1X4UA

Solution structure of the fyve domain from human fyve domain containing 27 isoform b protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
84
structure length
84
Chain Sequence
GSSGSSGRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Zinc finger, FYVE domain containing 27 isoform b
publication title Solution structure of the FYVE domain from human FYVE domain containing 27 isoform b protein
rcsb
source organism Homo sapiens
total genus 5
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4uA01
1WEQA 2ECGA 2EGPA 2LN0A 3N9OA 4ZUXU 5FB0A 2LGLA 2MUMA 2LXHC 2MIQA 2YQLA 4ZDTA 2K1JA 4R8PK 4A0CD 5TDRA 4YBMA 4I7CA 2K16A 3MHSA 5H1VA 3O34A 2M3HA 1FP0A 2Y43A 2ECJA 2YSMA 3O37A 2CT2A 3N9PA 2ECTA 5G0FA 2H0DB 1V87A 5JG6A 2KE1A 3KQIA 3FL2A 3RTRB 2FUIA 1DVPA 4IC3A 1RMDA 5C13A 4S3OC 2F6JA 4B7YC 4WA6A 4N3WA 3M62A 4UP0A 3EB5A 5LKXA 5TBNA 3ZTGA 3HTKC 3L1ZB 4AYCA 2M1RA 2MNYA 3ZVYA 1WILA 5FEYA 5G04B 3KV6A 3SOXA 1K2FA 4Q6FA 3PURA 4UP5A 1WEWA 2CSYA 1CHCA 5H9MA 5TABA 3PHDA 1VD4A 3L11A 4BHWA 4QF3A 4UI9B 4BBQA 2JRJA 2IDAA 4AVXA 4A49A 3GL6A 2XB1A 1FBVA 3ZPV1 4LADB 5KH9A 4GB0A 2YT5A 3I2DA 1HYIA 2YURA 2L43A 1WEEA 3L1XA 4XI1A 5D1KB 4B86C 5FERA 2KGIA 5EYAF 2LV9A 3ZYQA 2G45A 2CKLA 4O64A 2ECIA 4I7BA 4FO9A 4A4BA 4YC9A 3GV4A 2L80A 4FK5A 2YUCA 2LGVA 2ZETC 2KWOA 5C11A 2HYED 2VP7A 4TKPB 2H0DA 4N4FA 4WZ2A 1Z60A 2E6SA 5I3LA 3M63A 5H1TA 3N9QA 2L0BA 2K4DA 4YBTA 4F52B 2EODA 2VPDA 2QJ0A 2LQ6A 2UZGA 1Z2QA 5DKAA 1WESA 3PUQA 3U5OA 2ECVA 4PPEA 2KIZA 4V3KC 3ZPVE 3DPLR 1T1HA 3O35A 2VJFA 5B75A 1G25A 2FSAA 2RSDA 5LKUA 4P5OB 2M6MA 2YREA 4A4CA 2YW8A 2Y1MA 3QZVA 1IYMA 1XWHA 2LXPC 4S3OB 2MA6A 2MD8C 2F42A 2C2LA 1WFKA 2KYUA 1VYXA 2F6NA 4LLBA 2AN6A 2ECWA 3LQJA 5TDWA 2DX8A 2LGGA 2I50A 1WE9A 5B79A 5LCWB 5AIUA 4W4UA 1JM7A 4YAXA 2YHNA 1WIMA 4GNEA 2KFTA 1HYJA 2VJEA 2YQMA 4AYCB 3O33A 3LRQA 2EA6A 5B78A 2ECNA 4YBSA 1BORA 2KWJA 2E6RA 1Z6UA 3DQVR 4CCGX 4FIPA 3HCSA 4X3GA 4QF2A 2C2VS 4I7DA 4C9ZA 3V43A 4AUQB 2JMJA 3O7AA 1X4UA 5B77A 3LQIA 3LQHA 4WZ3B 2FUUA 3VK6A 2KU3A 2NAAA 2JMDA 3U5NA 2L75A 4ZQLA 1ZBDB 1N87A 3KV5A 1E4UA 3SHBA 1WEPA 2MD7B 3HCTA 1WENA 3N9LA 1X4IA 2LDRA 2KGGA 2RI7A 1WEOA 5KH3A 2VPGA 2YU4A 5D1LB 2CKLB 3SOWA 2LGKA 2G6QA 4LK9A 3RPGC 2MA5A 3N9MA 1LDKC 3RPGB 1LDJB 4R2YA 1MM2A 1MM3A 4PTBA 5LKTA 1JOCA 2BAYA 3T6RA 2KWNA 3O70A 3U5PA 2CSZA 4YABA 4WZ0A 1WGMA 2YYRA 1WEUA 1F62A 5TRBA 3C6WA 4IC2A 2PUYA 5B76A 2QIZA 4FJCA 2VJFB 3N9NA 