1X4UA

Solution structure of the fyve domain from human fyve domain containing 27 isoform b protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
84
structure length
84
Chain Sequence
GSSGSSGRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the FYVE domain from human FYVE domain containing 27 isoform b protein
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Zinc finger, FYVE domain containing 27 isoform b
total genus 5
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4uA01
5EYAF 2G43A 3O36A 2ECWA 4WZ0A 4YATA 5H9MA 5B76A 3EB6A 3SOXA 3MHSA 4O64A 2VJEB 2YUCA 3L1XA 2LGKA 2YQMA 2KWJA 4A4CA 2JMIA 2YQLA 3U5NA 2MD8C 3M99A 4L58A 3T7LA 2MT5A 1XWHA 2IDAA 3M63A 5B8DA 4QF3A 1JM7B 2L0BA 2KREA 1WEOA 2C2VS 2YYRA 4V3LC 3RTRB 4N3WA 4R8PK 2C2LA 5FERA 2E6SA 4MVTA 4V3KC 2EODA 2M6MA 3N9QA 3N9OA 2D8SA 4S3OB 2FUUA 3SOWA 1FBVA 2LRIC 4FJCA 2JMDA 3RPGB 2H0DB 3ZYQA 3ZPVE 4ZUXU 1V87A 2KU3A 4Q6FA 4ZQLA 2KE1A 3PHDA 5D1KB 4C9ZA 2F6NA 2KGGA 2CKLA 3N9PA 4GNDA 1X4JA 3KNVA 3C6WA 5D1MB 2BAYA 2FSAA 1RMDA 2QIZA 5B79A 2M3HA 4LJNA 3HCTA 1F62A 1WFKA 1WESA 2QICA 1HYJA 2Y1MA 3LQJA 3ASLA 2L5UA 3M62A 3ZVZB 1K2FA 3N9LA 2H0DA 2ECJA 3DQVR 3O7AA 5LKZA 4R2YA 3ZPV1 4WA6A 2KWKA 4WZ3B 4ZDTA 2Y43A 2YT5A 2KR4A 2K1JA 3KQIA 5AITA 3LQHA 5G0FA 4P5OB 3O33A 3C5KA 3LRQA 4I7BA 2EGPA 2MNYA 3ZVYA 1LDJB 2PUYA 2YREA 2YSJA 4W4UA 4UP0A 4B86C 4B7YC 4AP4A 1E4UA 5FB0A 4LADB 4TKPB 5TDWA 3O34A 2VPEA 2YU4A 4FO9A 4XI1A 2G6QA 4IC2A 1VD4A 2LXPC 2M1RA 1Z2QA 4UP5A 5AIUA 2ECGA 2YW8A 4LLBA 5FB1A 1IYMA 2Y1NA 4YBMA 1N87A 2QJ0A 5J3XA 4UI9B 4GNGA 5TRBA 4AVXA 2CKLB 4AUQB 2KYUA 2MA6A 5G04B 3L1ZB 4L7XA 2VJFA 5DINA 3N9MA 5LKXA 1G25A 3U5PA 5FEYA 2ECIA 2OXQC 4CA1A 2E6RA 4YC9A 2LXHC 3KV5A 2JRJA 2LGVA 5C13A 2G45A 1X4UA 2DX8A 4A49A 1WIMA 1FP0A 4LK9A 4YBTA 4LKAA 2FUIA 2VJFB 4NN2A 5H1TA 3SOUA 3O37A 2VNFA 5C11A 3NG2A 2YHNA 1JOCA 3GV4A 2XEUA 2K4DA 3LQIA 1WEQA 4GB0A 5G05B 2F42A 2I50A 3VK6A 2L75A 2KWOA 2KGIA 4PTBA 4CCGX 1BORA 2RSDA 1MM3A 3N9NA 1WENA 3QZVA 4N4FA 5H1VA 1DVPA 2LDRA 3FL2A 2L80A 2HYED 4GNFA 1T1HA 2YSMA 2MA5A 4AYCA 1WEPA 2JMJA 4IC3A 2LGGA 3SHBA 5LKTA 1LDKC 1MM2A 2EA6A 5B77A 3ZNIA 4YBSA 5LCWB 4BHWA 4YABA 4FK5A 1WEVA 3GL6A 2M85A 4PPEA 1Z60A 3PUQA 1WEUA 2K17A 1WEEA 3HCUA 4A0CD 1U6GB 3MHHA 4X3GA 5H1UA 1WEMA 1HYIA 3HCSA 2VJEA 4QF2A 4BBQA 2VP7A 2VPDA 1WE9A 2LV9A 5TDRA 4F52B 2ECNA 3L11A 3ZTGA 5B75A 2LN0A 2UZGA 2CT2A 2MIQA 5TABA 1JM7A 2MNZA 2LGLA 3HTKC 