2E6SA

Solution structure of the phd domain in ring finger protein 107
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
77
structure length
77
Chain Sequence
GSSGSSGRNDTECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords E3 ubiquitin-protein ligase UHRF2
publication title Solution structure of the PHD domain in RING finger protein 107
rcsb
source organism Homo sapiens
total genus 3
structure length 77
sequence length 77
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2e6sA00
1X4IA 1HYIA 2M6MA 3PURA 2YQMA 1WEMA 4X3GA 2YT5A 4I7DA 2MD7B 3LQIA 3C5KA 5B76A 4QF2A 2YUCA 2LN0A 1U6GB 2YQLA 4R2YA 2VJFB 2LXPC 5J3XA 5C11A 1ZBDB 5LKTA 4L7XA 3ZNIA 4XI1A 4LADB 5D1LB 1CHCA 2H0DB 2CT2A 2YU4A 4LLBA 3QZVA 2CSYA 3N9NA 2RI7A 2QJ0A 3GV4A 3SHBA 2LGLA 2VP7A 4A4BA 5B79A 2KR4A 3O33A 3M63A 5H1VA 5AIUA 4AYCA 4UP0A 2EODA 2ECJA 4AP4A 4YATA 4CA1A 2KFTA 3HCUA 3ZPVE 2YHNA 5D1MB 1HYJA 4B86C 2VPDA 1WILA 5TRBA 2Y1NA 2JRJA 3RPGB 3RPGC 2KGIA 4GNEA 2CKLA 1Z6UA 3ZVZB 5H1UA 4YC9A 4FO9A 3EB5A 3KNVA 2LXHC 4GNDA 3DPLR 3I2DA 2KWOA 2UZGA 2VNFA 4UI9B 3L1XA 3KV5A 1WEPA 1LDJB 1JM7A 4GB0A 4ZUXU 2G43A 2KYUA 5H9MA 5LCWB 1V87A 2K4DA 2JMJA 1Z60A 2MA5A 2PNXA 1RMDA 2KWKA 3MHSA 2ECTA 5JG6A 4W4UA 4WZ3B 5LKUA 3LRQA 5TDWA 2Y1MA 2VJEB 2MNYA 2C2LA 2YREA 1E4UA 2LDRA 3M99A 5FB0A 1VFYA 2LV9A 2XB1A 4WZ2A 2LGKA 5LKZA 1X4JA 1N87A 3O7AA 4A4CA 3MHHA 1MM2A 3ZTGA 2ECWA 2YYRA 2NAAA 5KH9A 1WEUA 2KU3A 4AYCB 4BHWA 3GL6A 4YBSA 3N9QA 4YAXA 5KH7A 4LJNA 1Z2QA 3NG2A 4P5OB 2BAYA 3SOWA 2VJFA 1WEQA 5C13A 2HDPA 4ZQLA 2M3HA 5AITA 4YABA 1IYMA 2FUIA 2FUUA 3L1ZB 4NN2A 2VPGA 3PUQA 4YBMA 2L5UA 1WESA 4LK9A 2LGVA 4YBTA 2I50A 2CKLB 2G6QA 4PTBA 1WE9A 2MNZA 4A49A 3FL2A 1T1HA 3PHDA 2YHOA 2MIQA 3O70A 3O34A 2KIZA 4L58A 5G0FA 2RSDA 2MD8C 4QF3A 1WGMA 2L43A 3N9MA 5B77A 2CSZA 2OXQC 4WZ0A 1WIMA 4UP5A 2VPBA 1FP0A 3DQVR 1BORA 2C2VS 3N9LA 2LRIC 3KV6A 5TABA 2KWJA 4AVXA 2YSJA 2MT5A 3C6WA 2YURA 4C9ZA 4O64A 4S3OB 4S3OC 5G05B 1MM3A 2QICA 4GNGA 2ECNA 1FBVA 3KQIA 1JOCA 4FIPA 4V3KC 4YADA 3U5NA 4MSXA 5FEYA 3RTRB 4B7YC 4PPEA 3O37A 2JMDA 4N4FA 4FJCA 5FERA 4GNFA 3M62A 3EB6A 5DINA 4CCGX 2ECVA 2IDAA 5TBNA 1X4UA 3O36A 4LKAA 4V3LC 2L0BA 4R7EA 2LQ6A 1WEOA 4IC2A 1WENA 2M85A 1F62A 3U5PA 2M1RA 2VJEA 3LQJA 4BBQA 2D8SA 2KWNA 2KREA 3ZVYA 1VD4A 3IHPA 5G04B 3HTKC 2KE1A 2VPEA 2K1JA 4R8PK 4I7CA 4ZDTA 5H1TA 