4GNFA 4L58A 3ZNIA 1VFYA 2G43A 5KH7A 2VPBA 5B8DA 2VNFA 2YSJA 3HCUA 3IHPA 4NN2A 1WEVA 2HDPA 5H1UA 4CA1A 2LRIC 5G05B 2KWKA 2L5UA 3MHHA 5AITA 2KREA 4LJNA 4MSXA 4YATA 3O36A 4V3LC 5DINA 2OXQC 2M85A 2PNXA 2K17A 4R7EA 2JMIA 2QICA 4LKAA 3SOUA 3M99A 3NG2A 3C5KA 4GNDA 1JM7B 2MNZA 2Y1NA 1X4JA 2YHOA 2XEUA 3ZVZB 2KR4A 3KNVA 3EB6A 2MT5A 3T7LA 5FB1A 2VJEB 1U6GB 4AP4A 4L7XA 2VPEA 4GNGA 5J3XA 4MVTA 4YADA 3U5MA 5D1MB 1WEMA 2D8SA 3ASLA 5LKZA
chains in the Genus database with same CATH superfamily
1WEQA 2ECGA 2EGPA 2LN0A 3N9OA 4ZUXU 2DJAA 5FB0A 2LGLA 2MUMA 2LXHC 2MIQA 2YQLA 2EGMA 4ZDTA 2K1JA 4R8PK 2D8UA 4A0CD 5TDRA 5SVIA 4YBMA 4I7CA 2K16A 3MHSA 5H1VA 3O34A 2M3HA 1FP0A 2Y43A 3FANA 2ECJA 2YSMA 3O37A 2CT2A 3N9PA 2ECTA 5G0FA 2H0DB 1V87A 5JG6A 2KE1A 3KQIA 3FL2A 3RTRB 2FUIA 1DVPA 4IC3A 1RMDA 5C13A 4S3OC 2B0OE 2F6JA 4B7YC 4WA6A 4N3WA 3JUEA 3M62A 4UP0A 3EB5A 5LKXA 5TBNA 3ZTGA 3HTKC 3L1ZB 4AYCA 2M1RA 2MNYA 3ZVYA 1WILA 5FEYA 5G04B 3KV6A 3SOXA 1K2FA 3FEHA 4Q6FA 3LJUX 4OGEA 4H9DA 3PURA 4UP5A 1WEWA 2CSYA 1CHCA 5H9MA 5TABA 4Z0RA 2DSMA 3PHDA 1VD4A 3L11A 4BHWA 4QF3A 2JM3A 4UI9B 4BBQA 4O62A 4F1PA 2JRJA 2IDAA 4AVXA 4A49A 3GL6A 2XB1A 1FBVA 3ZPV1 4LADB 5KH9A 4GB0A 2YT5A 3I2DA 1HYIA 2YURA 2L43A 2JUNA 1WEEA 3L1XA 4XI1A 5D1KB 4B86C 5FERA 2KGIA 5EYAF 2LV9A 2EXUA 3ZYQA 3LVQE 2KKYA 2G45A 2CONA 2CKLA 4O64A 2ECIA 4I7BA 3KDEC 3LVRE 4FO9A 4A4BA 4YC9A 3GV4A 3E2DA 2L80A 4FK5A 2YUCA 2LGVA 2ZETC 2KWOA 5C11A 2HYED 3MDBC 2VP7A 2YVRA 4TKPB 2H0DA 2FD4A 4N4FA 4WZ2A 2XOYA 1Z60A 2E6SA 5I3LA 3M63A 5H1TA 3N9QA 2L0BA 2K4DA 4YBTA 4F52B 2EODA 2VPDA 2QJ0A 3H7HA 2LQ6A 2UZGA 1Z2QA 5DKAA 1WESA 3PUQA 3U5OA 2ECVA 2XOZA 2KIZA 4PPEA 4V3KC 3ZPVE 3DPLR 1T1HA 3O35A 3T9KA 2VJFA 5B75A 1G25A 2FSAA 2RSDA 5LKUA 4P5OB 2M6MA 2YREA 4A4CA 2YW8A 2Y1MA 3QZVA 1IYMA 1XWHA 5SVIB 2LXPC 4S3OB 2MA6A 2MD8C 2F42A 2C2LA 1WFKA 2KYUA 1VYXA 2F6NA 3DWDA 4LLBA 2LAUA 2AN6A 2ECWA 3LQJA 5TDWA 2DX8A 2OWAA 2LGGA 2I50A 4OGCA 1WE9A 2KKXA 5B79A 5LCWB 5AIUA 4W4UA 3DDTA 1JM7A 4YAXA 2M13A 2YHNA 1WIMA 4GNEA 2KFTA 1HYJA 2VJEA 2YQMA 2RR4A 4AYCB 3O33A 3LRQA 2EA6A 5B78A 2ECNA 4YBSA 1BORA 2KWJA 2E6RA 1Z6UA 3DQVR 4CCGX 4FIPA 3HCSA 4X3GA 4QF2A 2C2VS 4I7DA 4C9ZA 3V43A 4AUQB 2JMJA 3O7AA 1X4UA 5B77A 3LQIA 1DCQA 3LQHA 4WZ3B 2L7PA 2FUUA 3VK6A 2KU3A 2NAAA 2JMDA 2P57A 3U5NA 2L75A 4ZQLA 5SVXA 1ZBDB 1N87A 3KV5A 1E4UA 3SHBA 1WEPA 2MD7B 3HCTA 1WENA 3N9LA 1X4IA 2LDRA 2KGGA 2FFWA 2RI7A 1WEOA 5KH3A 2VPGA 2YU4A 