3O35A 5LKUA 2KIZA 2F6JA 4R7EA 1WGMA 3EB5A 5DKAA 1X4IA 5B78A 3T6RA 5KH7A 2LQ6A 4FIPA 2VPBA 4WZ2A 5I3LA 2CSYA 3KV6A 4AYCB 4YAXA 4I7DA 3PURA 1CHCA 2RI7A 1VFYA 2K16A 5KH9A 4GNEA 2KWNA 3U5MA 2ECVA 2PNXA 1WILA 2VPGA 2NAAA 1WEWA 2XB1A 2ZETC 4MSXA 3O70A 2MD7B 5KH3A 4I7CA 3V43A 2HDPA 5D1LB 3RPGC 2ECTA 1VYXA 3IHPA 2KFTA 1ZBDB 4S3OC 5JG6A 4YADA 3I2DA 2YURA 2YHOA 1Z6UA 2AN6A 3U5OA 3DPLR 2CSZA 4A4BA 2L43A 5TBNA 2MUMA
chains in the Genus database with same CATH superfamily
5EYAF 2G43A 3O36A 2ECWA 4WZ0A 4YATA 5H9MA 5SVIA 5B76A 2L7PA 3EB6A 3SOXA 3MHSA 3DWDA 4O64A 2VJEB 2YUCA 3L1XA 2LGKA 4Z0OA 2YQMA 2XOCA 2KWJA 3E2DA 4A4CA 2JMIA 2YQLA 3U5NA 2MD8C 3M99A 4L58A 3T7LA 2MT5A 1XWHA 5SVYA 2IDAA 3M63A 5B8DA 4QF3A 1JM7B 2L0BA 2KREA 1WEOA 2C2VS 2YYRA 4V3LC 3RTRB 4N3WA 4R8PK 2C2LA 5FERA 2FD4A 3MDBC 2E6SA 4MVTA 4V3KC 2EODA 2M6MA 3N9QA 3N9OA 4QQ4A 2D8SA 4S3OB 2FUUA 3SOWA 1FBVA 2LRIC 4FJCA 3KDEC 2JMDA 3RPGB 2H0DB 3ZYQA 3ZPVE 4ZUXU 1V87A 2KU3A 4Q6FA 4ZQLA 2KKYA 2KE1A 5SVXA 3PHDA 5D1KB 4C9ZA 3Q1DA 3FEHA 2F6NA 3T9KA 2KGGA 2CKLA 3N9PA 4GNDA 1X4JA 3KNVA 3C6WA 5D1MB 2BAYA 2FSAA 1RMDA 2QIZA 5B79A 2M3HA 4LJNA 3HCTA 1F62A 1WFKA 1WESA 2QICA 1HYJA 2Y1MA 3LQJA 3ASLA 2L5UA 3M62A 2XOZA 3ZVZB 1K2FA 3N9LA 2H0DA 2ECJA 3DQVR 3O7AA 5LKZA 4R2YA 3ZPV1 4WA6A 2KWKA 4WZ3B 3FANA 4ZDTA 2Y43A 5SVIB 2JM3A 2YT5A 2KR4A 2K1JA 3KQIA 5AITA 3LQHA 5G0FA 4P5OB 3O33A 2P57A 3C5KA 3LRQA 4I7BA 2EGPA 2MNYA 3ZVYA 1LDJB 2EGMA 2PUYA 2YREA 2OWAA 2RR4A 2YSJA 4W4UA 4UP0A 2JUNA 5K3QA 4B86C 4B7YC 3JUEA 4AP4A 1E4UA 5FB0A 4LADB 4TKPB 3PLWA 5TDWA 3O34A 2VPEA 2YU4A 4FO9A 4XI1A 2G6QA 4IC2A 1VD4A 2LXPC 2M1RA 1Z2QA 4UP5A 5AIUA 4H9DA 2ECGA 2YW8A 4OGCA 4LLBA 5FB1A 1IYMA 2Y1NA 4YBMA 1N87A 2QJ0A 5J3XA 2CONA 4UI9B 4GNGA 5TRBA 4AVXA 2CKLB 4AUQB 2KYUA 2MA6A 5G04B 3L1ZB 4L7XA 2VJFA 5DINA 3N9MA 5LKXA 3FM8C 1G25A 3U5PA 5FEYA 2ECIA 2OXQC 4O62A 4CA1A 2E6RA 4YC9A 2LXHC 2EXUA 3KV5A 2JRJA 4F1PA 1MBMA 2LGVA 5C13A 1X4UA 2G45A 2MKEA 2DX8A 4OGEA 4A49A 1WIMA 1FP0A 4LK9A 4YBTA 4LKAA 2FUIA 2VJFB 4NN2A 5H1TA 3SOUA 3SUBA 3O37A 2VNFA 5C11A 3NG2A 2YHNA 1JOCA 3GV4A 2XEUA 2K4DA 4Z0RA 3LQIA 1WEQA 2CSVA 4GB0A 5G05B 2F42A 2I50A 3VK6A 2L75A 2KWOA 2KGIA 4PTBA 4CCGX 2CRRA 1BORA 2RSDA 1MM3A 3N9NA 1WENA 3QZVA 4N4FA 5H1VA 3O47A 1DVPA 2LDRA 3FL2A 3LVRE 2L80A 2HYED 4GNFA 1T1HA 2YSMA 2MA5A 4AYCA 1WEPA 2JMJA 4IC3A 2LGGA 3SHBA 5LKTA 1LDKC 1MM2A 2EA6A 5B77A 3ZNIA 4YBSA 5LCWB 4BHWA 2YVRA 4YABA 2XP0A 2B0OE 