2G45A 3U5MA 2LGGA 5FB1A 1LDKC 2EGPA 4MVTA 2ECGA 4Q6FA 2YW8A 3N9PA 3SOUA 2L80A 1WEWA 1XWHA 2H0DA 3HCTA 5B8DA 3ZYQA 1DVPA 3T6RA 2L75A 3N9OA 3SOXA 1K2FA 2F42A 3ZPV1 2HYED 2MA6A 4F52B 2F6NA 4I7BA 2EA6A 5KH3A 3U5OA 2E6RA 2DX8A 1WFKA 5D1KB 5DKAA 3T7LA 2QIZA 4N3WA 2MUMA 5EYAF 5B75A 1VYXA 1JM7B 2E6SA 3HCSA 1G25A 4WA6A 4TKPB 5I3LA 4IC3A 1WEEA 2KGGA 3O35A 4FK5A 4A0CD 2XEUA 2YSMA 5TDRA 3L11A 2K16A 5LKXA 3LQHA 4AUQB 2AN6A 2JMIA 1WEVA 2Y43A 2ZETC 2FSAA 2K17A 2F6JA 3VK6A 2ECIA 2PUYA 5B78A 3V43A 3ASLA
chains in the Genus database with same CATH superfamily
1X4IA 1HYIA 2P57A 2M6MA 3PURA 3DDTA 2RR4A 2YQMA 1WEMA 4X3GA 2YT5A 4I7DA 3Q1DA 2MD7B 4O62A 3E2DA 2XOYA 3LQIA 3C5KA 5B76A 4QF2A 2YUCA 2LN0A 1U6GB 2YQLA 4R2YA 3FANA 2VJFB 2LXPC 5J3XA 2D8UA 5C11A 1ZBDB 5LKTA 4L7XA 3ZNIA 4XI1A 4LADB 5D1LB 1CHCA 2H0DB 2CT2A 2YU4A 4LLBA 3QZVA 2CSYA 2CSVA 3N9NA 2CRRA 2RI7A 2QJ0A 3GV4A 3SHBA 2LGLA 2VP7A 4A4BA 5B79A 2KR4A 3O33A 3M63A 5H1VA 4Z0RA 5AIUA 4AYCA 4UP0A 2EODA 2ECJA 4AP4A 4YATA 4OGCA 4CA1A 2KFTA 2M13A 3HCUA 3ZPVE 5SVXA 2YHNA 4QQ4A 5D1MB 1HYJA 4B86C 2VPDA 1WILA 2XOCA 5TRBA 1DCQA 2Y1NA 2JRJA 3RPGB 3RPGC 2KGIA 4GNEA 2CKLA 1Z6UA 3ZVZB 5H1UA 4YC9A 4FO9A 3EB5A 3KNVA 2LXHC 4GNDA 3DPLR 3I2DA 5K3QA 2KWOA 2UZGA 2JM3A 2VNFA 4UI9B 3L1XA 3KV5A 1WEPA 1LDJB 1JM7A 2IQJA 4GB0A 2B0OE 5SVIA 4ZUXU 3PLWA 2G43A 2KYUA 5H9MA 5LCWB 1V87A 2MKEA 2K4DA 2PNXA 1Z60A 2JMJA 2MA5A 1RMDA 2KWKA 3MHSA 2ECTA 5JG6A 4W4UA 4WZ3B 5LKUA 3LRQA 2CONA 4OGEA 5TDWA 2Y1MA 2EXUA 2VJEB 2MNYA 2C2LA 2YREA 1E4UA 2LDRA 3M99A 5FB0A 1VFYA 2LV9A 2XB1A 4WZ2A 2KKXA 2LGKA 5LKZA 2CRWA 1X4JA 4Z0OA 1N87A 5SVYA 3O7AA 4A4CA 3MHHA 1MM2A 3O47A 2E61A 3ZTGA 2ECWA 2YYRA 2NAAA 5KH9A 1WEUA 2KU3A 4AYCB 4BHWA 2LAUA 3GL6A 4YBSA 3N9QA 4YAXA 5KH7A 4LJNA 3JUEA 1Z2QA 3NG2A 4P5OB 2BAYA 3SOWA 2VJFA 1WEQA 5C13A 2HDPA 4ZQLA 2M3HA 5AITA 3LJUX 4YABA 1IYMA 2FUIA 2FUUA 3L1ZB 4NN2A 2VPGA 3PUQA 4YBMA 2DSMA 2L5UA 1WESA 4LK9A 2LGVA 4YBTA 2I50A 2CKLB 2G6QA 4PTBA 1WE9A 2MNZA 4A49A 3SUBA 3FL2A 1T1HA 3PHDA 2YHOA 3FM8C 2MIQA 2JUNA 3O70A 3O34A 2KIZA 4L58A 2L7PA 5G0FA 4H9DA 2RSDA 2YVRA 3MDBC 2MD8C 4QF3A 1WGMA 2L43A 3KDEC 5SVIB 3LVRE 3N9MA 5B77A 2CSZA 2OXQC 4WZ0A 1WIMA 4UP5A 2VPBA 1FP0A 3DQVR 1BORA 2C2VS 3N9LA 2LRIC 3KV6A 5TABA 2KWJA 4AVXA 2YSJA 2MT5A 3C6WA 2YURA 4C9ZA 4O64A 4S3OB 4S3OC 5G05B 1MM3A 4GNGA 2QICA 3LVQE 2ECNA 