5D1LB 2CKLB 3SOWA 2LGKA 2G6QA 4LK9A 3RPGC 2MA5A 3N9MA 1LDKC 3RPGB 1LDJB 4R2YA 1MM2A 1MM3A 4PTBA 5LKTA 1JOCA 3FM8C 2BAYA 3T6RA 2KWNA 3O70A 3U5PA 2CSZA 2XP0A 3FJUB 4YABA 4WZ0A 5K3QA 1WGMA 2YYRA 1WEUA 1F62A 3O47A 5TRBA 3C6WA 4Z0OA 4IC2A 2PUYA 5B76A 2CRWA 2QIZA 2CRRA 4FJCA 2VJFB 3N9NA 4GNFA 4L58A 3ZNIA 1VFYA 2G43A 5KH7A 2VPBA 2MKEA 3FAOA 5B8DA 2VNFA 2YSJA 3HCUA 3IHPA 4NN2A 1WEVA 2HDPA 2XOCA 5H1UA 4CA1A 2LRIC 5G05B 2KWKA 2L5UA 3MHHA 5AITA 2KREA 4LJNA 4MSXA 4YATA 3PLWA 3O36A 4V3LC 5DINA 2OXQC 2M85A 2PNXA 2K17A 4R7EA 2JMIA 2QICA 4LKAA 5SVYA 3SOUA 3M99A 3NG2A 3C5KA 4GNDA 1JM7B 2MNZA 2Y1NA 1X4JA 2YHOA 4QQ4A 2XEUA 3ZVZB 2KR4A 3KNVA 3EB6A 2MT5A 3LDYA 3M7KA 3T7LA 5FB1A 2VJEB 1U6GB 2E61A 4AP4A 4L7XA 2VPEA 4GNGA 5J3XA 1MBMA 4MVTA 2IQJA 4YADA 2CSVA 3U5MA 3Q1DA 5D1MB 1WEMA 3SUBA 2D8SA 3ASLA 5LKZA
chains in the Genus database with same CATH topology
1WEQA 2ECGA 2EGPA 2LN0A 3N9OA 4ZUXU 5FB0A 2LGLA 2MUMA 2LXHC 2MIQA 2YQLA 4ZDTA 2K1JA 4R8PK 4A0CD 5TDRA 4YBMA 4I7CA 2K16A 3MHSA 5H1VA 3O34A 2M3HA 1FP0A 2Y43A 2ECJA 2YSMA 3O37A 2CT2A 3N9PA 2ECTA 5G0FA 2H0DB 1V87A 5JG6A 2KE1A 3KQIA 3FL2A 3RTRB 2FUIA 1DVPA 4IC3A 1RMDA 5C13A 4S3OC 2F6JA 4B7YC 4WA6A 4N3WA 3M62A 4UP0A 3EB5A 5LKXA 5TBNA 3ZTGA 3HTKC 3L1ZB 4AYCA 2M1RA 2MNYA 3ZVYA 1WILA 5FEYA 5G04B 3KV6A 3SOXA 1K2FA 4Q6FA 3PURA 4UP5A 1WEWA 2CSYA 1CHCA 5H9MA 5TABA 3PHDA 1VD4A 3L11A 4BHWA 4QF3A 4UI9B 4BBQA 2JRJA 2IDAA 4AVXA 4A49A 3GL6A 2XB1A 1FBVA 3ZPV1 4LADB 5KH9A 4GB0A 2YT5A 3I2DA 1HYIA 2YURA 2L43A 1WEEA 3L1XA 4XI1A 5D1KB 4B86C 5FERA 2KGIA 5EYAF 2LV9A 3ZYQA 2G45A 2CKLA 4O64A 2ECIA 4I7BA 4FO9A 4A4BA 4YC9A 3GV4A 2L80A 4FK5A 2YUCA 2LGVA 2ZETC 2KWOA 5C11A 2HYED 2VP7A 4TKPB 2H0DA 4N4FA 4WZ2A 1Z60A 2E6SA 5I3LA 3M63A 5H1TA 3N9QA 2L0BA 2K4DA 4YBTA 4F52B 2EODA 2VPDA 2QJ0A 2LQ6A 2UZGA 1Z2QA 5DKAA 1WESA 3PUQA 3U5OA 2ECVA 4PPEA 2KIZA 4V3KC 3ZPVE 3DPLR 1T1HA 3O35A 2VJFA 5B75A 1G25A 2FSAA 2RSDA 5LKUA 4P5OB 2M6MA 2YREA 4A4CA 2YW8A 2Y1MA 3QZVA 1IYMA 1XWHA 2LXPC 4S3OB 2MA6A 2MD8C 2F42A 2C2LA 1WFKA 2KYUA 1VYXA 2F6NA 4LLBA 2AN6A 2ECWA 3LQJA 5TDWA 2DX8A 2LGGA 2I50A 1WE9A 5B79A 5LCWB 5AIUA 4W4UA 1JM7A 4YAXA 2YHNA 1WIMA 4GNEA 2KFTA 1HYJA 2VJEA 2YQMA 4AYCB 3O33A 3LRQA 2EA6A 5B78A 2ECNA 4YBSA 1BORA 2KWJA 2E6RA 1Z6UA 3DQVR 4CCGX 4FIPA 3HCSA 4X3GA 4QF2A 2C2VS 4I7DA 4C9ZA 3V43A 4AUQB 2JMJA 3O7AA 1X4UA 5B77A 3LQIA 3LQHA 4WZ3B 2FUUA 3VK6A 2KU3A 2NAAA 2JMDA 3U5NA 2L75A 4ZQLA 1ZBDB 1N87A 