2E6SA

Solution structure of the phd domain in ring finger protein 107
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
77
structure length
77
Chain Sequence
GSSGSSGRNDTECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF2
publication title Solution structure of the PHD domain in RING finger protein 107
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 3
structure length 77
sequence length 77
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2e6sA00
4XI1A 5TABA 4YBMA 2ECVA 2KWJA 5DINA 2L80A 3ZPV1 3SHBA 3KV5A 4B7YC 4YABA 2F6JA 5LKZA 4A4BA 1WIMA 4Q6FA 2LGKA 5B77A 1IYMA 2L5UA 2ECWA 1WEMA 2MIQA 5B76A 3U5NA 4FJCA 2JMIA 2F6NA 5H1VA 3L1XA 5C11A 3N9LA 3PURA 1VFYA 1CHCA 3U5MA 4NN2A 4UP0A 4YADA 2VPEA 2KGGA 2L43A 2ECJA 3HCSA 4UP5A 4S3OB 5KH9A 3M63A 5KH7A 2KR4A 2QIZA 3NG2A 2CT2A 2KWKA 4GNGA 4AP4A 5I3LA 3M62A 4L7XA 2QJ0A 2JRJA 4YBTA 2LXHC 2RI7A 2VPGA 1WEUA 2H0DB 3SOXA 2LGVA 4MVTA 2CSZA 5FB0A 2M1RA 2LDRA 3ASLA 2YUCA 4W4UA 1WEQA 5H1TA 2VPDA 5EYAF 4N3WA 5D1MB 2KWNA 5H1UA 3L11A 1T1HA 1WILA 4BBQA 2Y43A 5D1LB 1X4IA 2ECGA 5TBNA 3EB5A 2M85A 1WEPA 4X3GA 2MD8C 2KYUA 3RPGC 1WENA 4ZUXU 1WEOA 2M6MA 3N9OA 1N87A 5B78A 5D1KB 1WE9A 1JOCA 2EGPA 2YURA 4FO9A 4A4CA 2Y1MA 4WZ3B 2FUIA 3O7AA 5KH3A 2AN6A 3ZPVE 1JM7B 4QF2A 2LQ6A 1G25A 4QF3A 3V43A 2G6QA 5B75A 4GNDA 2LV9A 5FERA 3N9QA 2HYED 4LKAA 4B86C 3ZTGA 1JM7A 3HTKC 3MHHA 3C6WA 4TKPB 3T7LA 2K4DA 1WEWA 2KU3A 4LK9A 5DKAA 2MT5A 4FK5A 3IHPA 5AIUA 3O37A 3KNVA 3M99A 4WZ2A 1K2FA 2G45A 4YC9A 5AITA 5LCWB 3VK6A 4N4FA 5G05B 2YHNA 4A49A 2KFTA 2KIZA 3FL2A 1WGMA 4YAXA 3O34A 4R8PK 1WEEA 2VJFA 3ZNIA 2MA5A 2YHOA 2ZETC 2LN0A 2EODA 5TDWA 2E6RA 5J3XA 2PNXA 1Z2QA 3ZVZB 3KV6A 2YQLA 1Z6UA 3DPLR 2HDPA 1FP0A 4V3KC 2NAAA 2DX8A 4AYCA 2K17A 2MUMA 4I7CA 4FIPA 2XEUA 2MNZA 2KREA 2YT5A 4S3OC 5B79A 2MNYA 3L1ZB 4UI9B 2EA6A 4GB0A 3N9PA 3U5PA 2VP7A 1F62A 2KWOA 2JMDA 2MD7B 3SOUA 2YREA 2UZGA 2XB1A 2E6SA 4BHWA 2QICA 2G43A 4LLBA 3DQVR 2CKLA 4V3LC 4ZQLA 3O70A 5H9MA 3I2DA 1X4UA 3EB6A 3LQHA 2YYRA 2LGLA 3O35A 4R2YA 2KE1A 2LXPC 2Y1NA 2LGGA 2VNFA 4GNEA 4ZDTA 5JG6A 2D8SA 4YBSA 2YU4A 4CCGX 2YSJA 1HYJA 5LKXA 2VJEB 4CA1A 1U6GB 4AUQB 1WESA 2VJEA 3GV4A 4PPEA 4IC3A 4WA6A 3ZVYA 4LJNA 4GNFA 3KQIA 4MSXA 2JMJA 5B8DA 3O33A 5TRBA 3U5OA 4LADB 4WZ0A 2CSYA 4O64A 2VJFB 3O36A 4I7DA 2MA6A 1WFKA 3T6RA 1FBVA 2IDAA 5FB1A 2FUUA 4L58A 1DVPA 1VD4A 4I7BA 3LRQA 3RTRB 2PUYA 4R7EA 3HCUA 3N9MA 1VYXA 2ECTA 2K16A 3C5KA 