1FBVA 3KQIA 1JOCA 4FIPA 4V3KC 4YADA 3U5NA 4MSXA 5FEYA 3RTRB 4B7YC 4PPEA 3O37A 2JMDA 4N4FA 4FJCA 5FERA 4GNFA 3T9KA 3M62A 3EB6A 5DINA 4CCGX 2ECVA 2IDAA 5TBNA 1X4UA 3O36A 3M7KA 4LKAA 4V3LC 2L0BA 4R7EA 2LQ6A 1WEOA 4IC2A 1WENA 2M85A 1F62A 2FFWA 3U5PA 2M1RA 2XOZA 2VJEA 3LQJA 4BBQA 2D8SA 2KWNA 2KREA 3ZVYA 1VD4A 3IHPA 5G04B 3HTKC 2KE1A 2EGMA 2DJAA 2KKYA 2VPEA 2K1JA 4R8PK 4I7CA 4ZDTA 5H1TA 2G45A 3U5MA 2LGGA 5FB1A 1LDKC 2EGPA 4MVTA 2ECGA 4Q6FA 2YW8A 3N9PA 3SOUA 2L80A 1WEWA 1XWHA 2H0DA 3HCTA 5B8DA 3ZYQA 1DVPA 3T6RA 2L75A 3N9OA 3SOXA 1K2FA 2F42A 3ZPV1 2HYED 2MA6A 4F52B 2F6NA 4I7BA 2EA6A 5KH3A 2FD4A 3U5OA 2E6RA 2DX8A 1WFKA 5D1KB 5DKAA 1MBMA 3T7LA 2QIZA 4N3WA 2MUMA 3FEHA 3FAOA 5EYAF 4F1PA 5B75A 1VYXA 1JM7B 2E6SA 3HCSA 1G25A 4WA6A 3H7HA 4TKPB 3LDYA 3FJUB 5I3LA 4IC3A 1WEEA 2OWAA 3DWDA 2KGGA 3O35A 4FK5A 4A0CD 2XEUA 2YSMA 5TDRA 3L11A 2K16A 5LKXA 3LQHA 4AUQB 2AN6A 2JMIA 1WEVA 2Y43A 2ZETC 2FSAA 2K17A 2XP0A 2F6JA 3VK6A 2ECIA 2PUYA 5B78A 3V43A 3ASLA
chains in the Genus database with same CATH topology
1X4IA 1HYIA 2M6MA 3PURA 2YQMA 1WEMA 4X3GA 2YT5A 4I7DA 2MD7B 3LQIA 3C5KA 5B76A 4QF2A 2YUCA 2LN0A 1U6GB 2YQLA 4R2YA 2VJFB 2LXPC 5J3XA 5C11A 1ZBDB 5LKTA 4L7XA 3ZNIA 4XI1A 4LADB 5D1LB 1CHCA 2H0DB 2CT2A 2YU4A 4LLBA 3QZVA 2CSYA 3N9NA 2RI7A 2QJ0A 3GV4A 3SHBA 2LGLA 2VP7A 4A4BA 5B79A 2KR4A 3O33A 3M63A 5H1VA 5AIUA 4AYCA 4UP0A 2EODA 2ECJA 4AP4A 4YATA 4CA1A 2KFTA 3HCUA 3ZPVE 2YHNA 5D1MB 1HYJA 4B86C 2VPDA 1WILA 5TRBA 2Y1NA 2JRJA 3RPGB 3RPGC 2KGIA 4GNEA 2CKLA 1Z6UA 3ZVZB 5H1UA 4YC9A 4FO9A 3EB5A 3KNVA 2LXHC 4GNDA 3DPLR 3I2DA 2KWOA 2UZGA 2VNFA 4UI9B 3L1XA 3KV5A 1WEPA 1LDJB 1JM7A 4GB0A 4ZUXU 2G43A 2KYUA 5H9MA 5LCWB 1V87A 2K4DA 2JMJA 1Z60A 2MA5A 2PNXA 1RMDA 2KWKA 3MHSA 2ECTA 5JG6A 4W4UA 4WZ3B 5LKUA 3LRQA 5TDWA 2Y1MA 2VJEB 2MNYA 2C2LA 2YREA 1E4UA 2LDRA 3M99A 5FB0A 1VFYA 2LV9A 2XB1A 4WZ2A 2LGKA 5LKZA 1X4JA 1N87A 3O7AA 4A4CA 3MHHA 1MM2A 3ZTGA 2ECWA 2YYRA 2NAAA 5KH9A 1WEUA 2KU3A 4AYCB 4BHWA 3GL6A 4YBSA 3N9QA 4YAXA 5KH7A 4LJNA 1Z2QA 3NG2A 4P5OB 2BAYA 3SOWA 2VJFA 1WEQA 5C13A 2HDPA 4ZQLA 2M3HA 5AITA 4YABA 1IYMA 2FUIA 2FUUA 3L1ZB 4NN2A 2VPGA 3PUQA 4YBMA 2L5UA 1WESA 4LK9A 2LGVA 4YBTA 2I50A 2CKLB 2G6QA 4PTBA 1WE9A 2MNZA 4A49A 3FL2A 1T1HA 3PHDA 2YHOA 2MIQA 3O70A 3O34A 2KIZA 4L58A 5G0FA 2RSDA 2MD8C 4QF3A 1WGMA 2L43A 3N9MA 5B77A 2CSZA 2OXQC 4WZ0A 1WIMA 