3KV5A 1E4UA 3SHBA 1WEPA 2MD7B 3HCTA 1WENA 3N9LA 1X4IA 2LDRA 2KGGA 2RI7A 1WEOA 5KH3A 2VPGA 2YU4A 5D1LB 2CKLB 3SOWA 2LGKA 2G6QA 4LK9A 3RPGC 2MA5A 3N9MA 1LDKC 3RPGB 1LDJB 4R2YA 1MM2A 1MM3A 4PTBA 5LKTA 1JOCA 2BAYA 3T6RA 2KWNA 3O70A 3U5PA 2CSZA 4YABA 4WZ0A 1WGMA 2YYRA 1WEUA 1F62A 5TRBA 3C6WA 4IC2A 2PUYA 5B76A 2QIZA 4FJCA 2VJFB 3N9NA 4GNFA 4L58A 3ZNIA 1VFYA 2G43A 5KH7A 2VPBA 5B8DA 2VNFA 2YSJA 3HCUA 3IHPA 4NN2A 1WEVA 2HDPA 5H1UA 4CA1A 2LRIC 5G05B 2KWKA 2L5UA 3MHHA 5AITA 2KREA 4LJNA 4MSXA 4YATA 3O36A 4V3LC 5DINA 2OXQC 2M85A 2PNXA 2K17A 4R7EA 2JMIA 2QICA 4LKAA 3SOUA 3M99A 3NG2A 3C5KA 4GNDA 1JM7B 2MNZA 2Y1NA 1X4JA 2YHOA 2XEUA 3ZVZB 2KR4A 3KNVA 3EB6A 2MT5A 3T7LA 5FB1A 2VJEB 1U6GB 4AP4A 4L7XA 2VPEA 4GNGA 5J3XA 4MVTA 4YADA 3U5MA 5D1MB 1WEMA 2D8SA 3ASLA 5LKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEQ A;  2ECG A;  2EGP A;  2LN0 A;  3N9O A;  4ZUX U;  5FB0 A;  2LGL A;  2MUM A;  2LXH C;  2MIQ A;  2YQL A;  4ZDT A;  2K1J A;  4R8P K;  4A0C D;  5TDR A;  4YBM A;  4I7C A;  2K16 A;  3MHS A;  5H1V A;  3O34 A;  2M3H A;  1FP0 A;  2Y43 A;  2ECJ A;  2YSM A;  3O37 A;  2CT2 A;  3N9P A;  2ECT A;  5G0F A;  2H0D B;  1V87 A;  5JG6 A;  2KE1 A;  3KQI A;  3FL2 A;  3RTR B;  2FUI A;  1DVP A;  4IC3 A;  1RMD A;  5C13 A;  4S3O C;  2F6J A;  4B7Y C;  4WA6 A;  4N3W A;  3M62 A;  4UP0 A;  3EB5 A;  5LKX A;  5TBN A;  3ZTG A;  3HTK C;  3L1Z B;  4AYC A;  2M1R A;  2MNY A;  3ZVY A;  1WIL A;  5FEY A;  5G04 B;  3KV6 A;  3SOX A;  1K2F A;  4Q6F A;  3PUR A;  4UP5 A;  1WEW A;  2CSY A;  1CHC A;  5H9M A;  5TAB A;  3PHD A;  1VD4 A;  3L11 A;  4BHW A;  4QF3 A;  4UI9 B;  4BBQ A;  2JRJ A;  2IDA A;  4AVX A;  4A49 A;  3GL6 A;  2XB1 A;  1FBV A;  3ZPV 1;  4LAD B;  5KH9 A;  4GB0 A;  2YT5 A;  3I2D A;  1HYI A;  2YUR A;  2L43 A;  1WEE A;  3L1X A;  4XI1 A;  5D1K B;  4B86 C;  5FER A;  2KGI A;  5EYA F;  2LV9 A;  3ZYQ A;  2G45 A;  2CKL A;  4O64 A;  2ECI A;  4I7B A;  4FO9 A;  4A4B A;  4YC9 A;  3GV4 A;  2L80 A;  4FK5 A;  2YUC A;  2LGV A;  2ZET C;  2KWO A;  5C11 A;  2HYE D;  2VP7 A;  4TKP B;  2H0D A;  4N4F A;  4WZ2 A;  1Z60 A;  2E6S A;  5I3L A;  3M63 A;  5H1T A;  3N9Q A;  2L0B A;  2K4D A;  4YBT A;  4F52 B;  2EOD A;  2VPD A;  2QJ0 A;  2LQ6 A;  2UZG A;  1Z2Q A;  5DKA A;  1WES A;  3PUQ A;  3U5O A;  2ECV A;  4PPE A;  2KIZ A;  4V3K C;  3ZPV E;  3DPL R;  1T1H A;  3O35 A;  2VJF A;  5B75 A;  1G25 A;  2FSA A;  2RSD A;  5LKU A;  4P5O B;  2M6M A;  2YRE A;  