1X4UA

Solution structure of the fyve domain from human fyve domain containing 27 isoform b protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
84
structure length
84
Chain Sequence
GSSGSSGRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the FYVE domain from human FYVE domain containing 27 isoform b protein
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Zinc finger, FYVE domain containing 27 isoform b
total genus 5
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4uA01
3SOXA 3VK6A 2MD8C 3IHPA 3HCSA 4X3GA 4N4FA 2ECNA 3LQHA 3GL6A 4R7EA 2QJ0A 2VJFB 2VPGA 2KGIA 2VJEA 4YBTA 3T6RA 3DQVR 3EB5A 2RSDA 4FIPA 2MA6A 2YQLA 2JMDA 2YHOA 1VD4A 4Q6FA 3PUQA 5KH7A 3KV6A 3MHSA 3EB6A 5LKTA 2KIZA 1WEUA 2RI7A 5LKXA 4S3OB 2DX8A 5DKAA 2VNFA 3L11A 2KE1A 2LXPC 3O36A 4YADA 3N9NA 1ZBDB 2JRJA 2F6JA 2YW8A 5B8DA 2VP7A 4CA1A 1VYXA 2YQMA 1CHCA 2E6RA 5B76A 2YUCA 3ZTGA 2NAAA 3HCTA 5D1KB 2YT5A 5D1MB 2CSZA 2K16A 3HTKC 4CCGX 4LJNA 1FBVA 2K17A 3SOWA 3LQIA 4MSXA 2ECJA 3I2DA 4AYCB 4P5OB 3O37A 2G45A 4BHWA 4UI9B 4B7YC 2ECVA 1WFKA 3ASLA 2M6MA 2UZGA 4YBSA 4MVTA 3DPLR 4GNEA 2PNXA 3V43A 2C2LA 3GV4A 3U5NA 2K4DA 1IYMA 2MNYA 1F62A 2L43A 1WEVA 2QICA 5DINA 3N9PA 2Y43A 4NN2A 3ZVYA 4GNFA 2YHNA 1Z6UA 5B75A 4GNDA 1WGMA 2KWKA 2OXQC 3O34A 2ZETC 5FERA 2YSMA 2M3HA 1HYIA 3U5MA 4I7DA 2VJFA 2VJEB 2KFTA 2HDPA 2ECIA 1WE9A 4AYCA 3T7LA 3RPGB 3SOUA 4UP0A 4A0CD 4LK9A 3L1XA 2ECWA 5J3XA 2KU3A 2Y1NA 1X4IA 5FEYA 3RTRB 2KREA 4IC3A 2MA5A 1K2FA 5KH3A 4R2YA 2VPEA 2PUYA 1WIMA 4PTBA 2MD7B 4W4UA 2LXHC 4V3KC 1T1HA 3LRQA 2H0DA 5TDRA 3ZVZB 4AP4A 3N9MA 4WZ2A 2D8SA 4YABA 2MIQA 2F42A 2L75A 2I50A 1V87A 3PHDA 1WEQA 4I7BA 4A4CA 2LRIC 2FSAA 2BAYA 4YATA 3FL2A 3KQIA 5FB1A 4R8PK 2ECGA 1BORA 5G04B 2YYRA 1E4UA 1XWHA 5I3LA 1FP0A 4QF3A 5FB0A 2HYED 5AIUA 3C5KA 2CKLB 5JG6A 2LV9A 3M62A 2G6QA 2CSYA 4C9ZA 4ZQLA 2L80A 1Z2QA 4L58A 2LGVA 2MUMA 2VPBA 5C11A 4B86C 4GB0A 4QF2A 1VFYA 2LQ6A 3MHHA 5H1VA 2FUUA 1U6GB 3KNVA 2YREA 4FK5A 2CT2A 5TBNA 5B78A 2EGPA 3N9OA 4GNGA 2EA6A 1WENA 4FJCA 4O64A 3N9QA 4XI1A 3KV5A 4AVXA 5G0FA 2KWJA 4YBMA 5G05B 5LCWB 2KGGA 4TKPB 2KYUA 1JM7A 1JM7B 2VPDA 2C2VS 5D1LB 2M1RA 5KH9A 5H1TA 2YURA 3NG2A 2KWNA 1DVPA 3O33A 3ZPV1 4AUQB 1G25A 5LKZA 1WESA 5C13A 2L0BA 3LQJA 2KWOA 3SHBA 3ZNIA 4LKAA 1WEMA 2FUIA 3PURA 2LGLA 4UP5A 1X4UA 2XEUA 5TDWA 1MM2A 3M99A 2H0DB 2JMIA 3O70A 4YAXA 4IC2A 2LDRA 4V3LC 2EODA 2JMJA 4FO9A 5B77A 2YU4A 2M85A 1WILA 1N87A 3N9LA 