4UP5A 2VPBA 1FP0A 3DQVR 1BORA 2C2VS 3N9LA 2LRIC 3KV6A 5TABA 2KWJA 4AVXA 2YSJA 2MT5A 3C6WA 2YURA 4C9ZA 4O64A 4S3OB 4S3OC 5G05B 1MM3A 2QICA 4GNGA 2ECNA 1FBVA 3KQIA 1JOCA 4FIPA 4V3KC 4YADA 3U5NA 4MSXA 5FEYA 3RTRB 4B7YC 4PPEA 3O37A 2JMDA 4N4FA 4FJCA 5FERA 4GNFA 3M62A 3EB6A 5DINA 4CCGX 2ECVA 2IDAA 5TBNA 1X4UA 3O36A 4LKAA 4V3LC 2L0BA 4R7EA 2LQ6A 1WEOA 4IC2A 1WENA 2M85A 1F62A 3U5PA 2M1RA 2VJEA 3LQJA 4BBQA 2D8SA 2KWNA 2KREA 3ZVYA 1VD4A 3IHPA 5G04B 3HTKC 2KE1A 2VPEA 2K1JA 4R8PK 4I7CA 4ZDTA 5H1TA 2G45A 3U5MA 2LGGA 5FB1A 1LDKC 2EGPA 4MVTA 2ECGA 4Q6FA 2YW8A 3N9PA 3SOUA 2L80A 1WEWA 1XWHA 2H0DA 3HCTA 5B8DA 3ZYQA 1DVPA 3T6RA 2L75A 3N9OA 3SOXA 1K2FA 2F42A 3ZPV1 2HYED 2MA6A 4F52B 2F6NA 4I7BA 2EA6A 5KH3A 3U5OA 2E6RA 2DX8A 1WFKA 5D1KB 5DKAA 3T7LA 2QIZA 4N3WA 2MUMA 5EYAF 5B75A 1VYXA 1JM7B 2E6SA 3HCSA 1G25A 4WA6A 4TKPB 5I3LA 4IC3A 1WEEA 2KGGA 3O35A 4FK5A 4A0CD 2XEUA 2YSMA 5TDRA 3L11A 2K16A 5LKXA 3LQHA 4AUQB 2AN6A 2JMIA 1WEVA 2Y43A 2ZETC 2FSAA 2K17A 2F6JA 3VK6A 2ECIA 2PUYA 5B78A 3V43A 3ASLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4I A;  1HYI A;  2M6M A;  3PUR A;  2YQM A;  1WEM A;  4X3G A;  2YT5 A;  4I7D A;  2MD7 B;  3LQI A;  3C5K A;  5B76 A;  4QF2 A;  2YUC A;  2LN0 A;  1U6G B;  2YQL A;  4R2Y A;  2VJF B;  2LXP C;  5J3X A;  5C11 A;  1ZBD B;  5LKT A;  4L7X A;  3ZNI A;  4XI1 A;  4LAD B;  5D1L B;  1CHC A;  2H0D B;  2CT2 A;  2YU4 A;  4LLB A;  3QZV A;  2CSY A;  3N9N A;  2RI7 A;  2QJ0 A;  3GV4 A;  3SHB A;  2LGL A;  2VP7 A;  4A4B A;  5B79 A;  2KR4 A;  3O33 A;  3M63 A;  5H1V A;  5AIU A;  4AYC A;  4UP0 A;  2EOD A;  2ECJ A;  4AP4 A;  4YAT A;  4CA1 A;  2KFT A;  3HCU A;  3ZPV E;  2YHN A;  5D1M B;  1HYJ A;  4B86 C;  2VPD A;  1WIL A;  5TRB A;  2Y1N A;  2JRJ A;  3RPG B;  3RPG C;  2KGI A;  4GNE A;  2CKL A;  1Z6U A;  3ZVZ B;  5H1U A;  4YC9 A;  4FO9 A;  3EB5 A;  3KNV A;  2LXH C;  4GND A;  3DPL R;  3I2D A;  2KWO A;  2UZG A;  2VNF A;  4UI9 B;  3L1X A;  3KV5 A;  1WEP A;  1LDJ B;  1JM7 A;  4GB0 A;  4ZUX U;  2G43 A;  2KYU A;  5H9M A;  5LCW B;  1V87 A;  2K4D A;  2JMJ A;  1Z60 A;  2MA5 A;  2PNX A;  1RMD A;  2KWK A;  3MHS A;  2ECT A;  5JG6 A;  4W4U A;  4WZ3 B;  5LKU A;  3LRQ A;  5TDW A;  2Y1M A;  2VJE B;  2MNY A;  2C2L A;  2YRE A;  1E4U A;  2LDR A;  3M99 A;  5FB0 A;  1VFY A;  2LV9 A;  2XB1 A;  4WZ2 A;  2LGK A;  5LKZ A;  1X4J A;  1N87 