5G0FA 4AYCB 1XWHA 4YATA 2YQMA 4F52B 3N9NA 2K1JA 2OXQC 4PTBA 5G04B 4AVXA 5LKUA 1X4JA 2YSMA 3HCTA 5TDRA 3QZVA 2L75A 1V87A 3MHSA 3SOWA 1LDKC 4P5OB 3RPGB 1E4UA 5FEYA 2I50A 2CKLB 2M3HA 2H0DA 2L0BA 2RSDA 4C9ZA 1RMDA 3LQJA 1Z60A 1MM3A 3PUQA 5C13A 2C2VS 2VPBA 2ECNA 1MM2A 2F42A 3PHDA 2LRIC 2C2LA 4IC2A 1ZBDB 3ZYQA 3LQIA 5LKTA 1BORA 3GL6A 2BAYA 2YW8A 1LDJB 2FSAA 2KGIA 2ECIA 1WEVA 4A0CD 1HYIA
chains in the Genus database with same CATH superfamily
2EXUA 4XI1A 5TABA 2CSVA 4YBMA 2ECVA 2KWJA 5DINA 2L80A 3ZPV1 1DCQA 3SHBA 3KV5A 4B7YC 4YABA 2F6JA 5LKZA 4A4BA 1WIMA 2P57A 4Q6FA 2LGKA 5B77A 1IYMA 2KKYA 2L5UA 2L7PA 2ECWA 1WEMA 2MIQA 5B76A 3U5NA 3DDTA 3FEHA 4H9DA 4FJCA 2JMIA 2F6NA 5H1VA 2JUNA 3L1XA 5C11A 3N9LA 3PURA 1VFYA 1CHCA 3U5MA 2FFWA 4NN2A 4UP0A 3FAOA 4YADA 2VPEA 2KGGA 2L43A 2ECJA 3HCSA 4UP5A 4S3OB 5KH9A 3M63A 5KH7A 2KR4A 2QIZA 3NG2A 2CT2A 3MDBC 2FD4A 4OGCA 2KWKA 4GNGA 4AP4A 5I3LA 3M62A 4L7XA 2QJ0A 2JRJA 4YBTA 2LXHC 3LJUX 2RI7A 3H7HA 2VPGA 1WEUA 2H0DB 3SOXA 2LGVA 4MVTA 2CSZA 5FB0A 4O62A 2M1RA 2LDRA 3ASLA 1MBMA 3T9KA 2YUCA 4W4UA 1WEQA 5H1TA 2VPDA 4N3WA 5EYAF 5D1MB 2KWNA 5H1UA 3L11A 1T1HA 1WILA 4BBQA 2Y43A 5D1LB 1X4IA 3O47A 2ECGA 5TBNA 3EB5A 2M85A 1WEPA 4X3GA 2MD8C 2KYUA 3RPGC 1WENA 4ZUXU 1WEOA 2M6MA 3N9OA 1N87A 5B78A 5D1KB 1WE9A 1JOCA 2EGPA 3FM8C 2YURA 4FO9A 4A4CA 2Y1MA 4WZ3B 2FUIA 3O7AA 5KH3A 2YVRA 2AN6A 3ZPVE 5SVIB 4QQ4A 1JM7B 4QF2A 2LQ6A 1G25A 4QF3A 3V43A 2G6QA 5B75A 4GNDA 2LV9A 5FERA 3N9QA 2HYED 5SVIA 4LKAA 4B86C 3ZTGA 1JM7A 3HTKC 3MHHA 3C6WA 4TKPB 3LVQE 3T7LA 2K4DA 1WEWA 2KU3A 4LK9A 5DKAA 2MT5A 4FK5A 3IHPA 5AIUA 3O37A 3KNVA 3M99A 4WZ2A 1K2FA 2EGMA 2G45A 4YC9A 3SUBA 5AITA 5LCWB 3VK6A 4N4FA 5G05B 2YHNA 4A49A 2KFTA 2CRWA 2DJAA 2KIZA 3FL2A 1WGMA 4YAXA 3O34A 4R8PK 1WEEA 2VJFA 5SVYA 3ZNIA 2MA5A 2YHOA 2ZETC 2LN0A 2EODA 5TDWA 2E6RA 5J3XA 2PNXA 1Z2QA 3ZVZB 3KV6A 2YQLA 1Z6UA 2B0OE 3DPLR 2HDPA 1FP0A 4V3KC 2M13A 2NAAA 2DX8A 5SVXA 3PLWA 4AYCA 2K17A 2MUMA 2D8UA 4I7CA 4FIPA 2XEUA 2MNZA 2KREA 2YT5A 4S3OC 5B79A 2MNYA 3L1ZB 4UI9B 2EA6A 4GB0A 3N9PA 3U5PA 2IQJA 3JUEA 2VP7A 1F62A 2KWOA 2CRRA 2JMDA 2XOZA 3LVRE 2MD7B 3SOUA 2YREA 4F1PA 2UZGA 3FJUB 2XB1A 2E6SA 4BHWA 2QICA 2G43A 4LLBA 3DQVR 5K3QA 3DWDA 2CKLA 4V3LC 2XOCA 4ZQLA 3O70A 5H9MA 3I2DA 4Z0OA 1X4UA 3EB6A 3LQHA 2YYRA 2LGLA 3O35A 4R2YA 2OWAA 2KE1A 2LXPC 2Y1NA 2LAUA 2LGGA 2VNFA 3Q1DA 4GNEA 2DSMA 4ZDTA 5JG6A 2D8SA 4YBSA 2YU4A 4CCGX 2YSJA 1HYJA 5LKXA 2VJEB 