3O7AA 2AN6A 2MT5A 4L7XA 3ZPVE 3M63A 4S3OC 2XB1A 2IDAA 2F6NA 2YSJA 2KR4A 2MNZA 4BBQA 3RPGC 4YC9A 5LKUA 1HYJA 4I7CA 3QZVA 1WEPA 4WZ0A 1JOCA 3U5PA 2E6SA 5EYAF 1WEWA 3HCUA 2LGKA 2CKLA 1WEEA 2Y1MA 4ZUXU 1WEOA 2L5UA 4A49A 3U5OA 3ZYQA 4WZ3B 2LN0A 5TRBA 1LDJB 2ECTA 2G43A 4PPEA 1RMDA 5H9MA 4LADB 2QIZA 3L1ZB 3C6WA 4ZDTA 4LLBA 1LDKC 4N3WA 4F52B 1Z60A 5H1UA 2K1JA 1MM3A 4WA6A 4A4BA 3O35A 5AITA 2LGGA 5TABA 1X4JA 5B79A
chains in the Genus database with same CATH superfamily
3SOXA 3VK6A 2MD8C 3IHPA 3HCSA 4X3GA 4N4FA 3FANA 2ECNA 3LQHA 3GL6A 4R7EA 2QJ0A 2VJFB 2VPGA 2E61A 3PLWA 2KGIA 2KKYA 2VJEA 4YBTA 3T6RA 3DQVR 3EB5A 2RSDA 2B0OE 4FIPA 2MA6A 2YQLA 2JMDA 2YHOA 1VD4A 4Q6FA 3PUQA 5KH7A 3KV6A 3MHSA 3EB6A 5LKTA 5SVXA 2KIZA 2D8UA 1WEUA 3Q1DA 2RI7A 5LKXA 4S3OB 2DX8A 2CRRA 5DKAA 2VNFA 3L11A 2KE1A 2LXPC 3O36A 4YADA 3N9NA 1ZBDB 2JRJA 3FJUB 2F6JA 2YW8A 5B8DA 2VP7A 4CA1A 1VYXA 2YQMA 1CHCA 2E6RA 5B76A 2YUCA 3ZTGA 2NAAA 3HCTA 5D1MB 5D1KB 2YT5A 2CSZA 2K16A 2DSMA 3HTKC 2JUNA 4CCGX 3KDEC 4LJNA 1FBVA 2K17A 3FM8C 3SOWA 3LQIA 4MSXA 2ECJA 3I2DA 3MDBC 4AYCB 4P5OB 2MKEA 3O37A 2G45A 4BHWA 4UI9B 4B7YC 2ECVA 1WFKA 3ASLA 4Z0OA 2M6MA 2UZGA 2IQJA 4YBSA 4MVTA 3DPLR 2XOYA 2FFWA 4GNEA 2PNXA 3V43A 2C2LA 3GV4A 3O47A 3U5NA 2K4DA 5B79A 1IYMA 2MNYA 5K3QA 2CONA 1F62A 2L43A 1WEVA 2QICA 4QQ4A 5DINA 3N9PA 3T9KA 2Y43A 4NN2A 3ZVYA 4GNFA 2YHNA 2L7PA 1Z6UA 4H9DA 5B75A 4GNDA 1WGMA 2KWKA 2OXQC 3O34A 2ZETC 5FERA 2YSMA 2M3HA 1HYIA 3U5MA 4I7DA 2VJFA 2VJEB 2KFTA 2HDPA 2ECIA 1WE9A 4AYCA 3T7LA 3RPGB 3SOUA 4UP0A 4A0CD 4LK9A 3L1XA 2ECWA 2KU3A 2Y1NA 1X4IA 5J3XA 5FEYA 3RTRB 2KREA 4IC3A 2MA5A 1K2FA 5KH3A 4Z0RA 4R2YA 2VPEA 2PUYA 1WIMA 4PTBA 2MD7B 4W4UA 2LXHC 4V3KC 1T1HA 3LRQA 5SVYA 2H0DA 5TDRA 3ZVZB 4AP4A 3N9MA 4WZ2A 2D8SA 4YABA 2MIQA 2F42A 2OWAA 2L75A 2I50A 1V87A 3PHDA 1WEQA 4I7BA 4A4CA 1MBMA 2LRIC 2FSAA 2BAYA 4YATA 3FL2A 3KQIA 5FB1A 4R8PK 2ECGA 1BORA 5G04B 2YYRA 1E4UA 1XWHA 3M7KA 5I3LA 1FP0A 4QF3A 5FB0A 2HYED 5AIUA 3C5KA 2CKLB 2CSVA 5JG6A 2LV9A 3M62A 2G6QA 2CSYA 4C9ZA 4O62A 4ZQLA 2L80A 1Z2QA 4L58A 2LGVA 2MUMA 2VPBA 5C11A 4B86C 4GB0A 2RR4A 4QF2A 3E2DA 2EXUA 1VFYA 2LQ6A 3MHHA 3H7HA 5H1VA 2FUUA 1U6GB 3KNVA 2YREA 4FK5A 2CT2A 5TBNA 5B78A 2EGPA 3N9OA 4GNGA 2EA6A 1WENA 4FJCA 4O64A 3LVRE 3N9QA 5SVIB 4XI1A 2FD4A 3KV5A 4AVXA 5G0FA 2KWJA 4YBMA 2JM3A 5G05B 5LCWB 2KGGA 4TKPB 2KYUA 3DDTA 1JM7A 1JM7B 2VPDA 3SUBA 2C2VS 5D1LB 2M1RA 5KH9A 5H1TA 2YURA 1DCQA 3NG2A 2KWNA 