1WEVA 4FK5A 3GL6A 3DDTA 2DSMA 2M85A 4PPEA 1Z60A 2DJAA 3PUQA 2D8UA 1WEUA 2K17A 1WEEA 3HCUA 4A0CD 1U6GB 2M13A 3MHHA 4X3GA 2FFWA 5H1UA 1WEMA 1HYIA 3HCSA 2VJEA 4QF2A 2KKXA 4BBQA 2VP7A 2VPDA 1WE9A 2LV9A 5TDRA 4F52B 2ECNA 3L11A 3ZTGA 5B75A 2IQJA 2LN0A 2UZGA 2CT2A 2MIQA 5TABA 1JM7A 2MNZA 2LGLA 3HTKC 3O35A 5LKUA 3M7KA 2KIZA 2F6JA 4R7EA 1WGMA 3EB5A 5DKAA 1X4IA 5B78A 3T6RA 5KH7A 3FAOA 2LQ6A 4FIPA 2VPBA 2CRWA 4WZ2A 5I3LA 2CSYA 3KV6A 4AYCB 4YAXA 4I7DA 3PURA 2E61A 2LAUA 1CHCA 2RI7A 1VFYA 2K16A 5KH9A 4GNEA 2KWNA 3U5MA 2ECVA 2PNXA 1WILA 3LDYA 2VPGA 3LVQE 2NAAA 1WEWA 2XB1A 2ZETC 4MSXA 3H7HA 3O70A 2MD7B 5KH3A 4I7CA 3V43A 2HDPA 5D1LB 3RPGC 2ECTA 1VYXA 3IHPA 2KFTA 1ZBDB 4S3OC 5JG6A 4YADA 3I2DA 3LJUX 2YURA 2YHOA 3FJUB 1Z6UA 2AN6A 3U5OA 2XOYA 3DPLR 2CSZA 4A4BA 2L43A 5TBNA 1DCQA 2MUMA
chains in the Genus database with same CATH topology
5EYAF 2G43A 3O36A 2ECWA 4WZ0A 4YATA 5H9MA 5B76A 3EB6A 3SOXA 3MHSA 4O64A 2VJEB 2YUCA 3L1XA 2LGKA 2YQMA 2KWJA 4A4CA 2JMIA 2YQLA 3U5NA 2MD8C 3M99A 4L58A 3T7LA 2MT5A 1XWHA 2IDAA 3M63A 5B8DA 4QF3A 1JM7B 2L0BA 2KREA 1WEOA 2C2VS 2YYRA 4V3LC 3RTRB 4N3WA 4R8PK 2C2LA 5FERA 2E6SA 4MVTA 4V3KC 2EODA 2M6MA 3N9QA 3N9OA 2D8SA 4S3OB 2FUUA 3SOWA 1FBVA 2LRIC 4FJCA 2JMDA 3RPGB 2H0DB 3ZYQA 3ZPVE 4ZUXU 1V87A 2KU3A 4Q6FA 4ZQLA 2KE1A 3PHDA 5D1KB 4C9ZA 2F6NA 2KGGA 2CKLA 3N9PA 4GNDA 1X4JA 3KNVA 3C6WA 5D1MB 2BAYA 2FSAA 1RMDA 2QIZA 5B79A 2M3HA 4LJNA 3HCTA 1F62A 1WFKA 1WESA 2QICA 1HYJA 2Y1MA 3LQJA 3ASLA 2L5UA 3M62A 3ZVZB 1K2FA 3N9LA 2H0DA 2ECJA 3DQVR 3O7AA 5LKZA 4R2YA 3ZPV1 4WA6A 2KWKA 4WZ3B 4ZDTA 2Y43A 2YT5A 2KR4A 2K1JA 3KQIA 5AITA 3LQHA 5G0FA 4P5OB 3O33A 3C5KA 3LRQA 4I7BA 2EGPA 2MNYA 3ZVYA 1LDJB 2PUYA 2YREA 2YSJA 4W4UA 4UP0A 4B86C 4B7YC 4AP4A 1E4UA 5FB0A 4LADB 4TKPB 5TDWA 3O34A 2VPEA 2YU4A 4FO9A 4XI1A 2G6QA 4IC2A 1VD4A 2LXPC 2M1RA 1Z2QA 4UP5A 5AIUA 2ECGA 2YW8A 4LLBA 5FB1A 1IYMA 2Y1NA 4YBMA 1N87A 2QJ0A 5J3XA 4UI9B 4GNGA 5TRBA 4AVXA 2CKLB 4AUQB 2KYUA 2MA6A 5G04B 3L1ZB 4L7XA 2VJFA 5DINA 3N9MA 5LKXA 1G25A 3U5PA 5FEYA 2ECIA 2OXQC 4CA1A 2E6RA 4YC9A 2LXHC 3KV5A 2JRJA 2LGVA 5C13A 2G45A 1X4UA 2DX8A 4A49A 1WIMA 1FP0A 4LK9A 4YBTA 4LKAA 2FUIA 2VJFB 4NN2A 5H1TA 3SOUA 3O37A 2VNFA 5C11A 3NG2A 2YHNA 1JOCA 3GV4A 2XEUA 2K4DA 3LQIA 1WEQA 4GB0A 5G05B 2F42A 2I50A 3VK6A 2L75A 2KWOA 2KGIA 4PTBA 4CCGX 1BORA 2RSDA 1MM3A 3N9NA 1WENA 3QZVA 4N4FA 5H1VA 1DVPA 2LDRA 3FL2A 2L80A 2HYED 4GNFA 1T1HA 2YSMA 2MA5A 4AYCA 