A;  3O70 A;  2CT2 A;  4GNG A;  3DQV R;  2EGM A;  2E6S A;  1N87 A;  4F1P A;  4LK9 A;  5C11 A;  4A0C D;  5I3L A;  5FB1 A;  3LRQ A;  2XOY A;  2CON A;  2K16 A;  1VYX A;  2E6R A;  2H0D B;  5B75 A;  2QIZ A;  3Q1D A;  5TDR A;  2MNZ A;  5H1V A;  2LDR A;  3ASL A;  3GV4 A; 
#chains in the Genus database with same CATH homology
 4YBT A;  1WEN A;  1Z6U A;  3U5M A;  5TAB A;  3ZPV E;  1VFY A;  4GB0 A;  1WEM A;  2MD8 C;  2KIZ A;  4I7C A;  4IC2 A;  1WEO A;  2CKL A;  3C5K A;  1VD4 A;  2VJF A;  2NAA A;  2ECJ A;  3T7L A;  3M99 A;  2VJE A;  3N9L A;  2XEU A;  5LKU A;  3N9Q A;  2VPB A;  1RMD A;  2M6M A;  2VPE A;  1Z60 A;  2ECG A;  4AYC A;  2YT5 A;  4ZDT A;  4S3O B;  2EOD A;  3KNV A;  3EB5 A;  2CKL B;  5C13 A;  1BOR A;  2M3H A;  1WEP A;  2I50 A;  4CA1 A;  3FL2 A;  3IHP A;  5TRB A;  4QF2 A;  2KWK A;  2XB1 A;  4L7X A;  4N4F A;  2AN6 A;  2BAY A;  4BHW A;  2OXQ C;  3NG2 A;  1E4U A;  2L5U A;  3L1Z B;  3O35 A;  1XWH A;  4YAD A;  2L0B A;  4A4C A;  2L80 A;  2EGP A;  1T1H A;  5B78 A;  4QF3 A;  4AYC B;  3O33 A;  2LGK A;  4W4U A;  2KFT A;  2JMI A;  2YUC A;  4YAX A;  2LV9 A;  1WE9 A;  1WEE A;  2ZET C;  4B86 C;  4C9Z A;  2MUM A;  1X4I A;  1JM7 A;  4GND A;  3KQI A;  2MNY A;  2C2V S;  1LDK C;  2YW8 A;  1WEQ A;  2G6Q A;  3ZVZ B;  5G05 B;  2IDA A;  4YBS A;  4YAB A;  4FO9 A;  2CSY A;  5EYA F;  3U5N A;  2VNF A;  2LGL A;  4WZ3 B;  4UP0 A;  3HCT A;  5FER A;  3DPL R;  4P5O B;  2G45 A;  2MD7 B;  3LQH A;  2F42 A;  1FBV A;  5D1M B;  4I7B A;  1G25 A;  2ECN A;  3ZVY A;  2VPD A;  4MVT A;  5AIT A;  4I7D A;  4R7E A;  4LAD B;  4TKP B;  2D8S A;  1IYM A;  5DIN A;  2KWJ A;  2EA6 A;  2RI7 A;  3KV6 A;  2K4D A;  4NN2 A;  2Y1N A;  1JOC A;  4UP5 A;  2LRI C;  2YU4 A;  4FJC A;  2DX8 A;  3GL6 A;  1MM2 A;  1MM3 A;  3L1X A;  4O64 A;  2VJF B;  3HCU A;  2KE1 A;  1X4U A;  2CSZ A;  2VPG A;  4V3L C;  5D1L B;  1HYI A;  5KH9 A;  1U6G B;  4AUQ B;  2L43 A;  4LKA A;  1WFK A;  2VJE B;  2FSA A;  2YRE A;  3HTK C;  3V43 A;  4LJN A;  1FP0 A;  1CHC A;  4X3G A;  2YQL A;  5D1K B;  4LLB A;  4ZUX U;  5TBN A;  2YHN A;  2YQM A;  2L75 A;  2ECV A;  2KGI A;  2H0D A;  4CCG X;  2YSJ A;  5G0F A;  4BBQ A;  4PTB A;  3M62 A;  5B8D A;  4L58 A;  3O36 A;  5LKZ A;  1HYJ A;  3EB6 A;  2PUY A;  4A49 A;  3LQI A;  2K17 A;  3KV5 A;  4YC9 A;  5LKX A;  3L11 A;  3U5O A;  2LXH C;  3RPG C;  4WA6 A;  5B79 A;  2KRE A;  3ZYQ A;  2PNX A;  2Y1M A;  2LGV A;  4AVX A;  2YUR A;  5G04 B;  3N9N A;  1WEV A;  3I2D A;  2VP7 A;  4FIP A;  4Q6F A;  2KWO A;  5LCW B;  1WIL A;  4UI9 B;  2QIC A;  3ZTG A;  2FUU A;  4PPE A;  3O37 A;  1JM7 B;  3MHS A;  4A4B A;  1Z2Q A;  3PHD A;  3MHH A;  2KU3 A;  3PUQ A;  1WIM A;  2M1R A;  4YAT A;  1ZBD B;  5H9M A;  1DVP A;  5DKA A;  2F6J A;  3SOW A;  1WES A;  1LDJ B;  3HCS A;  2ECI A;  3QZV A;  3T6R A;  2JRJ A;  2KYU A;  5AIU A;  1K2F A;  3LQJ A;  3SOX A;  5TDW A;  5FEY A;  3M63 A;  2G43 A;  3SOU A;  1WEW A;  4YBM A;  4WZ2 A;  2FUI A;  5B76 A;  4XI1 A;  5JG6 A;  2F6N A;  2KGG A;  4WZ0 A;  2LGG A;  5KH7 A;  3U5P A;  2KR4 A;  2UZG A;  2MA5 A;  2JMJ A;  2KWN A;  3VK6 A;  4R8P K;  3SHB A;  1F62 A;  2YHO A;  2MT5 A;  2LQ6 A;  2ECT A;  4N3W A;  2MIQ A;  4ZQL A;  2MA6 A;  3O34 A;  1WEU A;  4IC3 A;  4V3K C;  3RTR B;  5J3X A;  2M85 A;  3N9O A;  4GNF A;  2HDP A;  3N9M A;  2YSM A;  4AP4 A;  2RSD A;  4R2Y A;  2LXP C;  4S3O C;  2YYR A;  1X4J A;  5B77 A;  2HYE D;  2ECW A;  4FK5 A;  3N9P A;  2K1J A;  3RPG B;  3ZPV 1;  1V87 A;  3O7A A;  3PUR A;  1WGM A;  5FB0 A;  4GNE A;  5H1U A;  4MSX A;  5KH3 A;  2JMD A;  2LN0 A;  3C6W A;  5H1T A;  2Y43 A;  2C2L A;  4B7Y C;  2QJ0 A;  4F52 B;  3ZNI A;  5LKT A;  3O70 A;  2CT2 A;  4GNG A;  3DQV R;  2E6S A;  1N87 A;  4LK9 A;  5C11 A;  4A0C D;  5I3L A;  5FB1 A;  3LRQ A;  2K16 A;  1VYX A;  2E6R A;  2H0D B;  5B75 A;  2QIZ A;  5TDR A;  2MNZ A;  5H1V A;  2LDR A;  3ASL A;  3GV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...