2JM3A

Solution structure of the thap domain from c. elegans c-terminal binding protein (ctbp)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
GSMPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Hypothetical protein
publication title Solution structure of the THAP domain from Caenorhabditis elegans C-terminal binding protein (CtBP).
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 17
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.180 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2jm3A00
3KDEC 2LAUA 2JM3A
chains in the Genus database with same CATH superfamily
4OGEA 2MA5A 5TABA 4AP4A 3NG2A 2XEUA 3FM8C 5G05B 5KH3A 4WZ0A 2KWNA 3SOXA 3ZVYA 2ECTA 3ZYQA 1WEPA 2YYRA 2YU4A 1FBVA 4S3OC 2DJAA 5LKUA 3C5KA 4MSXA 3V43A 2JMJA 4Z0RA 3LVQE 2YREA 5B8DA 4XI1A 3LRQA 4UP5A 4C9ZA 2LXPC 3LDYA 2G6QA 2UZGA 3U5PA 1E4UA 2D8UA 3PUQA 2LGKA 2NAAA 1VYXA 3O34A 1WEWA 2E61A 4TKPB 3RPGB 2E6SA 2CKLA 5SVIB 5TDRA 2PNXA 5LCWB 5B78A 3PHDA 4GNGA 3I2DA 1WEOA 3MDBC 2KKXA 1WE9A 2ECIA 2VJFA 1Z6UA 2JRJA 2FUUA 2IDAA 2CONA 5LKXA 4L58A 2MNYA 2VPDA 1V87A 3KNVA 5TRBA 2I50A 3O35A 1WILA 1DCQA 3ASLA 5SVYA 3E2DA 2CT2A 1LDJB 5J3XA 3PURA 3SOUA 3N9MA 2M3HA 1WENA 5I3LA 4A4CA 2YHOA 2HYED 3L1ZB 2RI7A 2G45A 2FFWA 3M63A 5H1UA 2CSYA 4YATA 4B86C 3H7HA 3O33A 2ZETC 5FB1A 1BORA 1U6GB 3LQJA 2L43A 5H1VA 3DPLR 2LQ6A 4R8PK 1X4IA 5JG6A 1VD4A 3KV6A 1N87A 4WZ2A 2L5UA 2MT5A 4AYCA 2H0DA 4GNFA 4O64A 1MM3A 3GL6A 4I7CA 3EB5A 1RMDA 4F1PA 2F6NA 2RR4A 2VPBA 3LVRE 2C2VS 5K3QA 4L7XA 4PPEA 2YUCA 4A49A 2CRRA 3O47A 2DX8A 3HCSA 4I7DA 1JM7A 5LKTA 2LXHC 2CSZA 1F62A 5TDWA 3LQHA 1G25A 2YQLA 4OGCA 2MUMA 3SHBA 5C11A 3RTRB 2M85A 1WEMA 1WEQA 2YVRA 4GB0A 4O62A 2LV9A 4MVTA 2JUNA 4W4UA 5DINA 4A0CD 1LDKC 2P57A 3VK6A 2KFTA 3FANA 4Z0OA 4Q6FA 2CKLB 1X4UA 2VJEA 2HDPA 3FL2A 3HCUA 1WEUA 2F6JA 4FK5A 4X3GA 5G0FA 4H9DA 5D1KB 4YBSA 2QICA 4IC3A 3EB6A 1WIMA 2LGVA 2VJFB 2XOYA 5D1LB 2ECWA 4V3LC 3FEHA 4V3KC 4YADA 1VFYA 2ECGA 2CRWA 2MD7B 4UP0A 3MHHA 5H9MA 4R7EA 2KREA 3LJUX 2K1JA 4FIPA 2KU3A 3ZPV1 1HYJA 5AIUA 5FB0A 4LKAA 2EGMA 3L11A 5EYAF 5B76A 2BAYA 1WGMA 4ZDTA 2LN0A 4NN2A 2MNZA 1WEEA 4A4BA 2XOCA 4GNEA 1WFKA 4LK9A 4AYCB 3KV5A 2H0DB 4F52B 2JM3A 5TBNA 