4CA1A 1U6GB 4AUQB 1WESA 3FANA 2JM3A 3E2DA 2VJEA 2XP0A 3GV4A 4IC3A 4PPEA 4WA6A 3ZVYA 4LJNA 4GNFA 3KQIA 4MSXA 2JMJA 5B8DA 3O33A 5TRBA 2CONA 3U5OA 4LADB 4WZ0A 2CSYA 4O64A 2VJFB 3O36A 4I7DA 2MA6A 1WFKA 3T6RA 3LDYA 3KDEC 1FBVA 2IDAA 2MKEA 2FUUA 4L58A 5FB1A 1DVPA 1VD4A 4I7BA 3LRQA 3RTRB 4OGEA 2PUYA 4R7EA 3HCUA 3N9MA 1VYXA 2ECTA 2K16A 3C5KA 5G0FA 4AYCB 1XWHA 4YATA 2YQMA 4F52B 3N9NA 2K1JA 3M7KA 2OXQC 4PTBA 5G04B 4AVXA 5LKUA 1X4JA 2YSMA 3HCTA 5TDRA 2XOYA 3QZVA 2L75A 1V87A 3MHSA 3SOWA 1LDKC 2E61A 4P5OB 3RPGB 1E4UA 5FEYA 2I50A 2CKLB 2M3HA 4Z0RA 2H0DA 2L0BA 2RSDA 4C9ZA 1RMDA 3LQJA 1Z60A 1MM3A 3PUQA 5C13A 2C2VS 2VPBA 2ECNA 1MM2A 2F42A 3PHDA 2LRIC 2C2LA 2RR4A 4IC2A 1ZBDB 3ZYQA 3LQIA 5LKTA 1BORA 3GL6A 2BAYA 2YW8A 1LDJB 2KKXA 2FSAA 2KGIA 2ECIA 1WEVA 4A0CD 1HYIA
chains in the Genus database with same CATH topology
4XI1A 5TABA 4YBMA 2ECVA 2KWJA 5DINA 2L80A 3ZPV1 3SHBA 3KV5A 4B7YC 4YABA 2F6JA 5LKZA 4A4BA 1WIMA 4Q6FA 2LGKA 5B77A 1IYMA 2L5UA 2ECWA 1WEMA 2MIQA 5B76A 3U5NA 4FJCA 2JMIA 2F6NA 5H1VA 3L1XA 5C11A 3N9LA 3PURA 1VFYA 1CHCA 3U5MA 4NN2A 4UP0A 4YADA 2VPEA 2KGGA 2L43A 2ECJA 3HCSA 4UP5A 4S3OB 5KH9A 3M63A 5KH7A 2KR4A 2QIZA 3NG2A 2CT2A 2KWKA 4GNGA 4AP4A 5I3LA 3M62A 4L7XA 2QJ0A 2JRJA 4YBTA 2LXHC 2RI7A 2VPGA 1WEUA 2H0DB 3SOXA 2LGVA 4MVTA 2CSZA 5FB0A 2M1RA 2LDRA 3ASLA 2YUCA 4W4UA 1WEQA 5H1TA 2VPDA 5EYAF 4N3WA 5D1MB 2KWNA 5H1UA 3L11A 1T1HA 1WILA 4BBQA 2Y43A 5D1LB 1X4IA 2ECGA 5TBNA 3EB5A 2M85A 1WEPA 4X3GA 2MD8C 2KYUA 3RPGC 1WENA 4ZUXU 1WEOA 2M6MA 3N9OA 1N87A 5B78A 5D1KB 1WE9A 1JOCA 2EGPA 2YURA 4FO9A 4A4CA 2Y1MA 4WZ3B 2FUIA 3O7AA 5KH3A 2AN6A 3ZPVE 1JM7B 4QF2A 2LQ6A 1G25A 4QF3A 3V43A 2G6QA 5B75A 4GNDA 2LV9A 5FERA 3N9QA 2HYED 4LKAA 4B86C 3ZTGA 1JM7A 3HTKC 3MHHA 3C6WA 4TKPB 3T7LA 2K4DA 1WEWA 2KU3A 4LK9A 5DKAA 2MT5A 4FK5A 3IHPA 5AIUA 3O37A 3KNVA 3M99A 4WZ2A 1K2FA 2G45A 4YC9A 5AITA 5LCWB 3VK6A 4N4FA 5G05B 2YHNA 4A49A 2KFTA 2KIZA 3FL2A 1WGMA 4YAXA 3O34A 4R8PK 1WEEA 2VJFA 3ZNIA 2MA5A 2YHOA 2ZETC 2LN0A 2EODA 5TDWA 2E6RA 5J3XA 2PNXA 1Z2QA 3ZVZB 3KV6A 2YQLA 1Z6UA 3DPLR 2HDPA 1FP0A 4V3KC 2NAAA 2DX8A 4AYCA 2K17A 2MUMA 4I7CA 4FIPA 2XEUA 2MNZA 2KREA 2YT5A 4S3OC 5B79A 2MNYA 3L1ZB 4UI9B 2EA6A 4GB0A 3N9PA 3U5PA 2VP7A 1F62A 2KWOA 2JMDA 2MD7B 3SOUA 2YREA 2UZGA 2XB1A 2E6SA 4BHWA 2QICA 2G43A 4LLBA 3DQVR 2CKLA 4V3LC 4ZQLA 3O70A 5H9MA 3I2DA 1X4UA 3EB6A 3LQHA 2YYRA 2LGLA 3O35A 4R2YA 2KE1A 2LXPC 2Y1NA 2LGGA 2VNFA 4GNEA 4ZDTA 5JG6A 2D8SA 4YBSA 2YU4A 4CCGX 2YSJA 1HYJA 5LKXA 2VJEB 4CA1A 1U6GB 4AUQB 1WESA 2VJEA 3GV4A 4PPEA 4IC3A 4WA6A 3ZVYA 4LJNA 4GNFA 3KQIA 4MSXA 2JMJA 5B8DA 3O33A 5TRBA 3U5OA 4LADB 4WZ0A 2CSYA 4O64A 2VJFB 3O36A 4I7DA 2MA6A 1WFKA 3T6RA 1FBVA 2IDAA 5FB1A 2FUUA 4L58A 1DVPA 1VD4A 4I7BA 3LRQA 3RTRB 2PUYA 4R7EA 3HCUA 3N9MA 1VYXA 2ECTA 2K16A 3C5KA 5G0FA 4AYCB 1XWHA 4YATA 2YQMA 4F52B 3N9NA 2K1JA 2OXQC 4PTBA 5G04B 4AVXA 5LKUA 1X4JA 2YSMA 3HCTA 5TDRA 3QZVA 2L75A 1V87A 3MHSA 3SOWA 1LDKC 4P5OB 3RPGB 1E4UA 5FEYA 2I50A 2CKLB 2M3HA 2H0DA 2L0BA 2RSDA 4C9ZA 1RMDA 3LQJA 1Z60A 1MM3A 3PUQA 5C13A 2C2VS 2VPBA 2ECNA 1MM2A 2F42A 3PHDA 2LRIC 2C2LA 4IC2A 1ZBDB 3ZYQA 3LQIA 5LKTA 1BORA 3GL6A 2BAYA 2YW8A 1LDJB 2FSAA 2KGIA 2ECIA 1WEVA 4A0CD 1HYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI1 A;  5TAB A;  4YBM A;  2ECV A;  2KWJ A;  5DIN A;  2L80 A;  3ZPV 1;  3SHB A;  3KV5 A;  4B7Y C;  4YAB A;  2F6J A;  5LKZ A;  4A4B A;  1WIM A;  4Q6F A;  2LGK A;  5B77 A;  1IYM A;  2L5U A;  2ECW A;  1WEM A;  2MIQ A;  5B76 A;  3U5N A;  4FJC A;  2JMI A;  2F6N A;  5H1V A;  3L1X A;  5C11 A;  3N9L A;  3PUR A;  1VFY A;  1CHC A;  3U5M A;  4NN2 A;  4UP0 A;  4YAD A;  2VPE A;  2KGG A;  2L43 A;  2ECJ A;  3HCS A;  4UP5 A;  4S3O B;  5KH9 A;  3M63 A;  5KH7 A;  2KR4 A;  2QIZ A;  3NG2 A;  2CT2 A;  2KWK A;  4GNG A;  4AP4 A;  5I3L A;  3M62 A;  4L7X A;  2QJ0 A;  2JRJ A;  4YBT A;  2LXH C;  2RI7 A;  2VPG A;  1WEU A;  2H0D B;  3SOX A;  2LGV A;  4MVT A;  2CSZ A;  5FB0 A;  2M1R A;  2LDR A;  3ASL A;  2YUC A;  4W4U A;  1WEQ A;  5H1T A;  2VPD A;  5EYA F;  4N3W A;  5D1M B;  2KWN A;  5H1U A;  3L11 A;  1T1H A;  1WIL A;  4BBQ A;  2Y43 A;  5D1L B;  1X4I A;  2ECG A;  5TBN A;  3EB5 A;  2M85 A;  1WEP A;  4X3G A;  2MD8 C;  2KYU A;  3RPG C;  1WEN A;  4ZUX U;  1WEO A;  2M6M A;  3N9O A;  1N87 A;  5B78 A;  5D1K B;  1WE9 A;  1JOC A;  2EGP A;  2YUR A;  4FO9 A;  4A4C A;  2Y1M A;  4WZ3 B;  2FUI A;  3O7A A;  5KH3 A;  2AN6 A;  3ZPV E;  1JM7 B;  4QF2 A;  2LQ6 A;  1G25 A;  4QF3 A;  3V43 A;  2G6Q A;  5B75 A;  4GND A;  2LV9 A;  5FER A;  3N9Q A;  2HYE D;  4LKA A;  4B86 C;  3ZTG A;  1JM7 A;  3HTK C;  3MHH A;  3C6W A;  4TKP B;  3T7L A;  2K4D A;  1WEW A;  2KU3 A;  4LK9 A;  5DKA A;  2MT5 A;  4FK5 A;  3IHP A;  5AIU A;  3O37 A;  3KNV A;  3M99 A;  4WZ2 A;  1K2F A;  2G45 A;  4YC9 A;  5AIT A;  5LCW B;  3VK6 A;  4N4F A;  5G05 B;  2YHN A;  4A49 A;  2KFT A;  2KIZ A;  3FL2 