2JM3A

Solution structure of the thap domain from c. elegans c-terminal binding protein (ctbp)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
GSMPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the THAP domain from Caenorhabditis elegans C-terminal binding protein (CtBP).
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Metal binding protein
molecule keywords Hypothetical protein
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.180 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2jm3A00
2JM3A 3KDEC 2LAUA
chains in the Genus database with same CATH superfamily
3FM8C 4UI9B 3PLWA 2KIZA 4P5OB 2MA5A 1Z2QA 2KGGA 1N87A 2F6JA 3I2DA 4FK5A 2H0DB 3DWDA 1E4UA 1Z6UA 2H0DA 2MD7B 2KWOA 4GNGA 3N9PA 2MKEA 2ECNA 5SVXA 5TDRA 2CONA 2M1RA 3MDBC 2CRRA 2VPBA 4L58A 3LQHA 2YSMA 2L43A 2KKXA 5B76A 3SOUA 4YAXA 3ZVZB 2XP0A 4IC3A 4FO9A 4BBQA 2FD4A 4B7YC 2ECJA 3ZTGA 3ZPVE 2ECVA 5B79A 2K16A 2Y1NA 1JM7A 3T6RA 3T7LA 2CSVA 3EB6A 2RR4A 3GL6A 4L7XA 4A4CA 4QF2A 2YYRA 4LK9A 3Q1DA 3VK6A 3U5NA 3FAOA 2P57A 1WEVA 5C13A 2DSMA 3O7AA 2FFWA 4OGCA 2MIQA 4R7EA 3LRQA 5KH7A 4GNDA 2D8UA 2OWAA 2EXUA 1RMDA 4AP4A 2E6RA 2K4DA 4PPEA 1WILA 1CHCA 2XOZA 4IC2A 4BHWA 5H9MA 5B8DA 5LCWB 2XOCA 1WEQA 4LJNA 5D1LB 4GNEA 2DJAA 4AUQB 3U5OA 4AYCB 3O36A 4FJCA 2VNFA 5D1MB 3KDEC 2JM3A 4Z0OA 2AN6A 4I7CA 2YVRA 5H1TA 3O70A 4UP5A 3KNVA 2VP7A 3LQJA 4I7BA 4NN2A 3U5MA 2VJFB 5DINA 2MD8C 2YSJA 2C2VS 3FANA 3FJUB 5I3LA 1F62A 5LKXA 2Y1MA 2LN0A 1LDKC 1VFYA 2EODA 5C11A 4LADB 2YUCA 4S3OC 4LLBA 5B78A 2HYED 3O33A 1MM3A 4N4FA 1VD4A 2KYUA 2YURA 2KREA 2YT5A 2CT2A 1X4JA 3HCSA 2L80A 1BORA 2MT5A 4B86C 3M7KA 2ZETC 2YW8A 5KH3A 1WEPA 5FB1A 4C9ZA 4V3KC 4YBMA 3SOXA 3M62A 4FIPA 2MUMA 3N9LA 2M13A 4R8PK 1WEWA 1MM2A 3HTKC 5AIUA 2XOYA 5SVYA 1WE9A 3SOWA 3LQIA 1V87A 4UP0A 4WZ3B 2Y43A 3KV6A 2YHNA 3LVQE 3IHPA 5TDWA 2KKYA 1FBVA 3H7HA 2M3HA 2ECTA 5TRBA 4OGEA 2DX8A 5LKUA 2KFTA 1HYIA 3PHDA 2FUIA 4R2YA 1HYJA 4F52B 4LKAA 2BAYA 3M63A 1WGMA 3ZVYA 3ZPV1 3O37A 2VPGA 1LDJB 5JG6A 2K1JA 2KWNA 1DVPA 4ZDTA 4I7DA 2IDAA 5DKAA 2ECGA 3PUQA 1WESA 4WA6A 3DDTA 1WEOA 4X3GA 1Z60A 2PNXA 1JOCA 2G6QA 5J3XA 4QQ4A 2YQLA 2L0BA 5TABA 4A49A 2HDPA 3L1ZB 2G45A 3N9NA 4YADA 3L11A 2XB1A 