1DVPA 3O33A 3ZPV1 1G25A 5LKZA 1WESA 5C13A 2L0BA 2KKXA 2KWOA 3LQJA 3SHBA 3ZNIA 4LKAA 1WEMA 2FUIA 3PURA 2XOZA 2LGLA 4UP5A 1X4UA 4OGCA 2XEUA 5TDWA 1MM2A 2YVRA 3M99A 3LVQE 2H0DB 2JMIA 3O70A 4YAXA 4IC2A 2LDRA 4V3LC 2EODA 2JMJA 4FO9A 5B77A 2YU4A 2M85A 1WILA 1N87A 3N9LA 3O7AA 2AN6A 2MT5A 4L7XA 3ZPVE 3M63A 4S3OC 2XB1A 2IDAA 2F6NA 2YSJA 2KR4A 2MNZA 5SVIA 3RPGC 4BBQA 4YC9A 5LKUA 1HYJA 4I7CA 3QZVA 1WEPA 4WZ0A 1JOCA 3U5PA 2E6SA 3JUEA 5EYAF 1WEWA 4OGEA 3HCUA 3FAOA 2LGKA 2CKLA 1WEEA 2Y1MA 4ZUXU 3LJUX 1WEOA 2L5UA 4A49A 3U5OA 2P57A 3ZYQA 4WZ3B 2LN0A 2M13A 5TRBA 4F1PA 1LDJB 3FEHA 2ECTA 2G43A 4PPEA 1RMDA 5H9MA 4LADB 2EGMA 3LDYA 2QIZA 3L1ZB 3C6WA 4ZDTA 4LLBA 1LDKC 4N3WA 1Z60A 4F52B 5H1UA 2K1JA 1MM3A 2LAUA 2DJAA 4WA6A 2CRWA 3DWDA 4A4BA 3O35A 5AITA 2LGGA 2XOCA 5TABA 2XP0A 1X4JA 4AUQB
chains in the Genus database with same CATH topology
3SOXA 3VK6A 2MD8C 3IHPA 3HCSA 4X3GA 4N4FA 2ECNA 3LQHA 3GL6A 4R7EA 2QJ0A 2VJFB 2VPGA 2KGIA 2VJEA 4YBTA 3T6RA 3DQVR 3EB5A 2RSDA 4FIPA 2MA6A 2YQLA 2JMDA 2YHOA 1VD4A 4Q6FA 3PUQA 5KH7A 3KV6A 3MHSA 3EB6A 5LKTA 2KIZA 1WEUA 2RI7A 5LKXA 4S3OB 2DX8A 5DKAA 2VNFA 3L11A 2KE1A 2LXPC 3O36A 4YADA 3N9NA 1ZBDB 2JRJA 2F6JA 2YW8A 5B8DA 2VP7A 4CA1A 1VYXA 2YQMA 1CHCA 2E6RA 5B76A 2YUCA 3ZTGA 2NAAA 3HCTA 5D1KB 2YT5A 5D1MB 2CSZA 2K16A 3HTKC 4CCGX 4LJNA 1FBVA 2K17A 3SOWA 3LQIA 4MSXA 2ECJA 3I2DA 4AYCB 4P5OB 3O37A 2G45A 4BHWA 4UI9B 4B7YC 2ECVA 1WFKA 3ASLA 2M6MA 2UZGA 4YBSA 4MVTA 3DPLR 4GNEA 2PNXA 3V43A 2C2LA 3GV4A 3U5NA 2K4DA 1IYMA 2MNYA 1F62A 2L43A 1WEVA 2QICA 5DINA 3N9PA 2Y43A 4NN2A 3ZVYA 4GNFA 2YHNA 1Z6UA 5B75A 4GNDA 1WGMA 2KWKA 2OXQC 3O34A 2ZETC 5FERA 2YSMA 2M3HA 1HYIA 3U5MA 4I7DA 2VJFA 2VJEB 2KFTA 2HDPA 2ECIA 1WE9A 4AYCA 3T7LA 3RPGB 3SOUA 4UP0A 4A0CD 4LK9A 3L1XA 2ECWA 5J3XA 2KU3A 2Y1NA 1X4IA 5FEYA 3RTRB 2KREA 4IC3A 2MA5A 1K2FA 5KH3A 4R2YA 2VPEA 2PUYA 1WIMA 4PTBA 2MD7B 4W4UA 2LXHC 4V3KC 1T1HA 3LRQA 2H0DA 5TDRA 3ZVZB 4AP4A 3N9MA 4WZ2A 2D8SA 4YABA 2MIQA 2F42A 2L75A 2I50A 1V87A 3PHDA 1WEQA 4I7BA 4A4CA 2LRIC 2FSAA 2BAYA 4YATA 3FL2A 3KQIA 5FB1A 4R8PK 2ECGA 1BORA 5G04B 2YYRA 1E4UA 1XWHA 5I3LA 1FP0A 4QF3A 5FB0A 2HYED 5AIUA 3C5KA 2CKLB 5JG6A 2LV9A 3M62A 2G6QA 2CSYA 4C9ZA 4ZQLA 2L80A 1Z2QA 4L58A 2LGVA 2MUMA 2VPBA 5C11A 4B86C 4GB0A 4QF2A 1VFYA 2LQ6A 3MHHA 5H1VA 2FUUA 1U6GB 3KNVA 2YREA 4FK5A 2CT2A 5TBNA 5B78A 2EGPA 3N9OA 4GNGA 2EA6A 1WENA 4FJCA 4O64A 3N9QA 4XI1A 3KV5A 4AVXA 5G0FA 2KWJA 4YBMA 