A;  3O7A A;  4A4C A;  3MHH A;  1MM2 A;  3ZTG A;  2ECW A;  2YYR A;  2NAA A;  5KH9 A;  1WEU A;  2KU3 A;  4AYC B;  4BHW A;  3GL6 A;  4YBS A;  3N9Q A;  4YAX A;  5KH7 A;  4LJN A;  1Z2Q A;  3NG2 A;  4P5O B;  2BAY A;  3SOW A;  2VJF A;  1WEQ A;  5C13 A;  2HDP A;  4ZQL A;  2M3H A;  5AIT A;  4YAB A;  1IYM A;  2FUI A;  2FUU A;  3L1Z B;  4NN2 A;  2VPG A;  3PUQ A;  4YBM A;  2L5U A;  1WES A;  4LK9 A;  2LGV A;  4YBT A;  2I50 A;  2CKL B;  2G6Q A;  4PTB A;  1WE9 A;  2MNZ A;  4A49 A;  3FL2 A;  1T1H A;  3PHD A;  2YHO A;  2MIQ A;  3O70 A;  3O34 A;  2KIZ A;  4L58 A;  5G0F A;  2RSD A;  2MD8 C;  4QF3 A;  1WGM A;  2L43 A;  3N9M A;  5B77 A;  2CSZ A;  2OXQ C;  4WZ0 A;  1WIM A;  4UP5 A;  2VPB A;  1FP0 A;  3DQV R;  1BOR A;  2C2V S;  3N9L A;  2LRI C;  3KV6 A;  5TAB A;  2KWJ A;  4AVX A;  2YSJ A;  2MT5 A;  3C6W A;  2YUR A;  4C9Z A;  4O64 A;  4S3O B;  4S3O C;  5G05 B;  1MM3 A;  2QIC A;  4GNG A;  2ECN A;  1FBV A;  3KQI A;  1JOC A;  4FIP A;  4V3K C;  4YAD A;  3U5N A;  4MSX A;  5FEY A;  3RTR B;  4B7Y C;  4PPE A;  3O37 A;  2JMD A;  4N4F A;  4FJC A;  5FER A;  4GNF A;  3M62 A;  3EB6 A;  5DIN A;  4CCG X;  2ECV A;  2IDA A;  5TBN A;  1X4U A;  3O36 A;  4LKA A;  4V3L C;  2L0B A;  4R7E A;  2LQ6 A;  1WEO A;  4IC2 A;  1WEN A;  2M85 A;  1F62 A;  3U5P A;  2M1R A;  2VJE A;  3LQJ A;  4BBQ A;  2D8S A;  2KWN A;  2KRE A;  3ZVY A;  1VD4 A;  3IHP A;  5G04 B;  3HTK C;  2KE1 A;  2VPE A;  2K1J A;  4R8P K;  4I7C A;  4ZDT A;  5H1T A;  2G45 A;  3U5M A;  2LGG A;  5FB1 A;  1LDK C;  2EGP A;  4MVT A;  2ECG A;  4Q6F A;  2YW8 A;  3N9P A;  3SOU A;  2L80 A;  1WEW A;  1XWH A;  2H0D A;  3HCT A;  5B8D A;  3ZYQ A;  1DVP A;  3T6R A;  2L75 A;  3N9O A;  3SOX A;  1K2F A;  2F42 A;  3ZPV 1;  2HYE D;  2MA6 A;  4F52 B;  2F6N A;  4I7B A;  2EA6 A;  5KH3 A;  3U5O A;  2E6R A;  2DX8 A;  1WFK A;  5D1K B;  5DKA A;  3T7L A;  2QIZ A;  4N3W A;  2MUM A;  5EYA F;  5B75 A;  1VYX A;  1JM7 B;  2E6S A;  3HCS A;  1G25 A;  4WA6 A;  4TKP B;  5I3L A;  4IC3 A;  1WEE A;  2KGG A;  3O35 A;  4FK5 A;  4A0C D;  2XEU A;  2YSM A;  5TDR A;  3L11 A;  2K16 A;  5LKX A;  3LQH A;  4AUQ B;  2AN6 A;  2JMI A;  1WEV A;  2Y43 A;  2ZET C;  2FSA A;  2K17 A;  2F6J A;  3VK6 A;  2ECI A;  2PUY A;  5B78 A;  3V43 A;  3ASL A; 
#chains in the Genus database with same CATH topology