1WEPA 2JMJA 4IC3A 2LGGA 3SHBA 5LKTA 1LDKC 1MM2A 2EA6A 5B77A 3ZNIA 4YBSA 5LCWB 4BHWA 4YABA 4FK5A 1WEVA 3GL6A 2M85A 4PPEA 1Z60A 3PUQA 1WEUA 2K17A 1WEEA 3HCUA 4A0CD 1U6GB 3MHHA 4X3GA 5H1UA 1WEMA 1HYIA 3HCSA 2VJEA 4QF2A 4BBQA 2VP7A 2VPDA 1WE9A 2LV9A 5TDRA 4F52B 2ECNA 3L11A 3ZTGA 5B75A 2LN0A 2UZGA 2CT2A 2MIQA 5TABA 1JM7A 2MNZA 2LGLA 3HTKC 3O35A 5LKUA 2KIZA 2F6JA 4R7EA 1WGMA 3EB5A 5DKAA 1X4IA 5B78A 3T6RA 5KH7A 2LQ6A 4FIPA 2VPBA 4WZ2A 5I3LA 2CSYA 3KV6A 4AYCB 4YAXA 4I7DA 3PURA 1CHCA 2RI7A 1VFYA 2K16A 5KH9A 4GNEA 2KWNA 3U5MA 2ECVA 2PNXA 1WILA 2VPGA 2NAAA 1WEWA 2XB1A 2ZETC 4MSXA 3O70A 2MD7B 5KH3A 4I7CA 3V43A 2HDPA 5D1LB 3RPGC 2ECTA 1VYXA 3IHPA 2KFTA 1ZBDB 4S3OC 5JG6A 4YADA 3I2DA 2YURA 2YHOA 1Z6UA 2AN6A 3U5OA 3DPLR 2CSZA 4A4BA 2L43A 5TBNA 2MUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EYA F;  2G43 A;  3O36 A;  2ECW A;  4WZ0 A;  4YAT A;  5H9M A;  5B76 A;  3EB6 A;  3SOX A;  3MHS A;  4O64 A;  2VJE B;  2YUC A;  3L1X A;  2LGK A;  2YQM A;  2KWJ A;  4A4C A;  2JMI A;  2YQL A;  3U5N A;  2MD8 C;  3M99 A;  4L58 A;  3T7L A;  2MT5 A;  1XWH A;  2IDA A;  3M63 A;  5B8D A;  4QF3 A;  1JM7 B;  2L0B A;  2KRE A;  1WEO A;  2C2V S;  2YYR A;  4V3L C;  3RTR B;  4N3W A;  4R8P K;  2C2L A;  5FER A;  2E6S A;  4MVT A;  4V3K C;  2EOD A;  2M6M A;  3N9Q A;  3N9O A;  2D8S A;  4S3O B;  2FUU A;  3SOW A;  1FBV A;  2LRI C;  4FJC A;  2JMD A;  3RPG B;  2H0D B;  3ZYQ A;  3ZPV E;  4ZUX U;  1V87 A;  2KU3 A;  4Q6F A;  4ZQL A;  2KE1 A;  3PHD A;  5D1K B;  4C9Z A;  2F6N A;  2KGG A;  2CKL A;  3N9P A;  4GND A;  1X4J A;  3KNV A;  3C6W A;  5D1M B;  2BAY A;  2FSA A;  1RMD A;  2QIZ A;  5B79 A;  2M3H A;  4LJN A;  3HCT A;  1F62 A;  1WFK A;  1WES A;  2QIC A;  1HYJ A;  2Y1M A;  3LQJ A;  3ASL A;  2L5U A;  3M62 A;  3ZVZ B;  1K2F A;  3N9L A;  2H0D A;  2ECJ A;  3DQV R;  3O7A A;  5LKZ A;  4R2Y A;  3ZPV 1;  4WA6 A;  2KWK A;  4WZ3 B;  4ZDT A;  2Y43 A;  2YT5 A;  2KR4 A;  2K1J A;  3KQI A;  5AIT A;  3LQH A;  5G0F A;  4P5O B;  3O33 A;  3C5K A;  3LRQ A;  4I7B A;  2EGP A;  2MNY A;  3ZVY A;  1LDJ B;  2PUY A;  2YRE A;  2YSJ A;  4W4U A;  4UP0 A;  4B86 C;  4B7Y C;  4AP4 A;  1E4U A;  5FB0 A;  4LAD B;  4TKP B;  5TDW A;  3O34 A;  2VPE A;  2YU4 A;  4FO9 A;  4XI1 A;  2G6Q A;  4IC2 A;  1VD4 A;  2LXP C;  2M1R A;  1Z2Q A;  4UP5 A;  5AIU A;  2ECG A;  2YW8 A;  4LLB A;  5FB1 A;  1IYM A;  2Y1N A;  4YBM A;  1N87 A;  2QJ0 A;  5J3X A;  4UI9 B;  4GNG A;  5TRB A;  