5G05B 5LCWB 2KGGA 4TKPB 2KYUA 1JM7A 1JM7B 2VPDA 2C2VS 5D1LB 2M1RA 5KH9A 5H1TA 2YURA 3NG2A 2KWNA 1DVPA 3O33A 3ZPV1 4AUQB 1G25A 5LKZA 1WESA 5C13A 2L0BA 3LQJA 2KWOA 3SHBA 3ZNIA 4LKAA 1WEMA 2FUIA 3PURA 2LGLA 4UP5A 1X4UA 2XEUA 5TDWA 1MM2A 3M99A 2H0DB 2JMIA 3O70A 4YAXA 4IC2A 2LDRA 4V3LC 2EODA 2JMJA 4FO9A 5B77A 2YU4A 2M85A 1WILA 1N87A 3N9LA 3O7AA 2AN6A 2MT5A 4L7XA 3ZPVE 3M63A 4S3OC 2XB1A 2IDAA 2F6NA 2YSJA 2KR4A 2MNZA 4BBQA 3RPGC 4YC9A 5LKUA 1HYJA 4I7CA 3QZVA 1WEPA 4WZ0A 1JOCA 3U5PA 2E6SA 5EYAF 1WEWA 3HCUA 2LGKA 2CKLA 1WEEA 2Y1MA 4ZUXU 1WEOA 2L5UA 4A49A 3U5OA 3ZYQA 4WZ3B 2LN0A 5TRBA 1LDJB 2ECTA 2G43A 4PPEA 1RMDA 5H9MA 4LADB 2QIZA 3L1ZB 3C6WA 4ZDTA 4LLBA 1LDKC 4N3WA 4F52B 1Z60A 5H1UA 2K1JA 1MM3A 4WA6A 4A4BA 3O35A 5AITA 2LGGA 5TABA 1X4JA 5B79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOX A;  3VK6 A;  2MD8 C;  3IHP A;  3HCS A;  4X3G A;  4N4F A;  2ECN A;  3LQH A;  3GL6 A;  4R7E A;  2QJ0 A;  2VJF B;  2VPG A;  2KGI A;  2VJE A;  4YBT A;  3T6R A;  3DQV R;  3EB5 A;  2RSD A;  4FIP A;  2MA6 A;  2YQL A;  2JMD A;  2YHO A;  1VD4 A;  4Q6F A;  3PUQ A;  5KH7 A;  3KV6 A;  3MHS A;  3EB6 A;  5LKT A;  2KIZ A;  1WEU A;  2RI7 A;  5LKX A;  4S3O B;  2DX8 A;  5DKA A;  2VNF A;  3L11 A;  2KE1 A;  2LXP C;  3O36 A;  4YAD A;  3N9N A;  1ZBD B;  2JRJ A;  2F6J A;  2YW8 A;  5B8D A;  2VP7 A;  4CA1 A;  1VYX A;  2YQM A;  1CHC A;  2E6R A;  5B76 A;  2YUC A;  3ZTG A;  2NAA A;  3HCT A;  5D1K B;  2YT5 A;  5D1M B;  2CSZ A;  2K16 A;  3HTK C;  4CCG X;  4LJN A;  1FBV A;  2K17 A;  3SOW A;  3LQI A;  4MSX A;  2ECJ A;  3I2D A;  4AYC B;  4P5O B;  3O37 A;  2G45 A;  4BHW A;  4UI9 B;  4B7Y C;  2ECV A;  1WFK A;  3ASL A;  2M6M A;  2UZG A;  4YBS A;  4MVT A;  3DPL R;  4GNE A;  2PNX A;  3V43 A;  2C2L A;  3GV4 A;  3U5N A;  2K4D A;  1IYM A;  2MNY A;  1F62 A;  2L43 A;  1WEV A;  2QIC A;  5DIN A;  3N9P A;  2Y43 A;  4NN2 A;  3ZVY A;  4GNF A;  2YHN A;  1Z6U A;  5B75 A;  4GND A;  1WGM A;  2KWK A;  2OXQ C;  3O34 A;  2ZET C;  5FER A;  2YSM A;  2M3H A;  1HYI A;  3U5M A;  4I7D A;  2VJF A;  2VJE B;  2KFT A;  2HDP A;  2ECI A;  1WE9 A;  4AYC A;  3T7L A;  3RPG B;  3SOU A;  4UP0 A;  4A0C D;  4LK9 A;  3L1X A;  2ECW A;  5J3X A;  2KU3 A;  2Y1N A;  1X4I A;  5FEY A;  3RTR B;  2KRE A;  4IC3 A;  2MA5 A;  1K2F A;  5KH3 A;  4R2Y A;  2VPE A;  2PUY A;  1WIM A;  4PTB A;  2MD7 B;  4W4U A;  2LXH C;  4V3K C;  1T1H A;  3LRQ A;  2H0D A;  5TDR A;  3ZVZ B;  4AP4 A;  3N9M