2JM3A

Solution structure of the thap domain from c. elegans c-terminal binding protein (ctbp)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
GSMPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Solution structure of the THAP domain from Caenorhabditis elegans C-terminal binding protein (CtBP).
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Metal binding protein
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.180 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2jm3A00
2JM3A 3KDEC 2LAUA
chains in the Genus database with same CATH superfamily
2KR4A 1N87A 2YVRA 3PLWA 4R8PK 2KWOA 2LGVA 5LKXA 4NN2A 1MM3A 2HYED 2CKLA 1LDKC 1WILA 3HCUA 3T9KA 1X4UA 2B0OE 3HCTA 4IC2A 5D1KB 3LQIA 4WZ2A 2FSAA 3ZPVE 3LVQE 2QICA 2FUUA 3H7HA 1JM7B 5LKZA 3E2DA 3N9QA 2F6JA 1Z60A 5TBNA 1CHCA 3ZVYA 2VNFA 2VPEA 2MD7B 3I2DA 4YABA 3O35A 3SOXA 4AVXA 1E4UA 4R7EA 2LAUA 3C6WA 2LGGA 5H1TA 2K17A 2ECJA 2JRJA 2KREA 3O70A 5K3QA 3DWDA 1WE9A 3Q1DA 2KE1A 3JUEA 1Z6UA 5KH9A 3VK6A 3M63A 2VP7A 2CONA 5EYAF 4WZ3B 3ZVZB 5C11A 5FERA 3DDTA 2D8UA 2YT5A 5DKAA 4Z0OA 2E6RA 5LKTA 4S3OB 3ZNIA 2KWJA 4LKAA 5SVXA 3N9LA 2PNXA 2YQMA 4PTBA 3RTRB 2EODA 1HYJA 5C13A 4GNFA 1U6GB 5B75A 2MNYA 3FANA 5TABA 2YU4A 2P57A 1WEOA 2OWAA 4ZDTA 3SOUA 4YBMA 1VD4A 3N9MA 2FFWA 2M6MA 3RPGC 2M85A 2CT2A 2L5UA 2QJ0A 4GNDA 2YURA 2F6NA 1WEPA 2G6QA 4GNEA 2CRWA 1DCQA 4UI9B 3LQHA 2ECVA 2LGKA 1WESA 4L58A 5D1MB 3ZPV1 1WEEA 4FIPA 2KKYA 1MBMA 3IHPA 1WENA 2K4DA 4YBTA 2BAYA 5H9MA 1G25A 2VPBA 2MT5A 2LGLA 4Z0RA 2XP0A 4A4CA 5H1UA 5G04B 2LDRA 3NG2A 4FK5A 3PHDA 2MUMA 2VJEA 4OGEA 2EXUA 3LQJA 1BORA 4WA6A 2ECGA 2UZGA 4P5OB 4ZQLA 4V3KC 3O33A 3GV4A 2H0DB 4W4UA 3N9NA 2KFTA 3T7LA 4A4BA 3KDEC 3KV5A 5TDWA 1VYXA 2LN0A 2CRRA 2FD4A 2MKEA 4QQ4A 4Q6FA 2Y43A 2C2VS 4MVTA 4CA1A 1WEQA 5AITA 2E61A 2EGMA 4MSXA 4S3OC 2LRIC 2RSDA 2ECWA 2YREA 2K1JA 1MM2A 4LADB 2L75A 2VJEB 2L7PA 5I3LA 2E6SA 3O36A 2KU3A 2YHNA 4PPEA 4UP5A 2EA6A 3LRQA 3KQIA 1VFYA 2JMDA 5D1LB 5SVIA 2DX8A 2YYRA 3DPLR 3FL2A 5G0FA 2KIZA 2KYUA 4WZ0A 2XB1A 2G45A 4I7CA 3M7KA 3O34A 1IYMA 2LQ6A 3SOWA 3ZYQA 2CSYA 3MHHA 2F42A 4OGCA 2YHOA 4QF2A 3N9OA 5TRBA 5B8DA 4FJCA 2G43A 2JMIA 2D8SA 4AYCA 2EGPA 5SVIB 1FBVA 4F52B 