4AVX A;  2CKL B;  4AUQ B;  2KYU A;  2MA6 A;  5G04 B;  3L1Z B;  4L7X A;  2VJF A;  5DIN A;  3N9M A;  5LKX A;  1G25 A;  3U5P A;  5FEY A;  2ECI A;  2OXQ C;  4CA1 A;  2E6R A;  4YC9 A;  2LXH C;  3KV5 A;  2JRJ A;  2LGV A;  5C13 A;  2G45 A;  1X4U A;  2DX8 A;  4A49 A;  1WIM A;  1FP0 A;  4LK9 A;  4YBT A;  4LKA A;  2FUI A;  2VJF B;  4NN2 A;  5H1T A;  3SOU A;  3O37 A;  2VNF A;  5C11 A;  3NG2 A;  2YHN A;  1JOC A;  3GV4 A;  2XEU A;  2K4D A;  3LQI A;  1WEQ A;  4GB0 A;  5G05 B;  2F42 A;  2I50 A;  3VK6 A;  2L75 A;  2KWO A;  2KGI A;  4PTB A;  4CCG X;  1BOR A;  2RSD A;  1MM3 A;  3N9N A;  1WEN A;  3QZV A;  4N4F A;  5H1V A;  1DVP A;  2LDR A;  3FL2 A;  2L80 A;  2HYE D;  4GNF A;  1T1H A;  2YSM A;  2MA5 A;  4AYC A;  1WEP A;  2JMJ A;  4IC3 A;  2LGG A;  3SHB A;  5LKT A;  1LDK C;  1MM2 A;  2EA6 A;  5B77 A;  3ZNI A;  4YBS A;  5LCW B;  4BHW A;  4YAB A;  4FK5 A;  1WEV A;  3GL6 A;  2M85 A;  4PPE A;  1Z60 A;  3PUQ A;  1WEU A;  2K17 A;  1WEE A;  3HCU A;  4A0C D;  1U6G B;  3MHH A;  4X3G A;  5H1U A;  1WEM A;  1HYI A;  3HCS A;  2VJE A;  4QF2 A;  4BBQ A;  2VP7 A;  2VPD A;  1WE9 A;  2LV9 A;  5TDR A;  4F52 B;  2ECN A;  3L11 A;  3ZTG A;  5B75 A;  2LN0 A;  2UZG A;  2CT2 A;  2MIQ A;  5TAB A;  1JM7 A;  2MNZ A;  2LGL A;  3HTK C;  3O35 A;  5LKU A;  2KIZ A;  2F6J A;  4R7E A;  1WGM A;  3EB5 A;  5DKA A;  1X4I A;  5B78 A;  3T6R A;  5KH7 A;  2LQ6 A;  4FIP A;  2VPB A;  4WZ2 A;  5I3L A;  2CSY A;  3KV6 A;  4AYC B;  4YAX A;  4I7D A;  3PUR A;  1CHC A;  2RI7 A;  1VFY A;  2K16 A;  5KH9 A;  4GNE A;  2KWN A;  3U5M A;  2ECV A;  2PNX A;  1WIL A;  2VPG A;  2NAA A;  1WEW A;  2XB1 A;  2ZET C;  4MSX A;  3O70 A;  2MD7 B;  5KH3 A;  4I7C A;  3V43 A;  2HDP A;  5D1L B;  3RPG C;  2ECT A;  1VYX A;  3IHP A;  2KFT A;  1ZBD B;  4S3O C;  5JG6 A;  4YAD A;  3I2D A;  2YUR A;  2YHO A;  1Z6U A;  2AN6 A;  3U5O A;  3DPL R;  2CSZ A;  4A4B A;  2L43 A;  5TBN A;  2MUM A; 
#chains in the Genus database with same CATH topology
 5EYA F;  2G43 A;  3O36 A;  2ECW A;  4WZ0 A;  4YAT A;  5H9M A;  5SVI A;  5B76 A;  2L7P A;  3EB6 A;  3SOX A;  3MHS A;  3DWD A;  4O64 A;  2VJE B;  2YUC A;  3L1X A;  2LGK A;  4Z0O A;  2YQM A;  2XOC A;  2KWJ A;  3E2D A;  4A4C A;  2JMI A;  2YQL A;  3U5N A;  2MD8 C;  3M99 A;  4L58 A;  3T7L A;  2MT5 A;  1XWH A;  5SVY A;  2IDA A;  3M63 A;  5B8D A;  4QF3 A;  1JM7 B;  2L0B A;  2KRE A;  1WEO A;  2C2V S;  2YYR A;  4V3L C;  3RTR B;  4N3W A;  4R8P K;  2C2L