2LDRA 3ZTGA 1WESA 2KWJA 3U5NA 2VP7A 2OXQC 1CHCA 2KGGA 3DDTA 3ZPVE 3HTKC 5KH9A 3MHSA 2JMDA 2K4DA 1MBMA 3GV4A 4YBTA 2C2LA 5C13A 2M6MA 1Z60A 4UI9B 1JM7B 4BHWA 2EODA 3N9LA 5DKAA 3N9QA 4PTBA 3T6RA 2L80A 3KDEC 2YQMA 1HYIA 2XP0A 2DSMA 4AUQB 2KKYA 3U5OA 5D1MB 3SOWA 3FJUB 4YC9A 2ECJA 4FJCA 2E6RA 4I7BA 2KGIA 4CA1A 2EXUA 2YW8A 2VPEA 2Y43A 5KH7A 4WA6A 2VNFA 3C6WA 2YURA 2D8SA 2LGGA 1JOCA 3T7LA 2L0BA 4BBQA 4ZQLA 5G04B 2VJEB 2OWAA 1IYMA 2MKEA 5H1TA 3FAOA 2L7PA 2MIQA 1X4JA 4LJNA 4N4FA 2QJ0A 3SUBA 3M99A 3O70A 2XB1A 2YSMA 2YHNA 2Y1MA 2LGLA 3JUEA 3N9NA 2EA6A 2CSVA 4LLBA 1MM2A 1ZBDB 3U5MA 2KWKA 3N9OA 2QIZA 4LADB 3PLWA 5SVIA 1XWHA 4ZUXU 2KIZA 3O7AA 2M1RA 2LAUA 2G43A 4WZ3B 2LRIC 1K2FA 4YBMA 1Z2QA 2FD4A 3M62A 4B7YC 4R2YA 2KYUA 2K16A 3O36A 5FEYA 2PUYA 2KWOA 3IHPA 1FP0A 2MA6A 3KQIA 3DQVR 3QZVA 1WEVA 3O37A 5LKZA 4S3OB 2EGPA 2FSAA 4QF2A 3ZNIA 4YABA 2K17A 2YT5A 1DVPA 4QQ4A 5B77A 2ECNA 5B79A 5B75A 5SVXA 4FO9A 5FERA 2AN6A 4AVXA 4CCGX 2XOZA 2VPGA 4QF3A 3LQIA 2IQJA 1T1HA 2KE1A 2Y1NA 2MD8C 3Q1DA 3RPGC 3L1XA 2KR4A 4P5OB 2L75A 4N3WA 2M13A 3ZVZB 2F42A 3HCTA 4IC2A 2YSJA 2B0OE 4YAXA 5AITA 2FUIA 4GNDA 2JMIA 3N9PA 2RSDA 3T9KA 3DWDA 3M7KA 2ECVA
chains in the Genus database with same CATH topology
2EXUA 2IQJA 4OGEA 3SUBA 2XOCA 2LAUA 3Q1DA 2D8UA 2YVRA 2CRRA 3FM8C 4H9DA 4O62A 3LJUX 3O47A 2FFWA 2JUNA 4QQ4A 3MDBC 2KKXA 2M13A 2XOYA 2JM3A 3JUEA 2FD4A 2CONA 2P57A 5SVXA 2E61A 2CSVA 2DJAA 3H7HA 3KDEC 4Z0OA 2XP0A 4Z0RA 2B0OE 3PLWA 2KKYA 3FEHA 2YREA 1DCQA 3LVQE 5SVIA 3DDTA 2OWAA 5SVIB 2RR4A 4F1PA 2MKEA 2EGMA 5SVYA 3E2DA 2XOZA 3FJUB 3LVRE 2L7PA 2CRWA 4OGCA 5K3QA 3T9KA 3DWDA 3LDYA 3M7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDE C;  2LAU A;  2JM3 A; 
#chains in the Genus database with same CATH topology
 4OGE A;  2MA5 A;  5TAB A;  4AP4 A;  3NG2 A;  2XEU A;  3FM8 C;  5G05 B;  5KH3 A;  4WZ0 A;  2KWN A;  3SOX A;  3ZVY A;  2ECT A;  3ZYQ A;  1WEP A;  2YYR A;  2YU4 A;  1FBV A;  4S3O C;  2DJA A;  5LKU A;  3C5K A;  4MSX A;  3V43 A;  2JMJ A;  4Z0R A;  3LVQ E;  2YRE A;  5B8D A;  4XI1 A;  3LRQ A;  4UP5 A;  4C9Z A;  2LXP C;  3LDY A;  2G6Q A;  2UZG A;  3U5P A;  1E4U A;  2D8U A;  3PUQ A;  2LGK A;  2NAA A;  1VYX A;  3O34 A;  