4A4C A;  2YW8 A;  2Y1M A;  3QZV A;  1IYM A;  1XWH A;  2LXP C;  4S3O B;  2MA6 A;  2MD8 C;  2F42 A;  2C2L A;  1WFK A;  2KYU A;  1VYX A;  2F6N A;  4LLB A;  2AN6 A;  2ECW A;  3LQJ A;  5TDW A;  2DX8 A;  2LGG A;  2I50 A;  1WE9 A;  5B79 A;  5LCW B;  5AIU A;  4W4U A;  1JM7 A;  4YAX A;  2YHN A;  1WIM A;  4GNE A;  2KFT A;  1HYJ A;  2VJE A;  2YQM A;  4AYC B;  3O33 A;  3LRQ A;  2EA6 A;  5B78 A;  2ECN A;  4YBS A;  1BOR A;  2KWJ A;  2E6R A;  1Z6U A;  3DQV R;  4CCG X;  4FIP A;  3HCS A;  4X3G A;  4QF2 A;  2C2V S;  4I7D A;  4C9Z A;  3V43 A;  4AUQ B;  2JMJ A;  3O7A A;  1X4U A;  5B77 A;  3LQI A;  3LQH A;  4WZ3 B;  2FUU A;  3VK6 A;  2KU3 A;  2NAA A;  2JMD A;  3U5N A;  2L75 A;  4ZQL A;  1ZBD B;  1N87 A;  3KV5 A;  1E4U A;  3SHB A;  1WEP A;  2MD7 B;  3HCT A;  1WEN A;  3N9L A;  1X4I A;  2LDR A;  2KGG A;  2RI7 A;  1WEO A;  5KH3 A;  2VPG A;  2YU4 A;  5D1L B;  2CKL B;  3SOW A;  2LGK A;  2G6Q A;  4LK9 A;  3RPG C;  2MA5 A;  3N9M A;  1LDK C;  3RPG B;  1LDJ B;  4R2Y A;  1MM2 A;  1MM3 A;  4PTB A;  5LKT A;  1JOC A;  2BAY A;  3T6R A;  2KWN A;  3O70 A;  3U5P A;  2CSZ A;  4YAB A;  4WZ0 A;  1WGM A;  2YYR A;  1WEU A;  1F62 A;  5TRB A;  3C6W A;  4IC2 A;  2PUY A;  5B76 A;  2QIZ A;  4FJC A;  2VJF B;  3N9N A;  4GNF A;  4L58 A;  3ZNI A;  1VFY A;  2G43 A;  5KH7 A;  2VPB A;  5B8D A;  2VNF A;  2YSJ A;  3HCU A;  3IHP A;  4NN2 A;  1WEV A;  2HDP A;  5H1U A;  4CA1 A;  2LRI C;  5G05 B;  2KWK A;  2L5U A;  3MHH A;  5AIT A;  2KRE A;  4LJN A;  4MSX A;  4YAT A;  3O36 A;  4V3L C;  5DIN A;  2OXQ C;  2M85 A;  2PNX A;  2K17 A;  4R7E A;  2JMI A;  2QIC A;  4LKA A;  3SOU A;  3M99 A;  3NG2 A;  3C5K A;  4GND A;  1JM7 B;  2MNZ A;  2Y1N A;  1X4J A;  2YHO A;  2XEU A;  3ZVZ B;  2KR4 A;  3KNV A;  3EB6 A;  2MT5 A;  3T7L A;  5FB1 A;  2VJE B;  1U6G B;  4AP4 A;  4L7X A;  2VPE A;  4GNG A;  5J3X A;  4MVT A;  4YAD A;  3U5M A;  5D1M B;  1WEM A;  2D8S A;  3ASL A;  5LKZ A; 
#chains in the Genus database with same CATH topology
 1WEQ A;  2ECG A;  2EGP A;  2LN0 A;  3N9O A;  4ZUX U;  2DJA A;  5FB0 A;  2LGL A;  2MUM A;  2LXH C;  2MIQ A;  2YQL A;  2EGM A;  4ZDT A;  2K1J A;  4R8P K;  2D8U A;  4A0C D;  5TDR A;  5SVI A;  4YBM A;  4I7C A;  2K16 A;  3MHS A;  5H1V A;  3O34 A;  2M3H A;  1FP0 A;  2Y43 A;  3FAN A;  2ECJ A;  2YSM A;  3O37 A;  2CT2 A;  3N9P A;  2ECT A;  5G0F A;  2H0D B;  1V87 A;  5JG6 A;  2KE1 A;  3KQI A;  3FL2 A;  3RTR B;  2FUI A;  1DVP A;  4IC3 A;  1RMD