3SUBA 3ZYQA 4MSXA 2OXQC 2JUNA 3N9QA 2CSYA 4YBTA 2KU3A 2ECIA 2EA6A 2G43A 2ECWA 2LDRA 2UZGA 5D1KB 1IYMA 4QF3A 2LXHC 2KWKA 4CA1A 2JMDA 4YATA 2YU4A 3N9MA 3LDYA 3KV5A 2L75A 1X4UA 2JRJA 2E6SA 4Z0RA 3L1XA 2MNYA 2XEUA 5H1UA 1G25A 2CRWA 4S3OB 1WIMA 4H9DA 2CSZA 3ZNIA 2K17A 2D8SA 2L7PA 2QICA 2LGVA 3RPGC 4CCGX 4GNFA 4V3LC 5G0FA 2EGPA 2VJEB 3MHSA 3MHHA 2C2LA 2KR4A 2E61A 2EGMA 2LGKA 2QJ0A 4MVTA 3ASLA 4O64A 5K3QA 5FB0A 2KE1A 2YREA 3GV4A 1U6GB 2FUUA 3N9OA 2JMJA 4WZ0A 2PUYA 4F1PA 4ZQLA 5TBNA 2JMIA 3C6WA 1MBMA 2LAUA 3E2DA 5EYAF 4N3WA 2KGIA 3O47A 2VJFA 2NAAA 3FL2A 1K2FA 1DCQA 5AITA 1VYXA 4O62A 2RI7A 1WEEA 5G04B 5FERA 1ZBDB 1XWHA 2MA6A 2IQJA 2VPDA 2CKLA 4TKPB 3LVRE 2KWJA 3LJUX 5SVIB 2CKLB 2RSDA 4PTBA 2FSAA 2B0OE 2YQMA 2M85A 3JUEA 2LRIC 5SVIA 5B77A 3RTRB 2YHOA 4W4UA 2VPEA 3PURA 5G05B 3HCUA 2F42A 3DQVR 1JM7B 1T1HA 3KQIA 3NG2A 3O34A 3T9KA 5B75A 2LQ6A 3SHBA 1FP0A 5KH9A 3QZVA 5LKZA 3U5PA 3FEHA 4YBSA 1WEMA 4ZUXU 4AVXA 4Q6FA 3RPGB 4GB0A 3EB5A 2M6MA 4XI1A 4YC9A 5H1VA 4A0CD 4A4BA 1WFKA 2QIZA 2I50A 3DPLR 3O35A 5FEYA 2MNZA 2L5UA 1WENA 1X4IA 2LGLA 3HCTA 2LV9A 2VJEA 3M99A 4WZ2A 3C5KA 4AYCA 5LKTA 2LGGA 4YABA 2F6NA 2LXPC 3V43A 1WEUA
chains in the Genus database with same CATH topology
2OWAA 4F1PA 2EXUA 3T9KA 4OGEA 3FM8C 4O62A 3KDEC 2M13A 3PLWA 3SUBA 2JM3A 4Z0OA 2JUNA 3DDTA 2YVRA 2XOYA 2IQJA 3Q1DA 2XOZA 3LVRE 3LDYA 5SVYA 3DWDA 2E61A 2EGMA 4Z0RA 3LJUX 2XOCA 2XP0A 3FEHA 5SVIB 2LAUA 3E2DA 2B0OE 2P57A 2FD4A 5K3QA 3O47A 3FJUB 2CRWA 3JUEA 4QQ4A 5SVIA 2MKEA 2FFWA 2YREA 4H9DA 3M7KA 2DJAA 5SVXA 2CONA 3LVQE 4OGCA 1DCQA 3MDBC 2CSVA 2CRRA 2L7PA 2KKYA 2RR4A 2D8UA 3H7HA 2KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JM3 A;  3KDE C;  2LAU A; 
#chains in the Genus database with same CATH topology
 3FM8 C;  4UI9 B;  3PLW A;  2KIZ A;  4P5O B;  2MA5 A;  1Z2Q A;  2KGG A;  1N87 A;  2F6J A;  3I2D A;  4FK5 A;  2H0D B;  3DWD A;  1E4U A;  1Z6U A;  2H0D A;  2MD7 B;  2KWO A;  4GNG A;  3N9P A;  2MKE A;  2ECN A;  5SVX A;  5TDR A;  2CON A;  2M1R A;  3MDB C;  2CRR A;  2VPB A;  4L58 A;  3LQH A;  2YSM A;  2L43 A;  2KKX A;  5B76 A;  3SOU A;  4YAX A;  3ZVZ B;  2XP0 A;  4IC3 A;  4FO9 A;  4BBQ A;  2FD4 A;  4B7Y C;  2ECJ A;  3ZTG