2JM3A

Solution structure of the thap domain from c. elegans c-terminal binding protein (ctbp)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
GSMPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the THAP domain from Caenorhabditis elegans C-terminal binding protein (CtBP).
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Metal binding protein
molecule keywords Hypothetical protein
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.180 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2jm3A00
2LAUA 3KDEC 2JM3A
chains in the Genus database with same CATH superfamily
2M6MA 2Y1NA 4LK9A 4PPEA 1V87A 2LAUA 3KDEC 3DPLR 4MSXA 2K16A 2L80A 2E61A 2MA5A 3IHPA 4WA6A 2VPBA 1WEVA 2JRJA 5B76A 4OGCA 2M13A 2KWNA 5SVIB 2MA6A 2IQJA 2HDPA 2MD8C 5G05B 3LVRE 1WIMA 3H7HA 2RI7A 5FERA 1JM7A 2KGIA 5B78A 4FK5A 3I2DA 3ZVZB 2LDRA 3PLWA 3T7LA 4A0CD 3LDYA 4IC2A 4R8PK 4L7XA 5FEYA 3SHBA 2G6QA 1WEUA 2PNXA 2CSZA 2RR4A 1WE9A 3T6RA 4LADB 1U6GB 3U5MA 1DVPA 4I7BA 1Z6UA 2KE1A 1IYMA 2JM3A 3U5OA 1JM7B 5B8DA 2KWJA 2XOZA 2CONA 5JG6A 3QZVA 1E4UA 4WZ2A 4S3OB 5TDWA 2FUIA 5LKXA 3LRQA 4B7YC 4R7EA 2ECIA 3O37A 2LGKA 2KFTA 3SOXA 4X3GA 2E6SA 3KQIA 5KH3A 3C5KA 4AYCA 1WEEA 2VNFA 3E2DA 2ECGA 3KNVA 4I7DA 2G43A 1LDJB 2XOCA 3JUEA 2YQMA 4AUQB 2YHNA 3M7KA 2BAYA 1WEWA 2P57A 2UZGA 2JMJA 3ZPVE 3M62A 4GB0A 2Y43A 2ECJA 2LGGA 5B77A 2LQ6A 3L11A 4I7CA 2E6RA 2LRIC 3ZYQA 1FBVA 2AN6A 3LQJA 4XI1A 2CKLB 2MNYA 3N9NA 2KWKA 4N3WA 2LN0A 4YBMA 4Z0RA 2KR4A 2B0OE 4BBQA 1HYJA 4PTBA 5LKZA 5C11A 4A4CA 3U5NA 2LV9A 2K1JA 2QIZA 3PURA 4QF3A 3ASLA 4UI9B 5SVXA 5AITA 3N9LA 3FAOA 3DDTA 3LVQE 3N9OA 2CKLA 2KU3A 2ECVA 2JUNA 2XP0A 4YBTA 1WGMA 3HCUA 2LXHC 3LJUX 2PUYA 1K2FA 2KYUA 2MT5A 2L5UA 2OXQC 4B86C 3L1ZB 4AVXA 2YREA 1LDKC 2ECWA 2EXUA 3FL2A 5J3XA 5H9MA 3PUQA 1F62A 2YW8A 2VPGA 4QF2A 3RPGB 5SVYA 2MUMA 1ZBDB 2XOYA 4GNGA 3HTKC 5LKUA 5G04B 1N87A 2FUUA 2RSDA 2DX8A 2D8SA 3ZTGA 4IC3A 2KWOA 1VYXA 2EGPA 3O70A 2YQLA 4MVTA 5FB0A 5KH7A 4C9ZA 3RPGC 2CSVA 2YHOA 3O47A 3FEHA 2LGVA 4ZDTA 2YUCA 2VPEA 4ZUXU 1FP0A 4A49A 2KKYA 2XB1A 2M85A 3N9PA 2KKXA 3FM8C 2VP7A 4L58A 2I50A 3VK6A 4GNEA 2KIZA 3KV5A 2F6NA 4AP4A 5TABA 2JMDA 4TKPB 2EA6A 5B75A 2JMIA 2KGGA 3LQHA 2QICA 5B79A 3M63A 2DSMA 3DWDA 3GL6A 1HYIA 1Z2QA 4FO9A 1VD4A 3GV4A 5SVIA 2ZETC 4F1PA 3L1XA 3LQIA 3O34A 1WEPA 3ZVYA 1WEOA 1G25A 2QJ0A 4LKAA 4H9DA 3RTRB 3HCSA 5TDRA 5C13A 2VJFB 3SUBA 5TBNA 5D1LB 2KREA 4O62A 3PHDA 2CT2A 4ZQLA 5K3QA 1T1HA 2DJAA 4Z0OA 3FJUB 2H0DB 5KH9A 3O36A 4FJCA 5TRBA 2M3HA 2FSAA 2MNZA 1MBMA 3SOUA 1XWHA 5EYAF 2K4DA 1BORA 1WILA 3O33A 2VPDA 2Y1MA 4GNFA 4UP5A 4O64A 2K17A 5DINA 3EB5A 4YC9A 2L75A 2L7PA 2YYRA 4W4UA 2H0DA 1JOCA 2CSYA 1WFKA 4N4FA 3T9KA 4UP0A 3NG2A 3SOWA 3Q1DA 5H1UA 3O35A 2F42A 4YBSA 1Z60A 4YADA 4P5OB 3ZPV1 3KV6A 2ECTA 3O7AA 1X4UA 4S3OC 5LCWB 4YATA 1WENA 2FD4A 2M1RA 1MM3A 1MM2A 2YSMA 4F52B 3HCTA 4BHWA 1X4IA 3N9QA 5D1MB 2CRWA 2XEUA 4AYCB 4FIPA 2NAAA 2LGLA 2L43A 3N9MA 2YURA 2D8UA 5H1VA 1CHCA 2EGMA 4LLBA 4NN2A 2L0BA 1X4JA 4A4BA 4YABA 3FANA 4CCGX 2VJEB 4YAXA 4CA1A 3C6WA 2C2LA 2MIQA 5FB1A 1VFYA 2YT5A 4R2YA 2IDAA 4Q6FA 4WZ0A 4QQ4A 1WEQA 5AIUA 5H1TA 2OWAA 2ECNA 4V3LC 5I3LA 3ZNIA 2C2VS 3MHHA 5D1KB 5LKTA 2YVRA 3DQVR 5DKAA 4GNDA 1WEMA 3MDBC 2VJEA 2YU4A 5G0FA 1RMDA 2LXPC 4WZ3B 2HYED 3U5PA 2FFWA 4OGEA 4V3KC 4LJNA 2G45A 2MD7B 2YSJA 2EODA 2MKEA 1WESA 3EB6A 3MHSA 2CRRA 3V43A 2F6JA 3M99A 1DCQA 2VJFA
chains in the Genus database with same CATH topology
4QQ4A 2JUNA 2XP0A 5SVIA 2KKYA 2FD4A 4F1PA 3LJUX 5K3QA 2KKXA 3PLWA 1DCQA 2L7PA 2LAUA 2DJAA 3E2DA 3KDEC 3FM8C 2JM3A 2FFWA 2OWAA 3FJUB 4OGEA 4Z0OA 3LDYA 2E61A 2YREA 2EXUA 2XOZA 2CONA 3T9KA 2XOCA 5SVXA 3Q1DA 2MKEA 3JUEA 4OGCA 2CRWA 4H9DA 2M13A 2YVRA 3M7KA 5SVIB 3SUBA 2IQJA 2P57A 4Z0RA 3DDTA 3MDBC 2CRRA 2CSVA 4O62A 3LVQE 3LVRE 2D8UA 2B0OE 3FEHA 3O47A 3DWDA 2RR4A 3H7HA 5SVYA 2EGMA 2XOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LAU A;  3KDE C;  2JM3 A; 
#chains in the Genus database with same CATH topology
 2M6M A;  2Y1N A;  4LK9 A;  4PPE A;  1V87 A;  2LAU A;  3KDE C;  3DPL R;  4MSX A;  2K16 A;  2L80 A;  2E61 A;  2MA5 A;  3IHP A;  4WA6 A;  2VPB A;  1WEV A;  2JRJ A;  5B76 A;  4OGC A;  2M13 A;  2KWN A;  5SVI B;  2MA6 A;  2IQJ A;  2HDP A;  2MD8 C;  5G05 B;  3LVR E;  1WIM A;  3H7H A;  2RI7 A;  5FER A;  1JM7 A;  2KGI A;  5B78 A;  4FK5 A;  3I2D A;  3ZVZ B;  2LDR A;  3PLW A;  3T7L A;  4A0C D;  3LDY A;  4IC2 A;  4R8P K;  4L7X A;  5FEY A;  3SHB A;  2G6Q A;  1WEU A;  2PNX A;  2CSZ A;  2RR4 A;  1WE9 A;  3T6R A;  4LAD B;  1U6G B;  3U5M A;  1DVP A;  4I7B A;  1Z6U A;  2KE1 A;  1IYM A;  2JM3 A;  3U5O A;  1JM7 B;  5B8D A;  2KWJ A;  2XOZ A;  2CON A;  5JG6 A;  3QZV A;  1E4U A;  4WZ2 A;  4S3O B;  5TDW A;  2FUI A;  5LKX A;  3LRQ A;  4B7Y C;  4R7E A;  2ECI A;  3O37 A;  2LGK A;  2KFT A;  3SOX A;  4X3G A;  2E6S A;  3KQI A;  5KH3 A;  3C5K A;  4AYC A;  1WEE A;  2VNF A;  3E2D A;  2ECG A;  3KNV A;  4I7D A;  2G43 A;  1LDJ B;  2XOC A;  3JUE A;  2YQM A;  4AUQ B;  2YHN A;  3M7K A;  2BAY A;  1WEW A;  2P57 A;  2UZG A;  2JMJ A;  3ZPV E;  3M62 A;  4GB0 A;  2Y43 A;  2ECJ A;  2LGG A;  5B77 A;  2LQ6 A;  3L11 A;  4I7C A;  2E6R A;  2LRI C;  3ZYQ A;  1FBV A;  2AN6 A;  3LQJ A;  4XI1 A;  2CKL B;  2MNY A;  3N9N A;  2KWK A;  4N3W A;  2LN0 A;  4YBM A;  4Z0R A;  2KR4 A;  2B0O E;  4BBQ A;  1HYJ A;  4PTB A;  5LKZ A;  5C11 A;  4A4C A;  3U5N A;  2LV9 A;  2K1J A;  2QIZ A;  3PUR A;  4QF3 A;  3ASL A;  4UI9 B;  5SVX A;  5AIT A;  3N9L A;  3FAO A;  3DDT A;  3LVQ E;  3N9O A;  2CKL A;  2KU3 A;  2ECV A;  2JUN A;  2XP0 A;  4YBT A;  1WGM A;  3HCU A;  2LXH C;  3LJU X;  2PUY A;  1K2F A;  2KYU A;  2MT5 A;  2L5U A;  2OXQ C;  4B86 C;  3L1Z B;  4AVX A;  2YRE A;  1LDK C;  2ECW A;  2EXU A;  3FL2 A;  5J3X A;  5H9M A;  3PUQ A;  1F62 A;  2YW8 A;  2VPG A;  4QF2 A;  3RPG B;  5SVY A;  2MUM A;  1ZBD B;  2XOY A;  4GNG A;  3HTK C;  5LKU A;  5G04 B;  1N87 A;  2FUU A;  2RSD A;  2DX8 A;  2D8S A;  3ZTG A;  4IC3 A;  2KWO A;  1VYX A;  2EGP A;  3O70 A;  2YQL A;  4MVT A;  5FB0 A;  5KH7 A;  4C9Z A;  3RPG C;  2CSV A;  2YHO A;  3O47 A;  3FEH A;  2LGV A;  4ZDT A;  2YUC A;  2VPE A;  4ZUX U;  1FP0 A;  4A49 A;  2KKY A;  2XB1 A;  2M85 A;  3N9P A;  2KKX A;  3FM8 C;  2VP7 A;  4L58 A;  2I50 A;  3VK6 A;  4GNE A;  2KIZ A;  3KV5 A;  2F6N A;  4AP4 A;  5TAB A;  2JMD A;  4TKP B;  2EA6 A;  5B75 A;  2JMI A;  2KGG A;  3LQH A;  2QIC A;  5B79 A;  3M63 A;  2DSM A;  3DWD A;  3GL6 A;  1HYI A;  1Z2Q A;  4FO9 A;  1VD4 A;  3GV4 A;  5SVI A;  2ZET C;  4F1P A;  3L1X A;  3LQI A;  3O34 A;  1WEP A;  3ZVY A;  1WEO A;  1G25 A;  2QJ0 A;  4LKA A;  4H9D A;  3RTR B;  3HCS A;  5TDR A;  5C13 A;  2VJF B;  