A;  5FER A;  2FD4 A;  3MDB C;  2E6S A;  4MVT A;  4V3K C;  2EOD A;  2M6M A;  3N9Q A;  3N9O A;  4QQ4 A;  2D8S A;  4S3O B;  2FUU A;  3SOW A;  1FBV A;  2LRI C;  4FJC A;  3KDE C;  2JMD A;  3RPG B;  2H0D B;  3ZYQ A;  3ZPV E;  4ZUX U;  1V87 A;  2KU3 A;  4Q6F A;  4ZQL A;  2KKY A;  2KE1 A;  5SVX A;  3PHD A;  5D1K B;  4C9Z A;  3Q1D A;  3FEH A;  2F6N A;  3T9K A;  2KGG A;  2CKL A;  3N9P A;  4GND A;  1X4J A;  3KNV A;  3C6W A;  5D1M B;  2BAY A;  2FSA A;  1RMD A;  2QIZ A;  5B79 A;  2M3H A;  4LJN A;  3HCT A;  1F62 A;  1WFK A;  1WES A;  2QIC A;  1HYJ A;  2Y1M A;  3LQJ A;  3ASL A;  2L5U A;  3M62 A;  2XOZ A;  3ZVZ B;  1K2F A;  3N9L A;  2H0D A;  2ECJ A;  3DQV R;  3O7A A;  5LKZ A;  4R2Y A;  3ZPV 1;  4WA6 A;  2KWK A;  4WZ3 B;  3FAN A;  4ZDT A;  2Y43 A;  5SVI B;  2JM3 A;  2YT5 A;  2KR4 A;  2K1J A;  3KQI A;  5AIT A;  3LQH A;  5G0F A;  4P5O B;  3O33 A;  2P57 A;  3C5K A;  3LRQ A;  4I7B A;  2EGP A;  2MNY A;  3ZVY A;  1LDJ B;  2EGM A;  2PUY A;  2YRE A;  2OWA A;  2RR4 A;  2YSJ A;  4W4U A;  4UP0 A;  2JUN A;  5K3Q A;  4B86 C;  4B7Y C;  3JUE A;  4AP4 A;  1E4U A;  5FB0 A;  4LAD B;  4TKP B;  3PLW A;  5TDW A;  3O34 A;  2VPE A;  2YU4 A;  4FO9 A;  4XI1 A;  2G6Q A;  4IC2 A;  1VD4 A;  2LXP C;  2M1R A;  1Z2Q A;  4UP5 A;  5AIU A;  4H9D A;  2ECG A;  2YW8 A;  4OGC A;  4LLB A;  5FB1 A;  1IYM A;  2Y1N A;  4YBM A;  1N87 A;  2QJ0 A;  5J3X A;  2CON A;  4UI9 B;  4GNG A;  5TRB A;  4AVX A;  2CKL B;  4AUQ B;  2KYU A;  2MA6 A;  5G04 B;  3L1Z B;  4L7X A;  2VJF A;  5DIN A;  3N9M A;  5LKX A;  3FM8 C;  1G25 A;  3U5P A;  5FEY A;  2ECI A;  2OXQ C;  4O62 A;  4CA1 A;  2E6R A;  4YC9 A;  2LXH C;  2EXU A;  3KV5 A;  2JRJ A;  4F1P A;  1MBM A;  2LGV A;  5C13 A;  1X4U A;  2G45 A;  2MKE A;  2DX8 A;  4OGE A;  4A49 A;  1WIM A;  1FP0 A;  4LK9 A;  4YBT A;  4LKA A;  2FUI A;  2VJF B;  4NN2 A;  5H1T A;  3SOU A;  3SUB A;  3O37 A;  2VNF A;  5C11 A;  3NG2 A;  2YHN A;  1JOC A;  3GV4 A;  2XEU A;  2K4D A;  4Z0R A;  3LQI A;  1WEQ A;  2CSV A;  4GB0 A;  5G05 B;  2F42 A;  2I50 A;  3VK6 A;  2L75 A;  2KWO A;  2KGI A;  4PTB A;  4CCG X;  2CRR A;  1BOR A;  2RSD A;  1MM3 A;  3N9N A;  1WEN A;  3QZV A;  4N4F A;  5H1V A;  3O47 A;  1DVP A;  2LDR A;  3FL2 A;  3LVR E;  2L80 A;  2HYE D;  4GNF A;  1T1H A;  2YSM A;  2MA5 A;  4AYC A;  1WEP A;  2JMJ A;  4IC3 A;  2LGG A;  3SHB A;  5LKT A;  1LDK C;  1MM2 A;  2EA6 A;  5B77 A;  3ZNI A;  4YBS A;  5LCW B;  4BHW A;  2YVR A;  4YAB