A;  3ZPV E;  2ECV A;  5B79 A;  2K16 A;  2Y1N A;  1JM7 A;  3T6R A;  3T7L A;  2CSV A;  3EB6 A;  2RR4 A;  3GL6 A;  4L7X A;  4A4C A;  4QF2 A;  2YYR A;  4LK9 A;  3Q1D A;  3VK6 A;  3U5N A;  3FAO A;  2P57 A;  1WEV A;  5C13 A;  2DSM A;  3O7A A;  2FFW A;  4OGC A;  2MIQ A;  4R7E A;  3LRQ A;  5KH7 A;  4GND A;  2D8U A;  2OWA A;  2EXU A;  1RMD A;  4AP4 A;  2E6R A;  2K4D A;  4PPE A;  1WIL A;  1CHC A;  2XOZ A;  4IC2 A;  4BHW A;  5H9M A;  5B8D A;  5LCW B;  2XOC A;  1WEQ A;  4LJN A;  5D1L B;  4GNE A;  2DJA A;  4AUQ B;  3U5O A;  4AYC B;  3O36 A;  4FJC A;  2VNF A;  5D1M B;  3KDE C;  2JM3 A;  4Z0O A;  2AN6 A;  4I7C A;  2YVR A;  5H1T A;  3O70 A;  4UP5 A;  3KNV A;  2VP7 A;  3LQJ A;  4I7B A;  4NN2 A;  3U5M A;  2VJF B;  5DIN A;  2MD8 C;  2YSJ A;  2C2V S;  3FAN A;  3FJU B;  5I3L A;  1F62 A;  5LKX A;  2Y1M A;  2LN0 A;  1LDK C;  1VFY A;  2EOD A;  5C11 A;  4LAD B;  2YUC A;  4S3O C;  4LLB A;  5B78 A;  2HYE D;  3O33 A;  1MM3 A;  4N4F A;  1VD4 A;  2KYU A;  2YUR A;  2KRE A;  2YT5 A;  2CT2 A;  1X4J A;  3HCS A;  2L80 A;  1BOR A;  2MT5 A;  4B86 C;  3M7K A;  2ZET C;  2YW8 A;  5KH3 A;  1WEP A;  5FB1 A;  4C9Z A;  4V3K C;  4YBM A;  3SOX A;  3M62 A;  4FIP A;  2MUM A;  3N9L A;  2M13 A;  4R8P K;  1WEW A;  1MM2 A;  3HTK C;  5AIU A;  2XOY A;  5SVY A;  1WE9 A;  3SOW A;  3LQI A;  1V87 A;  4UP0 A;  4WZ3 B;  2Y43 A;  3KV6 A;  2YHN A;  3LVQ E;  3IHP A;  5TDW A;  2KKY A;  1FBV A;  3H7H A;  2M3H A;  2ECT A;  5TRB A;  4OGE A;  2DX8 A;  5LKU A;  2KFT A;  1HYI A;  3PHD A;  2FUI A;  4R2Y A;  1HYJ A;  4F52 B;  4LKA A;  2BAY A;  3M63 A;  1WGM A;  3ZVY A;  3ZPV 1;  3O37 A;  2VPG A;  1LDJ B;  5JG6 A;  2K1J A;  2KWN A;  1DVP A;  4ZDT A;  4I7D A;  2IDA A;  5DKA A;  2ECG A;  3PUQ A;  1WES A;  4WA6 A;  3DDT A;  1WEO A;  4X3G A;  1Z60 A;  2PNX A;  1JOC A;  2G6Q A;  5J3X A;  4QQ4 A;  2YQL A;  2L0B A;  5TAB A;  4A49 A;  2HDP A;  3L1Z B;  2G45 A;  3N9N A;  4YAD A;  3L11 A;  2XB1 A;  3SUB A;  3ZYQ A;  4MSX A;  2OXQ C;  2JUN A;  3N9Q A;  2CSY A;  4YBT A;  2KU3 A;  2ECI A;  2EA6 A;  2G43 A;  2ECW A;  2LDR A;  2UZG A;  5D1K B;  1IYM A;  4QF3 A;  2LXH C;  2KWK A;  4CA1 A;  2JMD A;  4YAT A;  2YU4 A;  3N9M A;  3LDY A;  3KV5 A;  2L75 A;  