 1X4I A;  1HYI A;  2P57 A;  2M6M A;  3PUR A;  3DDT A;  2RR4 A;  2YQM A;  1WEM A;  4X3G A;  2YT5 A;  4I7D A;  3Q1D A;  2MD7 B;  4O62 A;  3E2D A;  2XOY A;  3LQI A;  3C5K A;  5B76 A;  4QF2 A;  2YUC A;  2LN0 A;  1U6G B;  2YQL A;  4R2Y A;  3FAN A;  2VJF B;  2LXP C;  5J3X A;  2D8U A;  5C11 A;  1ZBD B;  5LKT A;  4L7X A;  3ZNI A;  4XI1 A;  4LAD B;  5D1L B;  1CHC A;  2H0D B;  2CT2 A;  2YU4 A;  4LLB A;  3QZV A;  2CSY A;  2CSV A;  3N9N A;  2CRR A;  2RI7 A;  2QJ0 A;  3GV4 A;  3SHB A;  2LGL A;  2VP7 A;  4A4B A;  5B79 A;  2KR4 A;  3O33 A;  3M63 A;  5H1V A;  4Z0R A;  5AIU A;  4AYC A;  4UP0 A;  2EOD A;  2ECJ A;  4AP4 A;  4YAT A;  4OGC A;  4CA1 A;  2KFT A;  2M13 A;  3HCU A;  3ZPV E;  5SVX A;  2YHN A;  4QQ4 A;  5D1M B;  1HYJ A;  4B86 C;  2VPD A;  1WIL A;  2XOC A;  5TRB A;  1DCQ A;  2Y1N A;  2JRJ A;  3RPG B;  3RPG C;  2KGI A;  4GNE A;  2CKL A;  1Z6U A;  3ZVZ B;  5H1U A;  4YC9 A;  4FO9 A;  3EB5 A;  3KNV A;  2LXH C;  4GND A;  3DPL R;  3I2D A;  5K3Q A;  2KWO A;  2UZG A;  2JM3 A;  2VNF A;  4UI9 B;  3L1X A;  3KV5 A;  1WEP A;  1LDJ B;  1JM7 A;  2IQJ A;  4GB0 A;  2B0O E;  5SVI A;  4ZUX U;  3PLW A;  2G43 A;  2KYU A;  5H9M A;  5LCW B;  1V87 A;  2MKE A;  2K4D A;  2PNX A;  1Z60 A;  2JMJ A;  2MA5 A;  1RMD A;  2KWK A;  3MHS A;  2ECT A;  5JG6 A;  4W4U A;  4WZ3 B;  5LKU A;  3LRQ A;  2CON A;  4OGE A;  5TDW A;  2Y1M A;  2EXU A;  2VJE B;  2MNY A;  2C2L A;  2YRE A;  1E4U A;  2LDR A;  3M99 A;  5FB0 A;  1VFY A;  2LV9 A;  2XB1 A;  4WZ2 A;  2KKX A;  2LGK A;  5LKZ A;  2CRW A;  1X4J A;  4Z0O A;  1N87 A;  5SVY A;  3O7A A;  4A4C A;  3MHH A;  1MM2 A;  3O47 A;  2E61 A;  3ZTG A;  2ECW A;  2YYR A;  2NAA A;  5KH9 A;  1WEU A;  2KU3 A;  4AYC B;  4BHW A;  2LAU A;  3GL6 A;  4YBS A;  3N9Q A;  4YAX A;  5KH7 A;  4LJN A;  3JUE A;  1Z2Q A;  3NG2 A;  4P5O B;  2BAY A;  3SOW A;  2VJF A;  1WEQ A;  5C13 A;  2HDP A;  4ZQL A;  2M3H A;  5AIT A;  3LJU X;  4YAB A;  1IYM A;  2FUI A;  2FUU A;  3L1Z B;  4NN2 A;  2VPG A;  3PUQ A;  4YBM A;  2DSM A;  2L5U A;  1WES A;  4LK9 A;  2LGV A;  4YBT A;  2I50 A;  2CKL B;  2G6Q A;  4PTB A;  1WE9 A;  2MNZ A;  4A49 A;  3SUB A;  3FL2 A;  1T1H A;  3PHD A;  2YHO A;  3FM8 C;  2MIQ A;  2JUN A;  3O70 A;  3O34 A;  2KIZ A;  4L58 A;  2L7P A;  5G0F A;  4H9D A;  2RSD A;  2YVR A;  3MDB C;  2MD8 C;  4QF3 A;  1WGM A;  2L43 A;  3KDE C;  5SVI B;  3LVR E;  3N9M A;  5B77 A;  2CSZ A;  2OXQ C;  