A;  2XP0 A;  2B0O E;  1WEV A;  4FK5 A;  3GL6 A;  3DDT A;  2DSM A;  2M85 A;  4PPE A;  1Z60 A;  2DJA A;  3PUQ A;  2D8U A;  1WEU A;  2K17 A;  1WEE A;  3HCU A;  4A0C D;  1U6G B;  2M13 A;  3MHH A;  4X3G A;  2FFW A;  5H1U A;  1WEM A;  1HYI A;  3HCS A;  2VJE A;  4QF2 A;  2KKX A;  4BBQ A;  2VP7 A;  2VPD A;  1WE9 A;  2LV9 A;  5TDR A;  4F52 B;  2ECN A;  3L11 A;  3ZTG A;  5B75 A;  2IQJ A;  2LN0 A;  2UZG A;  2CT2 A;  2MIQ A;  5TAB A;  1JM7 A;  2MNZ A;  2LGL A;  3HTK C;  3O35 A;  5LKU A;  3M7K A;  2KIZ A;  2F6J A;  4R7E A;  1WGM A;  3EB5 A;  5DKA A;  1X4I A;  5B78 A;  3T6R A;  5KH7 A;  3FAO A;  2LQ6 A;  4FIP A;  2VPB A;  2CRW A;  4WZ2 A;  5I3L A;  2CSY A;  3KV6 A;  4AYC B;  4YAX A;  4I7D A;  3PUR A;  2E61 A;  2LAU A;  1CHC A;  2RI7 A;  1VFY A;  2K16 A;  5KH9 A;  4GNE A;  2KWN A;  3U5M A;  2ECV A;  2PNX A;  1WIL A;  3LDY A;  2VPG A;  3LVQ E;  2NAA A;  1WEW A;  2XB1 A;  2ZET C;  4MSX A;  3H7H A;  3O70 A;  2MD7 B;  5KH3 A;  4I7C A;  3V43 A;  2HDP A;  5D1L B;  3RPG C;  2ECT A;  1VYX A;  3IHP A;  2KFT A;  1ZBD B;  4S3O C;  5JG6 A;  4YAD A;  3I2D A;  3LJU X;  2YUR A;  2YHO A;  3FJU B;  1Z6U A;  2AN6 A;  3U5O A;  2XOY A;  3DPL R;  2CSZ A;  4A4B A;  2L43 A;  5TBN A;  1DCQ A;  2MUM A; 
#chains in the Genus database with same CATH homology
 5EYA F;  2G43 A;  3O36 A;  2ECW A;  4WZ0 A;  4YAT A;  5H9M A;  5B76 A;  3EB6 A;  3SOX A;  3MHS A;  4O64 A;  2VJE B;  2YUC A;  3L1X A;  2LGK A;  2YQM A;  2KWJ A;  4A4C A;  2JMI A;  2YQL A;  3U5N A;  2MD8 C;  3M99 A;  4L58 A;  3T7L A;  2MT5 A;  1XWH A;  2IDA A;  3M63 A;  5B8D A;  4QF3 A;  1JM7 B;  2L0B A;  2KRE A;  1WEO A;  2C2V S;  2YYR A;  4V3L C;  3RTR B;  4N3W A;  4R8P K;  2C2L A;  5FER A;  2E6S A;  4MVT A;  4V3K C;  2EOD A;  2M6M A;  3N9Q A;  3N9O A;  2D8S A;  4S3O B;  2FUU A;  3SOW A;  1FBV A;  2LRI C;  4FJC A;  2JMD A;  3RPG B;  2H0D B;  3ZYQ A;  3ZPV E;  4ZUX U;  1V87 A;  2KU3 A;  4Q6F A;  4ZQL A;  2KE1 A;  3PHD A;  5D1K B;  4C9Z A;  2F6N A;  2KGG A;  2CKL A;  3N9P A;  4GND A;  1X4J A;  3KNV A;  3C6W A;  5D1M B;  2BAY A;  2FSA A;  1RMD A;  2QIZ A;  5B79 A;  2M3H A;  4LJN A;  3HCT A;  1F62 A;  1WFK A;  1WES A;  2QIC A;  1HYJ A;  2Y1M A;  3LQJ A;  3ASL A;  2L5U A;  3M62 A;  3ZVZ B;  1K2F A;  3N9L A;  2H0D A;  2ECJ A;  3DQV R;  3O7A A;  5LKZ A;  4R2Y A;  3ZPV 1;  4WA6 A;  2KWK A;  4WZ3 B;  4ZDT A;  2Y43 A;  2YT5 A;  2KR4 A;  2K1J A;  3KQI A;  5AIT A;  3LQH