A;  1WGM A;  4YAX A;  3O34 A;  4R8P K;  1WEE A;  2VJF A;  3ZNI A;  2MA5 A;  2YHO A;  2ZET C;  2LN0 A;  2EOD A;  5TDW A;  2E6R A;  5J3X A;  2PNX A;  1Z2Q A;  3ZVZ B;  3KV6 A;  2YQL A;  1Z6U A;  3DPL R;  2HDP A;  1FP0 A;  4V3K C;  2NAA A;  2DX8 A;  4AYC A;  2K17 A;  2MUM A;  4I7C A;  4FIP A;  2XEU A;  2MNZ A;  2KRE A;  2YT5 A;  4S3O C;  5B79 A;  2MNY A;  3L1Z B;  4UI9 B;  2EA6 A;  4GB0 A;  3N9P A;  3U5P A;  2VP7 A;  1F62 A;  2KWO A;  2JMD A;  2MD7 B;  3SOU A;  2YRE A;  2UZG A;  2XB1 A;  2E6S A;  4BHW A;  2QIC A;  2G43 A;  4LLB A;  3DQV R;  2CKL A;  4V3L C;  4ZQL A;  3O70 A;  5H9M A;  3I2D A;  1X4U A;  3EB6 A;  3LQH A;  2YYR A;  2LGL A;  3O35 A;  4R2Y A;  2KE1 A;  2LXP C;  2Y1N A;  2LGG A;  2VNF A;  4GNE A;  4ZDT A;  5JG6 A;  2D8S A;  4YBS A;  2YU4 A;  4CCG X;  2YSJ A;  1HYJ A;  5LKX A;  2VJE B;  4CA1 A;  1U6G B;  4AUQ B;  1WES A;  2VJE A;  3GV4 A;  4PPE A;  4IC3 A;  4WA6 A;  3ZVY A;  4LJN A;  4GNF A;  3KQI A;  4MSX A;  2JMJ A;  5B8D A;  3O33 A;  5TRB A;  3U5O A;  4LAD B;  4WZ0 A;  2CSY A;  4O64 A;  2VJF B;  3O36 A;  4I7D A;  2MA6 A;  1WFK A;  3T6R A;  1FBV A;  2IDA A;  5FB1 A;  2FUU A;  4L58 A;  1DVP A;  1VD4 A;  4I7B A;  3LRQ A;  3RTR B;  2PUY A;  4R7E A;  3HCU A;  3N9M A;  1VYX A;  2ECT A;  2K16 A;  3C5K A;  5G0F A;  4AYC B;  1XWH A;  4YAT A;  2YQM A;  4F52 B;  3N9N A;  2K1J A;  2OXQ C;  4PTB A;  5G04 B;  4AVX A;  5LKU A;  1X4J A;  2YSM A;  3HCT A;  5TDR A;  3QZV A;  2L75 A;  1V87 A;  3MHS A;  3SOW A;  1LDK C;  4P5O B;  3RPG B;  1E4U A;  5FEY A;  2I50 A;  2CKL B;  2M3H A;  2H0D A;  2L0B A;  2RSD A;  4C9Z A;  1RMD A;  3LQJ A;  1Z60 A;  1MM3 A;  3PUQ A;  5C13 A;  2C2V S;  2VPB A;  2ECN A;  1MM2 A;  2F42 A;  3PHD A;  2LRI C;  2C2L A;  4IC2 A;  1ZBD B;  3ZYQ A;  3LQI A;  5LKT A;  1BOR A;  3GL6 A;  2BAY A;  2YW8 A;  1LDJ B;  2FSA A;  2KGI A;  2ECI A;  1WEV A;  4A0C D;  1HYI A; 
#chains in the Genus database with same CATH topology
 2EXU A;  4XI1 A;  5TAB A;  2CSV A;  4YBM A;  2ECV A;  2KWJ A;  5DIN A;  2L80 A;  3ZPV 1;  1DCQ A;  3SHB A;  3KV5 A;  4B7Y C;  4YAB A;  2F6J A;  5LKZ A;  4A4B A;  1WIM A;  2P57 A;  4Q6F A;  2LGK A;  5B77 A;  1IYM A;  2KKY A;  2L5U A;  2L7P A;  2ECW A;  1WEM A;  2MIQ A;  5B76 A;  3U5N A;  3DDT A;  3FEH A;  4H9D A;  4FJC A;  2JMI A;  2F6N A;  5H1V A;  2JUN A;  3L1X A;  5C11 A;  3N9L A;  3PUR A;  1VFY A;  1CHC A;  3U5M A;  2FFW A;  4NN2 A;  4UP0 A;  3FAO