4WZ0 A;  1WIM A;  4UP5 A;  2VPB A;  1FP0 A;  3DQV R;  1BOR A;  2C2V S;  3N9L A;  2LRI C;  3KV6 A;  5TAB A;  2KWJ A;  4AVX A;  2YSJ A;  2MT5 A;  3C6W A;  2YUR A;  4C9Z A;  4O64 A;  4S3O B;  4S3O C;  5G05 B;  1MM3 A;  4GNG A;  2QIC A;  3LVQ E;  2ECN A;  1FBV A;  3KQI A;  1JOC A;  4FIP A;  4V3K C;  4YAD A;  3U5N A;  4MSX A;  5FEY A;  3RTR B;  4B7Y C;  4PPE A;  3O37 A;  2JMD A;  4N4F A;  4FJC A;  5FER A;  4GNF A;  3T9K A;  3M62 A;  3EB6 A;  5DIN A;  4CCG X;  2ECV A;  2IDA A;  5TBN A;  1X4U A;  3O36 A;  3M7K A;  4LKA A;  4V3L C;  2L0B A;  4R7E A;  2LQ6 A;  1WEO A;  4IC2 A;  1WEN A;  2M85 A;  1F62 A;  2FFW A;  3U5P A;  2M1R A;  2XOZ A;  2VJE A;  3LQJ A;  4BBQ A;  2D8S A;  2KWN A;  2KRE A;  3ZVY A;  1VD4 A;  3IHP A;  5G04 B;  3HTK C;  2KE1 A;  2EGM A;  2DJA A;  2KKY A;  2VPE A;  2K1J A;  4R8P K;  4I7C A;  4ZDT A;  5H1T A;  2G45 A;  3U5M A;  2LGG A;  5FB1 A;  1LDK C;  2EGP A;  4MVT A;  2ECG A;  4Q6F A;  2YW8 A;  3N9P A;  3SOU A;  2L80 A;  1WEW A;  1XWH A;  2H0D A;  3HCT A;  5B8D A;  3ZYQ A;  1DVP A;  3T6R A;  2L75 A;  3N9O A;  3SOX A;  1K2F A;  2F42 A;  3ZPV 1;  2HYE D;  2MA6 A;  4F52 B;  2F6N A;  4I7B A;  2EA6 A;  5KH3 A;  2FD4 A;  3U5O A;  2E6R A;  2DX8 A;  1WFK A;  5D1K B;  5DKA A;  1MBM A;  3T7L A;  2QIZ A;  4N3W A;  2MUM A;  3FEH A;  3FAO A;  5EYA F;  4F1P A;  5B75 A;  1VYX A;  1JM7 B;  2E6S A;  3HCS A;  1G25 A;  4WA6 A;  3H7H A;  4TKP B;  3LDY A;  3FJU B;  5I3L A;  4IC3 A;  1WEE A;  2OWA A;  3DWD A;  2KGG A;  3O35 A;  4FK5 A;  4A0C D;  2XEU A;  2YSM A;  5TDR A;  3L11 A;  2K16 A;  5LKX A;  3LQH A;  4AUQ B;  2AN6 A;  2JMI A;  1WEV A;  2Y43 A;  2ZET C;  2FSA A;  2K17 A;  2XP0 A;  2F6J A;  3VK6 A;  2ECI A;  2PUY A;  5B78 A;  3V43 A;  3ASL A; 
#chains in the Genus database with same CATH homology
 1X4I A;  1HYI A;  2M6M A;  3PUR A;  2YQM A;  1WEM A;  4X3G A;  2YT5 A;  4I7D A;  2MD7 B;  3LQI A;  3C5K A;  5B76 A;  4QF2 A;  2YUC A;  2LN0 A;  1U6G B;  2YQL A;  4R2Y A;  2VJF B;  2LXP C;  5J3X A;  5C11 A;  1ZBD B;  5LKT A;  4L7X A;  3ZNI A;  4XI1 A;  4LAD B;  5D1L B;  1CHC A;  2H0D B;  2CT2 A;  2YU4 A;  4LLB A;  3QZV A;  2CSY A;  3N9N A;  2RI7 A;  2QJ0 A;  3GV4 A;  3SHB A;  2LGL A;  2VP7 A;  4A4B A;  5B79 A;  2KR4 A;  3O33 A;  3M63 A;  5H1V A;  5AIU A;  4AYC A;  4UP0 A;  2EOD A;  2ECJ A;  4AP4 A;  4YAT A;  