A;  5G0F A;  4P5O B;  3O33 A;  3C5K A;  3LRQ A;  4I7B A;  2EGP A;  2MNY A;  3ZVY A;  1LDJ B;  2PUY A;  2YRE A;  2YSJ A;  4W4U A;  4UP0 A;  4B86 C;  4B7Y C;  4AP4 A;  1E4U A;  5FB0 A;  4LAD B;  4TKP B;  5TDW A;  3O34 A;  2VPE A;  2YU4 A;  4FO9 A;  4XI1 A;  2G6Q A;  4IC2 A;  1VD4 A;  2LXP C;  2M1R A;  1Z2Q A;  4UP5 A;  5AIU A;  2ECG A;  2YW8 A;  4LLB A;  5FB1 A;  1IYM A;  2Y1N A;  4YBM A;  1N87 A;  2QJ0 A;  5J3X A;  4UI9 B;  4GNG A;  5TRB A;  4AVX A;  2CKL B;  4AUQ B;  2KYU A;  2MA6 A;  5G04 B;  3L1Z B;  4L7X A;  2VJF A;  5DIN A;  3N9M A;  5LKX A;  1G25 A;  3U5P A;  5FEY A;  2ECI A;  2OXQ C;  4CA1 A;  2E6R A;  4YC9 A;  2LXH C;  3KV5 A;  2JRJ A;  2LGV A;  5C13 A;  2G45 A;  1X4U A;  2DX8 A;  4A49 A;  1WIM A;  1FP0 A;  4LK9 A;  4YBT A;  4LKA A;  2FUI A;  2VJF B;  4NN2 A;  5H1T A;  3SOU A;  3O37 A;  2VNF A;  5C11 A;  3NG2 A;  2YHN A;  1JOC A;  3GV4 A;  2XEU A;  2K4D A;  3LQI A;  1WEQ A;  4GB0 A;  5G05 B;  2F42 A;  2I50 A;  3VK6 A;  2L75 A;  2KWO A;  2KGI A;  4PTB A;  4CCG X;  1BOR A;  2RSD A;  1MM3 A;  3N9N A;  1WEN A;  3QZV A;  4N4F A;  5H1V A;  1DVP A;  2LDR A;  3FL2 A;  2L80 A;  2HYE D;  4GNF A;  1T1H A;  2YSM A;  2MA5 A;  4AYC A;  1WEP A;  2JMJ A;  4IC3 A;  2LGG A;  3SHB A;  5LKT A;  1LDK C;  1MM2 A;  2EA6 A;  5B77 A;  3ZNI A;  4YBS A;  5LCW B;  4BHW A;  4YAB A;  4FK5 A;  1WEV A;  3GL6 A;  2M85 A;  4PPE A;  1Z60 A;  3PUQ A;  1WEU A;  2K17 A;  1WEE A;  3HCU A;  4A0C D;  1U6G B;  3MHH A;  4X3G A;  5H1U A;  1WEM A;  1HYI A;  3HCS A;  2VJE A;  4QF2 A;  4BBQ A;  2VP7 A;  2VPD A;  1WE9 A;  2LV9 A;  5TDR A;  4F52 B;  2ECN A;  3L11 A;  3ZTG A;  5B75 A;  2LN0 A;  2UZG A;  2CT2 A;  2MIQ A;  5TAB A;  1JM7 A;  2MNZ A;  2LGL A;  3HTK C;  3O35 A;  5LKU A;  2KIZ A;  2F6J A;  4R7E A;  1WGM A;  3EB5 A;  5DKA A;  1X4I A;  5B78 A;  3T6R A;  5KH7 A;  2LQ6 A;  4FIP A;  2VPB A;  4WZ2 A;  5I3L A;  2CSY A;  3KV6 A;  4AYC B;  4YAX A;  4I7D A;  3PUR A;  1CHC A;  2RI7 A;  1VFY A;  2K16 A;  5KH9 A;  4GNE A;  2KWN A;  3U5M A;  2ECV A;  2PNX A;  1WIL A;  2VPG A;  2NAA A;  1WEW A;  2XB1 A;  2ZET C;  4MSX A;  3O70 A;  2MD7 B;  5KH3 A;  4I7C A;  3V43 A;  2HDP A;  5D1L B;  3RPG C;  2ECT A;  1VYX A;  3IHP A;  2KFT A;  1ZBD B;  4S3O C;  5JG6 A;  4YAD A;  3I2D A;  2YUR A;  2YHO A;  1Z6U A;  2AN6 A;  3U5O A;  3DPL R;  2CSZ A;  4A4B A;  2L43 A;  5TBN A;  2MUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...