A;  4YAD A;  2VPE A;  2KGG A;  2L43 A;  2ECJ A;  3HCS A;  4UP5 A;  4S3O B;  5KH9 A;  3M63 A;  5KH7 A;  2KR4 A;  2QIZ A;  3NG2 A;  2CT2 A;  3MDB C;  2FD4 A;  4OGC A;  2KWK A;  4GNG A;  4AP4 A;  5I3L A;  3M62 A;  4L7X A;  2QJ0 A;  2JRJ A;  4YBT A;  2LXH C;  3LJU X;  2RI7 A;  3H7H A;  2VPG A;  1WEU A;  2H0D B;  3SOX A;  2LGV A;  4MVT A;  2CSZ A;  5FB0 A;  4O62 A;  2M1R A;  2LDR A;  3ASL A;  1MBM A;  3T9K A;  2YUC A;  4W4U A;  1WEQ A;  5H1T A;  2VPD A;  4N3W A;  5EYA F;  5D1M B;  2KWN A;  5H1U A;  3L11 A;  1T1H A;  1WIL A;  4BBQ A;  2Y43 A;  5D1L B;  1X4I A;  3O47 A;  2ECG A;  5TBN A;  3EB5 A;  2M85 A;  1WEP A;  4X3G A;  2MD8 C;  2KYU A;  3RPG C;  1WEN A;  4ZUX U;  1WEO A;  2M6M A;  3N9O A;  1N87 A;  5B78 A;  5D1K B;  1WE9 A;  1JOC A;  2EGP A;  3FM8 C;  2YUR A;  4FO9 A;  4A4C A;  2Y1M A;  4WZ3 B;  2FUI A;  3O7A A;  5KH3 A;  2YVR A;  2AN6 A;  3ZPV E;  5SVI B;  4QQ4 A;  1JM7 B;  4QF2 A;  2LQ6 A;  1G25 A;  4QF3 A;  3V43 A;  2G6Q A;  5B75 A;  4GND A;  2LV9 A;  5FER A;  3N9Q A;  2HYE D;  5SVI A;  4LKA A;  4B86 C;  3ZTG A;  1JM7 A;  3HTK C;  3MHH A;  3C6W A;  4TKP B;  3LVQ E;  3T7L A;  2K4D A;  1WEW A;  2KU3 A;  4LK9 A;  5DKA A;  2MT5 A;  4FK5 A;  3IHP A;  5AIU A;  3O37 A;  3KNV A;  3M99 A;  4WZ2 A;  1K2F A;  2EGM A;  2G45 A;  4YC9 A;  3SUB A;  5AIT A;  5LCW B;  3VK6 A;  4N4F A;  5G05 B;  2YHN A;  4A49 A;  2KFT A;  2CRW A;  2DJA A;  2KIZ A;  3FL2 A;  1WGM A;  4YAX A;  3O34 A;  4R8P K;  1WEE A;  2VJF A;  5SVY A;  3ZNI A;  2MA5 A;  2YHO A;  2ZET C;  2LN0 A;  2EOD A;  5TDW A;  2E6R A;  5J3X A;  2PNX A;  1Z2Q A;  3ZVZ B;  3KV6 A;  2YQL A;  1Z6U A;  2B0O E;  3DPL R;  2HDP A;  1FP0 A;  4V3K C;  2M13 A;  2NAA A;  2DX8 A;  5SVX A;  3PLW A;  4AYC A;  2K17 A;  2MUM A;  2D8U A;  4I7C A;  4FIP A;  2XEU A;  2MNZ A;  2KRE A;  2YT5 A;  4S3O C;  5B79 A;  2MNY A;  3L1Z B;  4UI9 B;  2EA6 A;  4GB0 A;  3N9P A;  3U5P A;  2IQJ A;  3JUE A;  2VP7 A;  1F62 A;  2KWO A;  2CRR A;  2JMD A;  2XOZ A;  3LVR E;  2MD7 B;  3SOU A;  2YRE A;  4F1P A;  2UZG A;  3FJU B;  2XB1 A;  2E6S A;  4BHW A;  2QIC A;  2G43 A;  4LLB A;  3DQV R;  5K3Q A;  3DWD A;  2CKL A;  4V3L C;  2XOC A;  4ZQL A;  3O70 A;  5H9M A;  3I2D A;  4Z0O A;  1X4U A;  3EB6 A;  3LQH A;  2YYR A;  2LGL A;  3O35 A;  4R2Y A;  2OWA A;  2KE1 A;  2LXP C;  2Y1N A;  2LAU A;  2LGG A;  2VNF A;  3Q1D A;  4GNE A;  2DSM A;  4ZDT A;  5JG6 A;  2D8S A;  4YBS A;  2YU4 A;  