1WEW A;  2E61 A;  4TKP B;  3RPG B;  2E6S A;  2CKL A;  5SVI B;  5TDR A;  2PNX A;  5LCW B;  5B78 A;  3PHD A;  4GNG A;  3I2D A;  1WEO A;  3MDB C;  2KKX A;  1WE9 A;  2ECI A;  2VJF A;  1Z6U A;  2JRJ A;  2FUU A;  2IDA A;  2CON A;  5LKX A;  4L58 A;  2MNY A;  2VPD A;  1V87 A;  3KNV A;  5TRB A;  2I50 A;  3O35 A;  1WIL A;  1DCQ A;  3ASL A;  5SVY A;  3E2D A;  2CT2 A;  1LDJ B;  5J3X A;  3PUR A;  3SOU A;  3N9M A;  2M3H A;  1WEN A;  5I3L A;  4A4C A;  2YHO A;  2HYE D;  3L1Z B;  2RI7 A;  2G45 A;  2FFW A;  3M63 A;  5H1U A;  2CSY A;  4YAT A;  4B86 C;  3H7H A;  3O33 A;  2ZET C;  5FB1 A;  1BOR A;  1U6G B;  3LQJ A;  2L43 A;  5H1V A;  3DPL R;  2LQ6 A;  4R8P K;  1X4I A;  5JG6 A;  1VD4 A;  3KV6 A;  1N87 A;  4WZ2 A;  2L5U A;  2MT5 A;  4AYC A;  2H0D A;  4GNF A;  4O64 A;  1MM3 A;  3GL6 A;  4I7C A;  3EB5 A;  1RMD A;  4F1P A;  2F6N A;  2RR4 A;  2VPB A;  3LVR E;  2C2V S;  5K3Q A;  4L7X A;  4PPE A;  2YUC A;  4A49 A;  2CRR A;  3O47 A;  2DX8 A;  3HCS A;  4I7D A;  1JM7 A;  5LKT A;  2LXH C;  2CSZ A;  1F62 A;  5TDW A;  3LQH A;  1G25 A;  2YQL A;  4OGC A;  2MUM A;  3SHB A;  5C11 A;  3RTR B;  2M85 A;  1WEM A;  1WEQ A;  2YVR A;  4GB0 A;  4O62 A;  2LV9 A;  4MVT A;  2JUN A;  4W4U A;  5DIN A;  4A0C D;  1LDK C;  2P57 A;  3VK6 A;  2KFT A;  3FAN A;  4Z0O A;  4Q6F A;  2CKL B;  1X4U A;  2VJE A;  2HDP A;  3FL2 A;  3HCU A;  1WEU A;  2F6J A;  4FK5 A;  4X3G A;  5G0F A;  4H9D A;  5D1K B;  4YBS A;  2QIC A;  4IC3 A;  3EB6 A;  1WIM A;  2LGV A;  2VJF B;  2XOY A;  5D1L B;  2ECW A;  4V3L C;  3FEH A;  4V3K C;  4YAD A;  1VFY A;  2ECG A;  2CRW A;  2MD7 B;  4UP0 A;  3MHH A;  5H9M A;  4R7E A;  2KRE A;  3LJU X;  2K1J A;  4FIP A;  2KU3 A;  3ZPV 1;  1HYJ A;  5AIU A;  5FB0 A;  4LKA A;  2EGM A;  3L11 A;  5EYA F;  5B76 A;  2BAY A;  1WGM A;  4ZDT A;  2LN0 A;  4NN2 A;  2MNZ A;  1WEE A;  4A4B A;  2XOC A;  4GNE A;  1WFK A;  4LK9 A;  4AYC B;  3KV5 A;  2H0D B;  4F52 B;  2JM3 A;  5TBN A;  2LDR A;  3ZTG A;  1WES A;  2KWJ A;  3U5N A;  2VP7 A;  2OXQ C;  1CHC A;  2KGG A;  3DDT A;  3ZPV E;  3HTK C;  5KH9 A;  3MHS A;  2JMD A;  2K4D A;  1MBM A;  3GV4 A;  4YBT A;  2C2L A;  5C13 A;  2M6M A;  1Z60 A;  4UI9 B;  1JM7 B;  4BHW A;  2EOD A;  3N9L A;  5DKA A;  