A;  5C13 A;  4S3O C;  2B0O E;  2F6J A;  4B7Y C;  4WA6 A;  4N3W A;  3JUE A;  3M62 A;  4UP0 A;  3EB5 A;  5LKX A;  5TBN A;  3ZTG A;  3HTK C;  3L1Z B;  4AYC A;  2M1R A;  2MNY A;  3ZVY A;  1WIL A;  5FEY A;  5G04 B;  3KV6 A;  3SOX A;  1K2F A;  3FEH A;  4Q6F A;  3LJU X;  4OGE A;  4H9D A;  3PUR A;  4UP5 A;  1WEW A;  2CSY A;  1CHC A;  5H9M A;  5TAB A;  4Z0R A;  2DSM A;  3PHD A;  1VD4 A;  3L11 A;  4BHW A;  4QF3 A;  2JM3 A;  4UI9 B;  4BBQ A;  4O62 A;  4F1P A;  2JRJ A;  2IDA A;  4AVX A;  4A49 A;  3GL6 A;  2XB1 A;  1FBV A;  3ZPV 1;  4LAD B;  5KH9 A;  4GB0 A;  2YT5 A;  3I2D A;  1HYI A;  2YUR A;  2L43 A;  2JUN A;  1WEE A;  3L1X A;  4XI1 A;  5D1K B;  4B86 C;  5FER A;  2KGI A;  5EYA F;  2LV9 A;  2EXU A;  3ZYQ A;  3LVQ E;  2KKY A;  2G45 A;  2CON A;  2CKL A;  4O64 A;  2ECI A;  4I7B A;  3KDE C;  3LVR E;  4FO9 A;  4A4B A;  4YC9 A;  3GV4 A;  3E2D A;  2L80 A;  4FK5 A;  2YUC A;  2LGV A;  2ZET C;  2KWO A;  5C11 A;  2HYE D;  3MDB C;  2VP7 A;  2YVR A;  4TKP B;  2H0D A;  2FD4 A;  4N4F A;  4WZ2 A;  2XOY A;  1Z60 A;  2E6S A;  5I3L A;  3M63 A;  5H1T A;  3N9Q A;  2L0B A;  2K4D A;  4YBT A;  4F52 B;  2EOD A;  2VPD A;  2QJ0 A;  3H7H A;  2LQ6 A;  2UZG A;  1Z2Q A;  5DKA A;  1WES A;  3PUQ A;  3U5O A;  2ECV A;  2XOZ A;  2KIZ A;  4PPE A;  4V3K C;  3ZPV E;  3DPL R;  1T1H A;  3O35 A;  3T9K A;  2VJF A;  5B75 A;  1G25 A;  2FSA A;  2RSD A;  5LKU A;  4P5O B;  2M6M A;  2YRE A;  4A4C A;  2YW8 A;  2Y1M A;  3QZV A;  1IYM A;  1XWH A;  5SVI B;  2LXP C;  4S3O B;  2MA6 A;  2MD8 C;  2F42 A;  2C2L A;  1WFK A;  2KYU A;  1VYX A;  2F6N A;  3DWD A;  4LLB A;  2LAU A;  2AN6 A;  2ECW A;  3LQJ A;  5TDW A;  2DX8 A;  2OWA A;  2LGG A;  2I50 A;  4OGC A;  1WE9 A;  2KKX A;  5B79 A;  5LCW B;  5AIU A;  4W4U A;  3DDT A;  1JM7 A;  4YAX A;  2M13 A;  2YHN A;  1WIM A;  4GNE A;  2KFT A;  1HYJ A;  2VJE A;  2YQM A;  2RR4 A;  4AYC B;  3O33 A;  3LRQ A;  2EA6 A;  5B78 A;  2ECN A;  4YBS A;  1BOR A;  2KWJ A;  2E6R A;  1Z6U A;  3DQV R;  4CCG X;  4FIP A;  3HCS A;  4X3G A;  4QF2 A;  2C2V S;  4I7D A;  4C9Z A;  3V43 A;  4AUQ B;  2JMJ A;  3O7A A;  1X4U A;  5B77 A;  3LQI A;  1DCQ A;  3LQH A;  4WZ3 B;  2L7P A;  2FUU A;  3VK6 A;  2KU3 A;  2NAA A;  2JMD A;  2P57 A;  3U5N A;  2L75 A;  4ZQL A;  5SVX A;  1ZBD B;  1N87 A;  3KV5 A;  1E4U A;  3SHB A;  1WEP A;  2MD7 B;  3HCT A;  1WEN A;  3N9L A;  1X4I A;  2LDR A;  2KGG A;  2FFW A;  2RI7 A;  1WEO A;  5KH3 A;  2VPG A;  2YU4 A;  