4CCG X;  2YSJ A;  1HYJ A;  5LKX A;  2VJE B;  4CA1 A;  1U6G B;  4AUQ B;  1WES A;  3FAN A;  2JM3 A;  3E2D A;  2VJE A;  2XP0 A;  3GV4 A;  4IC3 A;  4PPE A;  4WA6 A;  3ZVY A;  4LJN A;  4GNF A;  3KQI A;  4MSX A;  2JMJ A;  5B8D A;  3O33 A;  5TRB A;  2CON A;  3U5O A;  4LAD B;  4WZ0 A;  2CSY A;  4O64 A;  2VJF B;  3O36 A;  4I7D A;  2MA6 A;  1WFK A;  3T6R A;  3LDY A;  3KDE C;  1FBV A;  2IDA A;  2MKE A;  2FUU A;  4L58 A;  5FB1 A;  1DVP A;  1VD4 A;  4I7B A;  3LRQ A;  3RTR B;  4OGE A;  2PUY A;  4R7E A;  3HCU A;  3N9M A;  1VYX A;  2ECT A;  2K16 A;  3C5K A;  5G0F A;  4AYC B;  1XWH A;  4YAT A;  2YQM A;  4F52 B;  3N9N A;  2K1J A;  3M7K A;  2OXQ C;  4PTB A;  5G04 B;  4AVX A;  5LKU A;  1X4J A;  2YSM A;  3HCT A;  5TDR A;  2XOY A;  3QZV A;  2L75 A;  1V87 A;  3MHS A;  3SOW A;  1LDK C;  2E61 A;  4P5O B;  3RPG B;  1E4U A;  5FEY A;  2I50 A;  2CKL B;  2M3H A;  4Z0R A;  2H0D A;  2L0B A;  2RSD A;  4C9Z A;  1RMD A;  3LQJ A;  1Z60 A;  1MM3 A;  3PUQ A;  5C13 A;  2C2V S;  2VPB A;  2ECN A;  1MM2 A;  2F42 A;  3PHD A;  2LRI C;  2C2L A;  2RR4 A;  4IC2 A;  1ZBD B;  3ZYQ A;  3LQI A;  5LKT A;  1BOR A;  3GL6 A;  2BAY A;  2YW8 A;  1LDJ B;  2KKX A;  2FSA A;  2KGI A;  2ECI A;  1WEV A;  4A0C D;  1HYI A; 
#chains in the Genus database with same CATH homology
 4XI1 A;  5TAB A;  4YBM A;  2ECV A;  2KWJ A;  5DIN A;  2L80 A;  3ZPV 1;  3SHB A;  3KV5 A;  4B7Y C;  4YAB A;  2F6J A;  5LKZ A;  4A4B A;  1WIM A;  4Q6F A;  2LGK A;  5B77 A;  1IYM A;  2L5U A;  2ECW A;  1WEM A;  2MIQ A;  5B76 A;  3U5N A;  4FJC A;  2JMI A;  2F6N A;  5H1V A;  3L1X A;  5C11 A;  3N9L A;  3PUR A;  1VFY A;  1CHC A;  3U5M A;  4NN2 A;  4UP0 A;  4YAD A;  2VPE A;  2KGG A;  2L43 A;  2ECJ A;  3HCS A;  4UP5 A;  4S3O B;  5KH9 A;  3M63 A;  5KH7 A;  2KR4 A;  2QIZ A;  3NG2 A;  2CT2 A;  2KWK A;  4GNG A;  4AP4 A;  5I3L A;  3M62 A;  4L7X A;  2QJ0 A;  2JRJ A;  4YBT A;  2LXH C;  2RI7 A;  2VPG A;  1WEU A;  2H0D B;  3SOX A;  2LGV A;  4MVT A;  2CSZ A;  5FB0 A;  2M1R A;  2LDR A;  3ASL A;  2YUC A;  4W4U A;  1WEQ A;  5H1T A;  2VPD A;  5EYA F;  4N3W A;  5D1M B;  2KWN A;  5H1U A;  3L11 A;  1T1H A;  1WIL A;  4BBQ A;  2Y43 A;  5D1L B;  1X4I A;  2ECG A;  5TBN A;  3EB5 A;  2M85 A;  1WEP A;  4X3G A;  2MD8 C;  2KYU A;  3RPG C;  1WEN A;  4ZUX U;  1WEO A;  2M6M A;  3N9O A;  1N87 A;  5B78 A;  5D1K B;  1WE9 A;  1JOC A;  2EGP A;  2YUR A;  4FO9 A;  4A4C A;  2Y1M A;  4WZ3 B;  2FUI A;  3O7A A;  