A;  4WZ2 A;  2D8S A;  4YAB A;  2MIQ A;  2F42 A;  2L75 A;  2I50 A;  1V87 A;  3PHD A;  1WEQ A;  4I7B A;  4A4C A;  2LRI C;  2FSA A;  2BAY A;  4YAT A;  3FL2 A;  3KQI A;  5FB1 A;  4R8P K;  2ECG A;  1BOR A;  5G04 B;  2YYR A;  1E4U A;  1XWH A;  5I3L A;  1FP0 A;  4QF3 A;  5FB0 A;  2HYE D;  5AIU A;  3C5K A;  2CKL B;  5JG6 A;  2LV9 A;  3M62 A;  2G6Q A;  2CSY A;  4C9Z A;  4ZQL A;  2L80 A;  1Z2Q A;  4L58 A;  2LGV A;  2MUM A;  2VPB A;  5C11 A;  4B86 C;  4GB0 A;  4QF2 A;  1VFY A;  2LQ6 A;  3MHH A;  5H1V A;  2FUU A;  1U6G B;  3KNV A;  2YRE A;  4FK5 A;  2CT2 A;  5TBN A;  5B78 A;  2EGP A;  3N9O A;  4GNG A;  2EA6 A;  1WEN A;  4FJC A;  4O64 A;  3N9Q A;  4XI1 A;  3KV5 A;  4AVX A;  5G0F A;  2KWJ A;  4YBM A;  5G05 B;  5LCW B;  2KGG A;  4TKP B;  2KYU A;  1JM7 A;  1JM7 B;  2VPD A;  2C2V S;  5D1L B;  2M1R A;  5KH9 A;  5H1T A;  2YUR A;  3NG2 A;  2KWN A;  1DVP A;  3O33 A;  3ZPV 1;  4AUQ B;  1G25 A;  5LKZ A;  1WES A;  5C13 A;  2L0B A;  3LQJ A;  2KWO A;  3SHB A;  3ZNI A;  4LKA A;  1WEM A;  2FUI A;  3PUR A;  2LGL A;  4UP5 A;  1X4U A;  2XEU A;  5TDW A;  1MM2 A;  3M99 A;  2H0D B;  2JMI A;  3O70 A;  4YAX A;  4IC2 A;  2LDR A;  4V3L C;  2EOD A;  2JMJ A;  4FO9 A;  5B77 A;  2YU4 A;  2M85 A;  1WIL A;  1N87 A;  3N9L A;  3O7A A;  2AN6 A;  2MT5 A;  4L7X A;  3ZPV E;  3M63 A;  4S3O C;  2XB1 A;  2IDA A;  2F6N A;  2YSJ A;  2KR4 A;  2MNZ A;  4BBQ A;  3RPG C;  4YC9 A;  5LKU A;  1HYJ A;  4I7C A;  3QZV A;  1WEP A;  4WZ0 A;  1JOC A;  3U5P A;  2E6S A;  5EYA F;  1WEW A;  3HCU A;  2LGK A;  2CKL A;  1WEE A;  2Y1M A;  4ZUX U;  1WEO A;  2L5U A;  4A49 A;  3U5O A;  3ZYQ A;  4WZ3 B;  2LN0 A;  5TRB A;  1LDJ B;  2ECT A;  2G43 A;  4PPE A;  1RMD A;  5H9M A;  4LAD B;  2QIZ A;  3L1Z B;  3C6W A;  4ZDT A;  4LLB A;  1LDK C;  4N3W A;  4F52 B;  1Z60 A;  5H1U A;  2K1J A;  1MM3 A;  4WA6 A;  4A4B A;  3O35 A;  5AIT A;  2LGG A;  5TAB A;  1X4J A;  5B79 A; 
#chains in the Genus database with same CATH topology
 3SOX A;  3VK6 A;  2MD8 C;  3IHP A;  3HCS A;  4X3G A;  4N4F A;  3FAN A;  2ECN A;  3LQH A;  3GL6 A;  4R7E A;  2QJ0 A;  2VJF B;  2VPG A;  2E61 A;  3PLW A;  2KGI A;  2KKY A;  2VJE A;  4YBT A;  3T6R A;  3DQV R;  3EB5 A;  2RSD A;  2B0O E;  4FIP A;  2MA6 A;  2YQL A;  2JMD A;  2YHO A;  1VD4 A;  4Q6F A;  3PUQ A;  5KH7 A;  3KV6 A;  3MHS A;  3EB6 A;  5LKT A;  5SVX A;  2KIZ A;  2D8U A;  1WEU A;  3Q1D A;  2RI7 A;  5LKX A;  4S3O B;  2DX8 A;  2CRR A;  5DKA