3MDBC 3O7AA 4ZUXU 2XOYA 2K16A 1JOCA 3V43A 2M13A 3N9PA 1X4JA 1FP0A 4L7XA 2KGGA 2MIQA 3KNVA 4TKPB 4BHWA 2MNZA 3EB5A 5G05B 2H0DA 2VJFA 5DINA 4AYCB 4FO9A 3LDYA 2YSJA 4F1PA 2JM3A 2PUYA 3SHBA 5B79A 3C5KA 2Y1MA 3U5PA 5AIUA 5KH7A 3PURA 2YUCA 2YSMA 2XOZA 5FEYA 2LV9A 3KV6A 2L0BA 1XWHA 1WIMA 3U5NA 1LDJB 4A0CD 2XEUA 2VPGA 4R2YA 1WEVA 3PUQA 2VJFB 5SVYA 3GL6A 3RPGB 2ECTA 2HDPA 4CCGX 1WEMA 3M99A 4UP0A 3FEHA 1WFKA 4YC9A 1RMDA 1WEUA 3T6RA 4I7BA 3FM8C 2LXPC 1DVPA 3ZTGA 4YBSA 2LXHC 3O47A 4V3LC 5B77A 2MA6A 3U5OA 2RI7A 2C2LA 1WEWA 4C9ZA 5KH3A 2CKLB 2KGIA 4YADA 3DQVR 2JUNA 2Y1NA 2FUIA 4YAXA 4X3GA 2YQLA 2AN6A 2CSZA 2ECNA 4B7YC 2OXQC 2ECIA 3L1XA 3O37A 2DJAA 5LCWB 2KKXA 3L1ZB 5LKUA 3ASLA 2L43A 4QF3A 3QZVA 4AUQB 2I50A 2M3HA 1X4IA 3FJUB 2RR4A 3U5MA 4GB0A 4B86C 2MA5A 4IC3A 2VPDA 4GNGA 2QIZA 2IDAA 5J3XA 2ZETC 1HYIA 3FAOA 5JG6A 5FB1A 3LJUX 3SUBA 4LLBA 3LVRE 2YW8A 5TDRA 2L80A 1T1HA 4YATA 4O64A 5B76A 3L11A 1F62A 4BBQA 2M1RA 2KWKA 1WGMA 3HCSA 4LJNA 2IQJA 5FB0A 4H9DA 4N4FA 2NAAA 2CSVA 4O62A 1ZBDB 1Z2QA 4XI1A 2MD8C 2DSMA 4N3WA 5B78A 2XOCA 4AP4A 1V87A 3MHSA 1JM7A 5H1VA 2KWNA 4LK9A 4I7DA 3HTKC 1K2FA 2JMJA 3EB6A 4A49A 3M62A
chains in the Genus database with same CATH topology
2IQJA 3PLWA 2YVRA 3E2DA 2XOYA 4OGCA 2L7PA 3JUEA 4H9DA 2KKYA 2FFWA 3LDYA 2CSVA 4O62A 3O47A 4F1PA 2M13A 3LJUX 2JM3A 3SUBA 3KDEC 5SVYA 2CONA 3LVRE 2OWAA 5SVIA 2CRRA 2FD4A 2MKEA 4QQ4A 3T9KA 2XOCA 3FJUB 4Z0RA 2XP0A 2E61A 2EGMA 2RR4A 2CRWA 2B0OE 3DDTA 3FEHA 2JUNA 1DCQA 2LAUA 2D8UA 2XOZA 4Z0OA 3Q1DA 3M7KA 4OGEA 2EXUA 5K3QA 2P57A 5SVIB 3DWDA 2YREA 3FM8C 3LVQE 3MDBC 5SVXA 2DJAA 3H7HA 2KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JM3 A;  3KDE C;  2LAU A; 
#chains in the Genus database with same CATH topology
 2KR4 A;  1N87 A;  2YVR A;  3PLW A;  4R8P K;  2KWO A;  2LGV A;  5LKX A;  4NN2 A;  1MM3 A;  2HYE D;  2CKL A;  1LDK C;  1WIL A;  3HCU A;  3T9K A;  1X4U A;  2B0O E;  3HCT A;  4IC2 A;  5D1K B;  3LQI A;  4WZ2 A;  2FSA A;  3ZPV E;  3LVQ E;  2QIC A;  2FUU A;  3H7H A;  1JM7 B;  5LKZ A;  3E2D A;  3N9Q A;  2F6J A;  1Z60 A;  5TBN A;  1CHC A;  3ZVY A;  2VNF A;  2VPE A;  2MD7 B;  3I2D A;  4YAB A;  3O35 A;  3SOX A;  4AVX A;  1E4U A;  4R7E