5KH3 A;  2AN6 A;  3ZPV E;  1JM7 B;  4QF2 A;  2LQ6 A;  1G25 A;  4QF3 A;  3V43 A;  2G6Q A;  5B75 A;  4GND A;  2LV9 A;  5FER A;  3N9Q A;  2HYE D;  4LKA A;  4B86 C;  3ZTG A;  1JM7 A;  3HTK C;  3MHH A;  3C6W A;  4TKP B;  3T7L A;  2K4D A;  1WEW A;  2KU3 A;  4LK9 A;  5DKA A;  2MT5 A;  4FK5 A;  3IHP A;  5AIU A;  3O37 A;  3KNV A;  3M99 A;  4WZ2 A;  1K2F A;  2G45 A;  4YC9 A;  5AIT A;  5LCW B;  3VK6 A;  4N4F A;  5G05 B;  2YHN A;  4A49 A;  2KFT A;  2KIZ A;  3FL2 A;  1WGM A;  4YAX A;  3O34 A;  4R8P K;  1WEE A;  2VJF A;  3ZNI A;  2MA5 A;  2YHO A;  2ZET C;  2LN0 A;  2EOD A;  5TDW A;  2E6R A;  5J3X A;  2PNX A;  1Z2Q A;  3ZVZ B;  3KV6 A;  2YQL A;  1Z6U A;  3DPL R;  2HDP A;  1FP0 A;  4V3K C;  2NAA A;  2DX8 A;  4AYC A;  2K17 A;  2MUM A;  4I7C A;  4FIP A;  2XEU A;  2MNZ A;  2KRE A;  2YT5 A;  4S3O C;  5B79 A;  2MNY A;  3L1Z B;  4UI9 B;  2EA6 A;  4GB0 A;  3N9P A;  3U5P A;  2VP7 A;  1F62 A;  2KWO A;  2JMD A;  2MD7 B;  3SOU A;  2YRE A;  2UZG A;  2XB1 A;  2E6S A;  4BHW A;  2QIC A;  2G43 A;  4LLB A;  3DQV R;  2CKL A;  4V3L C;  4ZQL A;  3O70 A;  5H9M A;  3I2D A;  1X4U A;  3EB6 A;  3LQH A;  2YYR A;  2LGL A;  3O35 A;  4R2Y A;  2KE1 A;  2LXP C;  2Y1N A;  2LGG A;  2VNF A;  4GNE A;  4ZDT A;  5JG6 A;  2D8S A;  4YBS A;  2YU4 A;  4CCG X;  2YSJ A;  1HYJ A;  5LKX A;  2VJE B;  4CA1 A;  1U6G B;  4AUQ B;  1WES A;  2VJE A;  3GV4 A;  4PPE A;  4IC3 A;  4WA6 A;  3ZVY A;  4LJN A;  4GNF A;  3KQI A;  4MSX A;  2JMJ A;  5B8D A;  3O33 A;  5TRB A;  3U5O A;  4LAD B;  4WZ0 A;  2CSY A;  4O64 A;  2VJF B;  3O36 A;  4I7D A;  2MA6 A;  1WFK A;  3T6R A;  1FBV A;  2IDA A;  5FB1 A;  2FUU A;  4L58 A;  1DVP A;  1VD4 A;  4I7B A;  3LRQ A;  3RTR B;  2PUY A;  4R7E A;  3HCU A;  3N9M A;  1VYX A;  2ECT A;  2K16 A;  3C5K A;  5G0F A;  4AYC B;  1XWH A;  4YAT A;  2YQM A;  4F52 B;  3N9N A;  2K1J A;  2OXQ C;  4PTB A;  5G04 B;  4AVX A;  5LKU A;  1X4J A;  2YSM A;  3HCT A;  5TDR A;  3QZV A;  2L75 A;  1V87 A;  3MHS A;  3SOW A;  1LDK C;  4P5O B;  3RPG B;  1E4U A;  5FEY A;  2I50 A;  2CKL B;  2M3H A;  2H0D A;  2L0B A;  2RSD A;  4C9Z A;  1RMD A;  3LQJ A;  1Z60 A;  1MM3 A;  3PUQ A;  5C13 A;  2C2V S;  2VPB A;  2ECN A;  1MM2 A;  2F42 A;  3PHD A;  2LRI C;  2C2L A;  4IC2 A;  1ZBD B;  3ZYQ A;  3LQI A;  5LKT A;  1BOR A;  3GL6 A;  2BAY A;  2YW8 A;  1LDJ B;  2FSA A;  2KGI A;  2ECI A;  1WEV A;  4A0C D;  1HYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...