1X4U A;  2JRJ A;  2E6S A;  4Z0R A;  3L1X A;  2MNY A;  2XEU A;  5H1U A;  1G25 A;  2CRW A;  4S3O B;  1WIM A;  4H9D A;  2CSZ A;  3ZNI A;  2K17 A;  2D8S A;  2L7P A;  2QIC A;  2LGV A;  3RPG C;  4CCG X;  4GNF A;  4V3L C;  5G0F A;  2EGP A;  2VJE B;  3MHS A;  3MHH A;  2C2L A;  2KR4 A;  2E61 A;  2EGM A;  2LGK A;  2QJ0 A;  4MVT A;  3ASL A;  4O64 A;  5K3Q A;  5FB0 A;  2KE1 A;  2YRE A;  3GV4 A;  1U6G B;  2FUU A;  3N9O A;  2JMJ A;  4WZ0 A;  2PUY A;  4F1P A;  4ZQL A;  5TBN A;  2JMI A;  3C6W A;  1MBM A;  2LAU A;  3E2D A;  5EYA F;  4N3W A;  2KGI A;  3O47 A;  2VJF A;  2NAA A;  3FL2 A;  1K2F A;  1DCQ A;  5AIT A;  1VYX A;  4O62 A;  2RI7 A;  1WEE A;  5G04 B;  5FER A;  1ZBD B;  1XWH A;  2MA6 A;  2IQJ A;  2VPD A;  2CKL A;  4TKP B;  3LVR E;  2KWJ A;  3LJU X;  5SVI B;  2CKL B;  2RSD A;  4PTB A;  2FSA A;  2B0O E;  2YQM A;  2M85 A;  3JUE A;  2LRI C;  5SVI A;  5B77 A;  3RTR B;  2YHO A;  4W4U A;  2VPE A;  3PUR A;  5G05 B;  3HCU A;  2F42 A;  3DQV R;  1JM7 B;  1T1H A;  3KQI A;  3NG2 A;  3O34 A;  3T9K A;  5B75 A;  2LQ6 A;  3SHB A;  1FP0 A;  5KH9 A;  3QZV A;  5LKZ A;  3U5P A;  3FEH A;  4YBS A;  1WEM A;  4ZUX U;  4AVX A;  4Q6F A;  3RPG B;  4GB0 A;  3EB5 A;  2M6M A;  4XI1 A;  4YC9 A;  5H1V A;  4A0C D;  4A4B A;  1WFK A;  2QIZ A;  2I50 A;  3DPL R;  3O35 A;  5FEY A;  2MNZ A;  2L5U A;  1WEN A;  1X4I A;  2LGL A;  3HCT A;  2LV9 A;  2VJE A;  3M99 A;  4WZ2 A;  3C5K A;  4AYC A;  5LKT A;  2LGG A;  4YAB A;  2F6N A;  2LXP C;  3V43 A;  1WEU A; 
#chains in the Genus database with same CATH homology
 2OWA A;  4F1P A;  2EXU A;  3T9K A;  4OGE A;  3FM8 C;  4O62 A;  3KDE C;  2M13 A;  3PLW A;  3SUB A;  2JM3 A;  4Z0O A;  2JUN A;  3DDT A;  2YVR A;  2XOY A;  2IQJ A;  3Q1D A;  2XOZ A;  3LVR E;  3LDY A;  5SVY A;  3DWD A;  2E61 A;  2EGM A;  4Z0R A;  3LJU X;  2XOC A;  2XP0 A;  3FEH A;  5SVI B;  2LAU A;  3E2D A;  2B0O E;  2P57 A;  2FD4 A;  5K3Q A;  3O47 A;  3FJU B;  2CRW A;  3JUE A;  4QQ4 A;  5SVI A;  2MKE A;  2FFW A;  2YRE A;  4H9D A;  3M7K A;  2DJA A;  5SVX A;  2CON A;  3LVQ E;  4OGC A;  1DCQ A;  3MDB C;  2CSV A;  2CRR A;  2L7P A;  2KKY A;  2RR4 A;  2D8U A;  3H7H A;  2KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...