A;  2LAU A;  3C6W A;  2LGG A;  5H1T A;  2K17 A;  2ECJ A;  2JRJ A;  2KRE A;  3O70 A;  5K3Q A;  3DWD A;  1WE9 A;  3Q1D A;  2KE1 A;  3JUE A;  1Z6U A;  5KH9 A;  3VK6 A;  3M63 A;  2VP7 A;  2CON A;  5EYA F;  4WZ3 B;  3ZVZ B;  5C11 A;  5FER A;  3DDT A;  2D8U A;  2YT5 A;  5DKA A;  4Z0O A;  2E6R A;  5LKT A;  4S3O B;  3ZNI A;  2KWJ A;  4LKA A;  5SVX A;  3N9L A;  2PNX A;  2YQM A;  4PTB A;  3RTR B;  2EOD A;  1HYJ A;  5C13 A;  4GNF A;  1U6G B;  5B75 A;  2MNY A;  3FAN A;  5TAB A;  2YU4 A;  2P57 A;  1WEO A;  2OWA A;  4ZDT A;  3SOU A;  4YBM A;  1VD4 A;  3N9M A;  2FFW A;  2M6M A;  3RPG C;  2M85 A;  2CT2 A;  2L5U A;  2QJ0 A;  4GND A;  2YUR A;  2F6N A;  1WEP A;  2G6Q A;  4GNE A;  2CRW A;  1DCQ A;  4UI9 B;  3LQH A;  2ECV A;  2LGK A;  1WES A;  4L58 A;  5D1M B;  3ZPV 1;  1WEE A;  4FIP A;  2KKY A;  1MBM A;  3IHP A;  1WEN A;  2K4D A;  4YBT A;  2BAY A;  5H9M A;  1G25 A;  2VPB A;  2MT5 A;  2LGL A;  4Z0R A;  2XP0 A;  4A4C A;  5H1U A;  5G04 B;  2LDR A;  3NG2 A;  4FK5 A;  3PHD A;  2MUM A;  2VJE A;  4OGE A;  2EXU A;  3LQJ A;  1BOR A;  4WA6 A;  2ECG A;  2UZG A;  4P5O B;  4ZQL A;  4V3K C;  3O33 A;  3GV4 A;  2H0D B;  4W4U A;  3N9N A;  2KFT A;  3T7L A;  4A4B A;  3KDE C;  3KV5 A;  5TDW A;  1VYX A;  2LN0 A;  2CRR A;  2FD4 A;  2MKE A;  4QQ4 A;  4Q6F A;  2Y43 A;  2C2V S;  4MVT A;  4CA1 A;  1WEQ A;  5AIT A;  2E61 A;  2EGM A;  4MSX A;  4S3O C;  2LRI C;  2RSD A;  2ECW A;  2YRE A;  2K1J A;  1MM2 A;  4LAD B;  2L75 A;  2VJE B;  2L7P A;  5I3L A;  2E6S A;  3O36 A;  2KU3 A;  2YHN A;  4PPE A;  4UP5 A;  2EA6 A;  3LRQ A;  3KQI A;  1VFY A;  2JMD A;  5D1L B;  5SVI A;  2DX8 A;  2YYR A;  3DPL R;  3FL2 A;  5G0F A;  2KIZ A;  2KYU A;  4WZ0 A;  2XB1 A;  2G45 A;  4I7C A;  3M7K A;  3O34 A;  1IYM A;  2LQ6 A;  3SOW A;  3ZYQ A;  2CSY A;  3MHH A;  2F42 A;  4OGC A;  2YHO A;  4QF2 A;  3N9O A;  5TRB A;  5B8D A;  4FJC A;  2G43 A;  2JMI A;  2D8S A;  4AYC A;  2EGP A;  5SVI B;  1FBV A;  4F52 B;  3MDB C;  3O7A A;  4ZUX U;  2XOY A;  2K16 A;  1JOC A;  3V43 A;  2M13 A;  3N9P A;  1X4J A;  1FP0 A;  4L7X A;  2KGG A;  2MIQ A;  3KNV A;  4TKP B;  4BHW A;  2MNZ A;  3EB5 A;  5G05 B;  2H0D A;  2VJF A;  5DIN A;  4AYC B;  4FO9 A;  3LDY A;  2YSJ A;  4F1P A;  2JM3 A;  2PUY A;  3SHB A;  5B79 A;  3C5K A;  2Y1M A;  3U5P A;  5AIU A;  5KH7 A;  3PUR A;  2YUC A;  2YSM A;  2XOZ A;  5FEY A;  2LV9 A;  3KV6 A;  2L0B A;  1XWH A;  1WIM A;  3U5N A;  1LDJ B;  4A0C D;  2XEU A;  2VPG A;  4R2Y A;  1WEV A;  3PUQ A;  2VJF B;  5SVY A;  3GL6 A;  3RPG B;  2ECT A;  2HDP A;  4CCG X;  1WEM A;  3M99 A;  4UP0 A;  3FEH A;  1WFK A;  4YC9 A;  1RMD A;  1WEU A;  3T6R A;  4I7B A;  3FM8 C;  2LXP C;  1DVP A;  3ZTG A;  4YBS A;  2LXH C;  3O47 A;  4V3L C;  5B77 A;  2MA6 A;  3U5O A;  2RI7 A;  2C2L A;  1WEW A;  4C9Z A;  5KH3 A;  2CKL B;  2KGI A;  4YAD A;  3DQV R;  2JUN A;  2Y1N A;  2FUI A;  4YAX A;  4X3G A;  2YQL A;  2AN6 A;  2CSZ A;  2ECN A;  4B7Y C;  2OXQ C;  2ECI A;  3L1X A;  3O37 A;  2DJA A;  5LCW B;  2KKX A;  3L1Z B;  5LKU A;  3ASL A;  2L43 A;  4QF3 A;  3QZV A;  4AUQ B;  2I50 A;  2M3H A;  1X4I A;  3FJU B;  2RR4 A;  3U5M A;  4GB0 A;  4B86 C;  2MA5 A;  4IC3 A;  2VPD A;  4GNG A;  2QIZ A;  2IDA A;  5J3X A;  2ZET C;  1HYI A;  3FAO A;  5JG6 A;  5FB1 A;  3LJU X;  3SUB A;  4LLB A;  3LVR E;  2YW8 A;  5TDR A;  2L80 A;  1T1H A;  4YAT A;  4O64 A;  5B76 A;  3L11 A;  1F62 A;  4BBQ A;  2M1R A;  2KWK A;  1WGM A;  3HCS A;  4LJN A;  2IQJ A;  5FB0 A;  4H9D A;  4N4F A;  2NAA A;  2CSV A;  4O62 A;  1ZBD B;  1Z2Q A;  4XI1 A;  2MD8 C;  2DSM A;  4N3W A;  5B78 A;  2XOC A;  4AP4 A;  1V87 A;  3MHS A;  1JM7 A;  5H1V A;  2KWN A;  4LK9 A;  4I7D A;  3HTK C;  1K2F A;  2JMJ A;  3EB6 A;  4A49 A;  3M62 A; 
#chains in the Genus database with same CATH homology
 2IQJ A;  3PLW A;  2YVR A;  3E2D A;  2XOY A;  4OGC A;  2L7P A;  3JUE A;  4H9D A;  2KKY A;  2FFW A;  3LDY A;  2CSV A;  4O62 A;  3O47 A;  4F1P A;  2M13 A;  3LJU X;  2JM3 A;  3SUB A;  3KDE C;  5SVY A;  2CON A;  3LVR E;  2OWA A;  5SVI A;  2CRR A;  2FD4 A;  2MKE A;  4QQ4 A;  3T9K A;  2XOC A;  3FJU B;  4Z0R A;  2XP0 A;  2E61 A;  2EGM A;  2RR4 A;  2CRW A;  2B0O E;  3DDT A;  3FEH A;  2JUN A;  1DCQ A;  2LAU A;  2D8U A;  2XOZ A;  4Z0O A;  3Q1D A;  3M7K A;  4OGE A;  2EXU A;  5K3Q A;  2P57 A;  5SVI B;  3DWD A;  2YRE A;  3FM8 C;  3LVQ E;  3MDB C;  5SVX A;  2DJA A;  3H7H A;  2KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...