5D1L B;  2CKL B;  3SOW A;  2LGK A;  2G6Q A;  4LK9 A;  3RPG C;  2MA5 A;  3N9M A;  1LDK C;  3RPG B;  1LDJ B;  4R2Y A;  1MM2 A;  1MM3 A;  4PTB A;  5LKT A;  1JOC A;  3FM8 C;  2BAY A;  3T6R A;  2KWN A;  3O70 A;  3U5P A;  2CSZ A;  2XP0 A;  3FJU B;  4YAB A;  4WZ0 A;  5K3Q A;  1WGM A;  2YYR A;  1WEU A;  1F62 A;  3O47 A;  5TRB A;  3C6W A;  4Z0O A;  4IC2 A;  2PUY A;  5B76 A;  2CRW A;  2QIZ A;  2CRR A;  4FJC A;  2VJF B;  3N9N A;  4GNF A;  4L58 A;  3ZNI A;  1VFY A;  2G43 A;  5KH7 A;  2VPB A;  2MKE A;  3FAO A;  5B8D A;  2VNF A;  2YSJ A;  3HCU A;  3IHP A;  4NN2 A;  1WEV A;  2HDP A;  2XOC A;  5H1U A;  4CA1 A;  2LRI C;  5G05 B;  2KWK A;  2L5U A;  3MHH A;  5AIT A;  2KRE A;  4LJN A;  4MSX A;  4YAT A;  3PLW A;  3O36 A;  4V3L C;  5DIN A;  2OXQ C;  2M85 A;  2PNX A;  2K17 A;  4R7E A;  2JMI A;  2QIC A;  4LKA A;  5SVY A;  3SOU A;  3M99 A;  3NG2 A;  3C5K A;  4GND A;  1JM7 B;  2MNZ A;  2Y1N A;  1X4J A;  2YHO A;  4QQ4 A;  2XEU A;  3ZVZ B;  2KR4 A;  3KNV A;  3EB6 A;  2MT5 A;  3LDY A;  3M7K A;  3T7L A;  5FB1 A;  2VJE B;  1U6G B;  2E61 A;  4AP4 A;  4L7X A;  2VPE A;  4GNG A;  5J3X A;  1MBM A;  4MVT A;  2IQJ A;  4YAD A;  2CSV A;  3U5M A;  3Q1D A;  5D1M B;  1WEM A;  3SUB A;  2D8S A;  3ASL A;  5LKZ A; 
#chains in the Genus database with same CATH homology
 1WEQ A;  2ECG A;  2EGP A;  2LN0 A;  3N9O A;  4ZUX U;  5FB0 A;  2LGL A;  2MUM A;  2LXH C;  2MIQ A;  2YQL A;  4ZDT A;  2K1J A;  4R8P K;  4A0C D;  5TDR A;  4YBM A;  4I7C A;  2K16 A;  3MHS A;  5H1V A;  3O34 A;  2M3H A;  1FP0 A;  2Y43 A;  2ECJ A;  2YSM A;  3O37 A;  2CT2 A;  3N9P A;  2ECT A;  5G0F A;  2H0D B;  1V87 A;  5JG6 A;  2KE1 A;  3KQI A;  3FL2 A;  3RTR B;  2FUI A;  1DVP A;  4IC3 A;  1RMD A;  5C13 A;  4S3O C;  2F6J A;  4B7Y C;  4WA6 A;  4N3W A;  3M62 A;  4UP0 A;  3EB5 A;  5LKX A;  5TBN A;  3ZTG A;  3HTK C;  3L1Z B;  4AYC A;  2M1R A;  2MNY A;  3ZVY A;  1WIL A;  5FEY A;  5G04 B;  3KV6 A;  3SOX A;  1K2F A;  4Q6F A;  3PUR A;  4UP5 A;  1WEW A;  2CSY A;  1CHC A;  5H9M A;  5TAB A;  3PHD A;  1VD4 A;  3L11 A;  4BHW A;  4QF3 A;  4UI9 B;  4BBQ A;  2JRJ A;  2IDA A;  4AVX A;  4A49 A;  3GL6 A;  2XB1 A;  1FBV A;  3ZPV 1;  4LAD B;  5KH9 A;  4GB0 A;  2YT5 A;  3I2D A;  1HYI A;  2YUR A;  2L43 A;  1WEE A;  3L1X A;  4XI1 A;  5D1K B;  4B86 C;  5FER A;  2KGI A;  5EYA F;  2LV9 A;  3ZYQ A;  2G45 A;  2CKL A;  4O64 A;  2ECI A;  4I7B A;  4FO9 A;  4A4B A;  4YC9 A;  3GV4 A;  2L80 A;  