A;  2VNF A;  3L11 A;  2KE1 A;  2LXP C;  3O36 A;  4YAD A;  3N9N A;  1ZBD B;  2JRJ A;  3FJU B;  2F6J A;  2YW8 A;  5B8D A;  2VP7 A;  4CA1 A;  1VYX A;  2YQM A;  1CHC A;  2E6R A;  5B76 A;  2YUC A;  3ZTG A;  2NAA A;  3HCT A;  5D1M B;  5D1K B;  2YT5 A;  2CSZ A;  2K16 A;  2DSM A;  3HTK C;  2JUN A;  4CCG X;  3KDE C;  4LJN A;  1FBV A;  2K17 A;  3FM8 C;  3SOW A;  3LQI A;  4MSX A;  2ECJ A;  3I2D A;  3MDB C;  4AYC B;  4P5O B;  2MKE A;  3O37 A;  2G45 A;  4BHW A;  4UI9 B;  4B7Y C;  2ECV A;  1WFK A;  3ASL A;  4Z0O A;  2M6M A;  2UZG A;  2IQJ A;  4YBS A;  4MVT A;  3DPL R;  2XOY A;  2FFW A;  4GNE A;  2PNX A;  3V43 A;  2C2L A;  3GV4 A;  3O47 A;  3U5N A;  2K4D A;  5B79 A;  1IYM A;  2MNY A;  5K3Q A;  2CON A;  1F62 A;  2L43 A;  1WEV A;  2QIC A;  4QQ4 A;  5DIN A;  3N9P A;  3T9K A;  2Y43 A;  4NN2 A;  3ZVY A;  4GNF A;  2YHN A;  2L7P A;  1Z6U A;  4H9D A;  5B75 A;  4GND A;  1WGM A;  2KWK A;  2OXQ C;  3O34 A;  2ZET C;  5FER A;  2YSM A;  2M3H A;  1HYI A;  3U5M A;  4I7D A;  2VJF A;  2VJE B;  2KFT A;  2HDP A;  2ECI A;  1WE9 A;  4AYC A;  3T7L A;  3RPG B;  3SOU A;  4UP0 A;  4A0C D;  4LK9 A;  3L1X A;  2ECW A;  2KU3 A;  2Y1N A;  1X4I A;  5J3X A;  5FEY A;  3RTR B;  2KRE A;  4IC3 A;  2MA5 A;  1K2F A;  5KH3 A;  4Z0R A;  4R2Y A;  2VPE A;  2PUY A;  1WIM A;  4PTB A;  2MD7 B;  4W4U A;  2LXH C;  4V3K C;  1T1H A;  3LRQ A;  5SVY A;  2H0D A;  5TDR A;  3ZVZ B;  4AP4 A;  3N9M A;  4WZ2 A;  2D8S A;  4YAB A;  2MIQ A;  2F42 A;  2OWA A;  2L75 A;  2I50 A;  1V87 A;  3PHD A;  1WEQ A;  4I7B A;  4A4C A;  1MBM A;  2LRI C;  2FSA A;  2BAY A;  4YAT A;  3FL2 A;  3KQI A;  5FB1 A;  4R8P K;  2ECG A;  1BOR A;  5G04 B;  2YYR A;  1E4U A;  1XWH A;  3M7K A;  5I3L A;  1FP0 A;  4QF3 A;  5FB0 A;  2HYE D;  5AIU A;  3C5K A;  2CKL B;  2CSV A;  5JG6 A;  2LV9 A;  3M62 A;  2G6Q A;  2CSY A;  4C9Z A;  4O62 A;  4ZQL A;  2L80 A;  1Z2Q A;  4L58 A;  2LGV A;  2MUM A;  2VPB A;  5C11 A;  4B86 C;  4GB0 A;  2RR4 A;  4QF2 A;  3E2D A;  2EXU A;  1VFY A;  2LQ6 A;  3MHH A;  3H7H A;  5H1V A;  2FUU A;  1U6G B;  3KNV A;  2YRE A;  4FK5 A;  2CT2 A;  5TBN A;  5B78 A;  2EGP A;  3N9O A;  4GNG A;  2EA6 A;  1WEN A;  4FJC A;  4O64 A;  3LVR E;  3N9Q A;  5SVI B;  4XI1 A;  2FD4 A;  3KV5 A;  4AVX A;  5G0F A;  2KWJ A;  4YBM A;  2JM3 A;  5G05 B;  5LCW B;  2KGG A;  4TKP B;  2KYU A;  3DDT A;  1JM7 A;  1JM7 B;  2VPD A;  3SUB A;  2C2V S;  5D1L B;  2M1R A;  5KH9 A;  5H1T A;  2YUR A;  1DCQ A;  3NG2 A;  2KWN A;  1DVP A;  3O33 A;  3ZPV 1;  1G25 A;  5LKZ A;  1WES A;  5C13 A;  2L0B A;  2KKX A;  2KWO A;  3LQJ A;  3SHB A;  3ZNI A;  4LKA A;  1WEM A;  2FUI A;  3PUR A;  2XOZ A;  2LGL A;  4UP5 A;  1X4U A;  4OGC A;  2XEU A;  5TDW A;  1MM2 A;  2YVR A;  3M99 A;  3LVQ E;  2H0D B;  2JMI A;  3O70 A;  4YAX A;  4IC2 A;  2LDR A;  4V3L C;  2EOD A;  2JMJ A;  4FO9 A;  5B77 A;  2YU4 A;  2M85 A;  1WIL A;  1N87 A;  3N9L A;  3O7A A;  2AN6 A;  2MT5 A;  4L7X A;  3ZPV E;  3M63 A;  4S3O C;  2XB1 A;  2IDA A;  2F6N A;  2YSJ A;  2KR4 A;  2MNZ A;  5SVI A;  3RPG C;  4BBQ A;  4YC9 A;  5LKU A;  1HYJ A;  4I7C A;  3QZV A;  1WEP A;  4WZ0 A;  1JOC A;  3U5P A;  2E6S A;  3JUE A;  5EYA F;  1WEW A;  4OGE A;  3HCU A;  3FAO A;  2LGK A;  2CKL A;  1WEE A;  2Y1M A;  4ZUX U;  3LJU X;  1WEO A;  2L5U A;  4A49 A;  3U5O A;  2P57 A;  3ZYQ A;  4WZ3 B;  2LN0 A;  2M13 A;  5TRB A;  4F1P A;  1LDJ B;  3FEH A;  2ECT A;  2G43 A;  4PPE A;  1RMD A;  5H9M A;  4LAD B;  2EGM A;  3LDY A;  2QIZ A;  3L1Z B;  3C6W A;  4ZDT A;  4LLB A;  1LDK C;  4N3W A;  1Z60 A;  4F52 B;  5H1U A;  2K1J A;  1MM3 A;  2LAU A;  2DJA A;  4WA6 A;  2CRW A;  3DWD A;  4A4B A;  3O35 A;  5AIT A;  2LGG A;  2XOC A;  5TAB A;  2XP0 A;  1X4J A;  4AUQ B; 
#chains in the Genus database with same CATH homology
 3SOX A;  3VK6 A;  2MD8 C;  3IHP A;  3HCS A;  4X3G A;  4N4F A;  2ECN A;  3LQH A;  3GL6 A;  4R7E A;  2QJ0 A;  2VJF B;  2VPG A;  2KGI A;  2VJE A;  4YBT A;  3T6R A;  3DQV R;  3EB5 A;  2RSD A;  4FIP A;  2MA6 A;  2YQL A;  2JMD A;  2YHO A;  1VD4 A;  4Q6F A;  3PUQ A;  5KH7 A;  3KV6 A;  3MHS A;  3EB6 A;  5LKT A;  2KIZ A;  1WEU A;  2RI7 A;  5LKX A;  4S3O B;  2DX8 A;  5DKA A;  2VNF A;  3L11 A;  2KE1 A;  2LXP C;  3O36 A;  4YAD A;  3N9N A;  1ZBD B;  2JRJ A;  2F6J A;  2YW8 A;  5B8D A;  2VP7 A;  4CA1 A;  1VYX A;  2YQM A;  1CHC A;  2E6R A;  5B76 A;  2YUC A;  3ZTG A;  2NAA A;  3HCT A;  5D1K B;  2YT5 A;  5D1M B;  2CSZ A;  2K16 A;  3HTK C;  4CCG X;  4LJN A;  1FBV A;  2K17 A;  3SOW A;  3LQI A;  4MSX A;  2ECJ A;  3I2D A;  4AYC B;  4P5O B;  3O37 A;  2G45 A;  4BHW A;  4UI9 B;  4B7Y C;  2ECV A;  1WFK A;  3ASL A;  2M6M A;  2UZG A;  4YBS A;  4MVT A;  3DPL R;  4GNE A;  2PNX A;  3V43 A;  2C2L A;  3GV4 A;  3U5N A;  2K4D A;  1IYM A;  2MNY A;  1F62 A;  2L43 A;  1WEV A;  2QIC A;  5DIN A;  3N9P A;  2Y43 A;  4NN2 A;  3ZVY A;  4GNF A;  2YHN A;  1Z6U A;  5B75 A;  4GND A;  1WGM A;  2KWK A;  2OXQ C;  3O34 A;  2ZET C;  5FER A;  2YSM A;  2M3H A;  1HYI A;  3U5M A;  4I7D A;  2VJF A;  2VJE B;  2KFT A;  2HDP A;  2ECI A;  1WE9 A;  4AYC A;  3T7L A;  3RPG B;  3SOU A;  4UP0 A;  4A0C D;  4LK9 A;  3L1X A;  2ECW A;  5J3X A;  2KU3 A;  2Y1N A;  1X4I A;  5FEY A;  3RTR B;  2KRE A;  4IC3 A;  2MA5 A;  1K2F A;  5KH3 A;  4R2Y A;  2VPE A;  2PUY A;  1WIM A;  4PTB A;  2MD7 B;  4W4U A;  2LXH C;  4V3K C;  1T1H A;  3LRQ A;  2H0D A;  5TDR A;  3ZVZ B;  4AP4 A;  3N9M A;  4WZ2 A;  2D8S A;  4YAB A;  2MIQ A;  2F42 A;  2L75 A;  2I50 A;  1V87 A;  3PHD A;  1WEQ A;  4I7B A;  4A4C A;  2LRI C;  2FSA A;  2BAY A;  4YAT A;  3FL2 A;  3KQI A;  5FB1 A;  4R8P K;  2ECG A;  1BOR A;  5G04 B;  2YYR A;  1E4U A;  1XWH A;  5I3L A;  1FP0 A;  4QF3 A;  5FB0 A;  2HYE D;  5AIU A;  3C5K A;  2CKL B;  5JG6 A;  2LV9 A;  3M62 A;  2G6Q A;  2CSY A;  4C9Z A;  4ZQL A;  2L80 A;  1Z2Q A;  4L58 A;  2LGV A;  2MUM A;  2VPB A;  5C11 A;  4B86 C;  4GB0 A;  4QF2 A;  1VFY A;  2LQ6 A;  3MHH A;  5H1V A;  2FUU A;  1U6G B;  3KNV A;  2YRE A;  4FK5 A;  2CT2 A;  5TBN A;  5B78 A;  2EGP A;  3N9O A;  4GNG A;  2EA6 A;  1WEN A;  4FJC A;  4O64 A;  3N9Q A;  4XI1 A;  3KV5 A;  4AVX A;  5G0F A;  2KWJ A;  4YBM A;  5G05 B;  5LCW B;  2KGG A;  4TKP B;  2KYU A;  1JM7 A;  1JM7 B;  2VPD A;  2C2V S;  5D1L B;  2M1R A;  5KH9 A;  5H1T A;  2YUR A;  3NG2 A;  2KWN A;  1DVP A;  3O33 A;  3ZPV 1;  4AUQ B;  1G25 A;  5LKZ A;  1WES A;  5C13 A;  2L0B A;  3LQJ A;  2KWO A;  3SHB A;  3ZNI A;  4LKA A;  1WEM A;  2FUI A;  3PUR A;  2LGL A;  4UP5 A;  1X4U A;  2XEU A;  5TDW A;  1MM2 A;  3M99 A;  2H0D B;  2JMI A;  3O70 A;  4YAX A;  4IC2 A;  2LDR A;  4V3L C;  2EOD A;  2JMJ A;  4FO9 A;  5B77 A;  2YU4 A;  2M85 A;  1WIL A;  1N87 A;  3N9L A;  3O7A A;  2AN6 A;  2MT5 A;  4L7X A;  3ZPV E;  3M63 A;  4S3O C;  2XB1 A;  2IDA A;  2F6N A;  2YSJ A;  2KR4 A;  2MNZ A;  4BBQ A;  3RPG C;  4YC9 A;  5LKU A;  1HYJ A;  4I7C A;  3QZV A;  1WEP A;  4WZ0 A;  1JOC A;  3U5P A;  2E6S A;  5EYA F;  1WEW A;  3HCU A;  2LGK A;  2CKL A;  1WEE A;  2Y1M A;  4ZUX U;  1WEO A;  2L5U A;  4A49 A;  3U5O A;  3ZYQ A;  4WZ3 B;  2LN0 A;  5TRB A;  1LDJ B;  2ECT A;  2G43 A;  4PPE A;  1RMD A;  5H9M A;  4LAD B;  2QIZ A;  3L1Z B;  3C6W A;  4ZDT A;  4LLB A;  1LDK C;  4N3W A;  4F52 B;  1Z60 A;  5H1U A;  2K1J A;  1MM3 A;  4WA6 A;  4A4B A;  3O35 A;  5AIT A;  2LGG A;  5TAB A;  1X4J A;  5B79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...