3SUB A;  5TBN A;  5D1L B;  2KRE A;  4O62 A;  3PHD A;  2CT2 A;  4ZQL A;  5K3Q A;  1T1H A;  2DJA A;  4Z0O A;  3FJU B;  2H0D B;  5KH9 A;  3O36 A;  4FJC A;  5TRB A;  2M3H A;  2FSA A;  2MNZ A;  1MBM A;  3SOU A;  1XWH A;  5EYA F;  2K4D A;  1BOR A;  1WIL A;  3O33 A;  2VPD A;  2Y1M A;  4GNF A;  4UP5 A;  4O64 A;  2K17 A;  5DIN A;  3EB5 A;  4YC9 A;  2L75 A;  2L7P A;  2YYR A;  4W4U A;  2H0D A;  1JOC A;  2CSY A;  1WFK A;  4N4F A;  3T9K A;  4UP0 A;  3NG2 A;  3SOW A;  3Q1D A;  5H1U A;  3O35 A;  2F42 A;  4YBS A;  1Z60 A;  4YAD A;  4P5O B;  3ZPV 1;  3KV6 A;  2ECT A;  3O7A A;  1X4U A;  4S3O C;  5LCW B;  4YAT A;  1WEN A;  2FD4 A;  2M1R A;  1MM3 A;  1MM2 A;  2YSM A;  4F52 B;  3HCT A;  4BHW A;  1X4I A;  3N9Q A;  5D1M B;  2CRW A;  2XEU A;  4AYC B;  4FIP A;  2NAA A;  2LGL A;  2L43 A;  3N9M A;  2YUR A;  2D8U A;  5H1V A;  1CHC A;  2EGM A;  4LLB A;  4NN2 A;  2L0B A;  1X4J A;  4A4B A;  4YAB A;  3FAN A;  4CCG X;  2VJE B;  4YAX A;  4CA1 A;  3C6W A;  2C2L A;  2MIQ A;  5FB1 A;  1VFY A;  2YT5 A;  4R2Y A;  2IDA A;  4Q6F A;  4WZ0 A;  4QQ4 A;  1WEQ A;  5AIU A;  5H1T A;  2OWA A;  2ECN A;  4V3L C;  5I3L A;  3ZNI A;  2C2V S;  3MHH A;  5D1K B;  5LKT A;  2YVR A;  3DQV R;  5DKA A;  4GND A;  1WEM A;  3MDB C;  2VJE A;  2YU4 A;  5G0F A;  1RMD A;  2LXP C;  4WZ3 B;  2HYE D;  3U5P A;  2FFW A;  4OGE A;  4V3K C;  4LJN A;  2G45 A;  2MD7 B;  2YSJ A;  2EOD A;  2MKE A;  1WES A;  3EB6 A;  3MHS A;  2CRR A;  3V43 A;  2F6J A;  3M99 A;  1DCQ A;  2VJF A; 
#chains in the Genus database with same CATH homology
 4QQ4 A;  2JUN A;  2XP0 A;  5SVI A;  2KKY A;  2FD4 A;  4F1P A;  3LJU X;  5K3Q A;  2KKX A;  3PLW A;  1DCQ A;  2L7P A;  2LAU A;  2DJA A;  3E2D A;  3KDE C;  3FM8 C;  2JM3 A;  2FFW A;  2OWA A;  3FJU B;  4OGE A;  4Z0O A;  3LDY A;  2E61 A;  2YRE A;  2EXU A;  2XOZ A;  2CON A;  3T9K A;  2XOC A;  5SVX A;  3Q1D A;  2MKE A;  3JUE A;  4OGC A;  2CRW A;  4H9D A;  2M13 A;  2YVR A;  3M7K A;  5SVI B;  3SUB A;  2IQJ A;  2P57 A;  4Z0R A;  3DDT A;  3MDB C;  2CRR A;  2CSV A;  4O62 A;  3LVQ E;  3LVR E;  2D8U A;  2B0O E;  3FEH A;  3O47 A;  3DWD A;  2RR4 A;  3H7H A;  5SVY A;  2EGM A;  2XOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...