4FK5 A;  2YUC A;  2LGV A;  2ZET C;  2KWO A;  5C11 A;  2HYE D;  2VP7 A;  4TKP B;  2H0D A;  4N4F A;  4WZ2 A;  1Z60 A;  2E6S A;  5I3L A;  3M63 A;  5H1T A;  3N9Q A;  2L0B A;  2K4D A;  4YBT A;  4F52 B;  2EOD A;  2VPD A;  2QJ0 A;  2LQ6 A;  2UZG A;  1Z2Q A;  5DKA A;  1WES A;  3PUQ A;  3U5O A;  2ECV A;  4PPE A;  2KIZ A;  4V3K C;  3ZPV E;  3DPL R;  1T1H A;  3O35 A;  2VJF A;  5B75 A;  1G25 A;  2FSA A;  2RSD A;  5LKU A;  4P5O B;  2M6M A;  2YRE A;  4A4C A;  2YW8 A;  2Y1M A;  3QZV A;  1IYM A;  1XWH A;  2LXP C;  4S3O B;  2MA6 A;  2MD8 C;  2F42 A;  2C2L A;  1WFK A;  2KYU A;  1VYX A;  2F6N A;  4LLB A;  2AN6 A;  2ECW A;  3LQJ A;  5TDW A;  2DX8 A;  2LGG A;  2I50 A;  1WE9 A;  5B79 A;  5LCW B;  5AIU A;  4W4U A;  1JM7 A;  4YAX A;  2YHN A;  1WIM A;  4GNE A;  2KFT A;  1HYJ A;  2VJE A;  2YQM A;  4AYC B;  3O33 A;  3LRQ A;  2EA6 A;  5B78 A;  2ECN A;  4YBS A;  1BOR A;  2KWJ A;  2E6R A;  1Z6U A;  3DQV R;  4CCG X;  4FIP A;  3HCS A;  4X3G A;  4QF2 A;  2C2V S;  4I7D A;  4C9Z A;  3V43 A;  4AUQ B;  2JMJ A;  3O7A A;  1X4U A;  5B77 A;  3LQI A;  3LQH A;  4WZ3 B;  2FUU A;  3VK6 A;  2KU3 A;  2NAA A;  2JMD A;  3U5N A;  2L75 A;  4ZQL A;  1ZBD B;  1N87 A;  3KV5 A;  1E4U A;  3SHB A;  1WEP A;  2MD7 B;  3HCT A;  1WEN A;  3N9L A;  1X4I A;  2LDR A;  2KGG A;  2RI7 A;  1WEO A;  5KH3 A;  2VPG A;  2YU4 A;  5D1L B;  2CKL B;  3SOW A;  2LGK A;  2G6Q A;  4LK9 A;  3RPG C;  2MA5 A;  3N9M A;  1LDK C;  3RPG B;  1LDJ B;  4R2Y A;  1MM2 A;  1MM3 A;  4PTB A;  5LKT A;  1JOC A;  2BAY A;  3T6R A;  2KWN A;  3O70 A;  3U5P A;  2CSZ A;  4YAB A;  4WZ0 A;  1WGM A;  2YYR A;  1WEU A;  1F62 A;  5TRB A;  3C6W A;  4IC2 A;  2PUY A;  5B76 A;  2QIZ A;  4FJC A;  2VJF B;  3N9N A;  4GNF A;  4L58 A;  3ZNI A;  1VFY A;  2G43 A;  5KH7 A;  2VPB A;  5B8D A;  2VNF A;  2YSJ A;  3HCU A;  3IHP A;  4NN2 A;  1WEV A;  2HDP A;  5H1U A;  4CA1 A;  2LRI C;  5G05 B;  2KWK A;  2L5U A;  3MHH A;  5AIT A;  2KRE A;  4LJN A;  4MSX A;  4YAT A;  3O36 A;  4V3L C;  5DIN A;  2OXQ C;  2M85 A;  2PNX A;  2K17 A;  4R7E A;  2JMI A;  2QIC A;  4LKA A;  3SOU A;  3M99 A;  3NG2 A;  3C5K A;  4GND A;  1JM7 B;  2MNZ A;  2Y1N A;  1X4J A;  2YHO A;  2XEU A;  3ZVZ B;  2KR4 A;  3KNV A;  3EB6 A;  2MT5 A;  3T7L A;  5FB1 A;  2VJE B;  1U6G B;  4AP4 A;  4L7X A;  2VPE A;  4GNG A;  5J3X A;  4MVT A;  4YAD A;  3U5M A;  5D1M B;  1WEM A;  2D8S A;  3ASL A;  5LKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...