3N9Q A;  4PTB A;  3T6R A;  2L80 A;  3KDE C;  2YQM A;  1HYI A;  2XP0 A;  2DSM A;  4AUQ B;  2KKY A;  3U5O A;  5D1M B;  3SOW A;  3FJU B;  4YC9 A;  2ECJ A;  4FJC A;  2E6R A;  4I7B A;  2KGI A;  4CA1 A;  2EXU A;  2YW8 A;  2VPE A;  2Y43 A;  5KH7 A;  4WA6 A;  2VNF A;  3C6W A;  2YUR A;  2D8S A;  2LGG A;  1JOC A;  3T7L A;  2L0B A;  4BBQ A;  4ZQL A;  5G04 B;  2VJE B;  2OWA A;  1IYM A;  2MKE A;  5H1T A;  3FAO A;  2L7P A;  2MIQ A;  1X4J A;  4LJN A;  4N4F A;  2QJ0 A;  3SUB A;  3M99 A;  3O70 A;  2XB1 A;  2YSM A;  2YHN A;  2Y1M A;  2LGL A;  3JUE A;  3N9N A;  2EA6 A;  2CSV A;  4LLB A;  1MM2 A;  1ZBD B;  3U5M A;  2KWK A;  3N9O A;  2QIZ A;  4LAD B;  3PLW A;  5SVI A;  1XWH A;  4ZUX U;  2KIZ A;  3O7A A;  2M1R A;  2LAU A;  2G43 A;  4WZ3 B;  2LRI C;  1K2F A;  4YBM A;  1Z2Q A;  2FD4 A;  3M62 A;  4B7Y C;  4R2Y A;  2KYU A;  2K16 A;  3O36 A;  5FEY A;  2PUY A;  2KWO A;  3IHP A;  1FP0 A;  2MA6 A;  3KQI A;  3DQV R;  3QZV A;  1WEV A;  3O37 A;  5LKZ A;  4S3O B;  2EGP A;  2FSA A;  4QF2 A;  3ZNI A;  4YAB A;  2K17 A;  2YT5 A;  1DVP A;  4QQ4 A;  5B77 A;  2ECN A;  5B79 A;  5B75 A;  5SVX A;  4FO9 A;  5FER A;  2AN6 A;  4AVX A;  4CCG X;  2XOZ A;  2VPG A;  4QF3 A;  3LQI A;  2IQJ A;  1T1H A;  2KE1 A;  2Y1N A;  2MD8 C;  3Q1D A;  3RPG C;  3L1X A;  2KR4 A;  4P5O B;  2L75 A;  4N3W A;  2M13 A;  3ZVZ B;  2F42 A;  3HCT A;  4IC2 A;  2YSJ A;  2B0O E;  4YAX A;  5AIT A;  2FUI A;  4GND A;  2JMI A;  3N9P A;  2RSD A;  3T9K A;  3DWD A;  3M7K A;  2ECV A; 
#chains in the Genus database with same CATH homology
 2EXU A;  2IQJ A;  4OGE A;  3SUB A;  2XOC A;  2LAU A;  3Q1D A;  2D8U A;  2YVR A;  2CRR A;  3FM8 C;  4H9D A;  4O62 A;  3LJU X;  3O47 A;  2FFW A;  2JUN A;  4QQ4 A;  3MDB C;  2KKX A;  2M13 A;  2XOY A;  2JM3 A;  3JUE A;  2FD4 A;  2CON A;  2P57 A;  5SVX A;  2E61 A;  2CSV A;  2DJA A;  3H7H A;  3KDE C;  4Z0O A;  2XP0 A;  4Z0R A;  2B0O E;  3PLW A;  2KKY A;  3FEH A;  2YRE A;  1DCQ A;  3LVQ E;  5SVI A;  3DDT A;  2OWA A;  5SVI B;  2RR4 A;  4F1P A;  2MKE A;  2EGM A;  5SVY A;  3E2D A;  2XOZ A;  3FJU B;  3LVR E;  2L7P A;  2CRW A;  4OGC A;  5K3Q A;  3T9K A;  3DWD A;  3LDY A;  3M7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...