4CA1 A;  2KFT A;  3HCU A;  3ZPV E;  2YHN A;  5D1M B;  1HYJ A;  4B86 C;  2VPD A;  1WIL A;  5TRB A;  2Y1N A;  2JRJ A;  3RPG B;  3RPG C;  2KGI A;  4GNE A;  2CKL A;  1Z6U A;  3ZVZ B;  5H1U A;  4YC9 A;  4FO9 A;  3EB5 A;  3KNV A;  2LXH C;  4GND A;  3DPL R;  3I2D A;  2KWO A;  2UZG A;  2VNF A;  4UI9 B;  3L1X A;  3KV5 A;  1WEP A;  1LDJ B;  1JM7 A;  4GB0 A;  4ZUX U;  2G43 A;  2KYU A;  5H9M A;  5LCW B;  1V87 A;  2K4D A;  2JMJ A;  1Z60 A;  2MA5 A;  2PNX A;  1RMD A;  2KWK A;  3MHS A;  2ECT A;  5JG6 A;  4W4U A;  4WZ3 B;  5LKU A;  3LRQ A;  5TDW A;  2Y1M A;  2VJE B;  2MNY A;  2C2L A;  2YRE A;  1E4U A;  2LDR A;  3M99 A;  5FB0 A;  1VFY A;  2LV9 A;  2XB1 A;  4WZ2 A;  2LGK A;  5LKZ A;  1X4J A;  1N87 A;  3O7A A;  4A4C A;  3MHH A;  1MM2 A;  3ZTG A;  2ECW A;  2YYR A;  2NAA A;  5KH9 A;  1WEU A;  2KU3 A;  4AYC B;  4BHW A;  3GL6 A;  4YBS A;  3N9Q A;  4YAX A;  5KH7 A;  4LJN A;  1Z2Q A;  3NG2 A;  4P5O B;  2BAY A;  3SOW A;  2VJF A;  1WEQ A;  5C13 A;  2HDP A;  4ZQL A;  2M3H A;  5AIT A;  4YAB A;  1IYM A;  2FUI A;  2FUU A;  3L1Z B;  4NN2 A;  2VPG A;  3PUQ A;  4YBM A;  2L5U A;  1WES A;  4LK9 A;  2LGV A;  4YBT A;  2I50 A;  2CKL B;  2G6Q A;  4PTB A;  1WE9 A;  2MNZ A;  4A49 A;  3FL2 A;  1T1H A;  3PHD A;  2YHO A;  2MIQ A;  3O70 A;  3O34 A;  2KIZ A;  4L58 A;  5G0F A;  2RSD A;  2MD8 C;  4QF3 A;  1WGM A;  2L43 A;  3N9M A;  5B77 A;  2CSZ A;  2OXQ C;  4WZ0 A;  1WIM A;  4UP5 A;  2VPB A;  1FP0 A;  3DQV R;  1BOR A;  2C2V S;  3N9L A;  2LRI C;  3KV6 A;  5TAB A;  2KWJ A;  4AVX A;  2YSJ A;  2MT5 A;  3C6W A;  2YUR A;  4C9Z A;  4O64 A;  4S3O B;  4S3O C;  5G05 B;  1MM3 A;  2QIC A;  4GNG A;  2ECN A;  1FBV A;  3KQI A;  1JOC A;  4FIP A;  4V3K C;  4YAD A;  3U5N A;  4MSX A;  5FEY A;  3RTR B;  4B7Y C;  4PPE A;  3O37 A;  2JMD A;  4N4F A;  4FJC A;  5FER A;  4GNF A;  3M62 A;  3EB6 A;  5DIN A;  4CCG X;  2ECV A;  2IDA A;  5TBN A;  1X4U A;  3O36 A;  4LKA A;  4V3L C;  2L0B A;  4R7E A;  2LQ6 A;  1WEO A;  4IC2 A;  1WEN A;  2M85 A;  1F62 A;  3U5P A;  2M1R A;  2VJE A;  3LQJ A;  4BBQ A;  2D8S A;  2KWN A;  2KRE A;  3ZVY A;  1VD4 A;  3IHP A;  5G04 B;  3HTK C;  2KE1 A;  2VPE A;  2K1J A;  4R8P K;  4I7C A;  4ZDT A;  5H1T A;  2G45 A;  3U5M A;  2LGG A;  5FB1 A;  1LDK C;  2EGP A;  4MVT A;  2ECG A;  4Q6F A;  2YW8 A;  3N9P A;  3SOU A;  2L80 A;  1WEW A;  1XWH A;  2H0D A;  3HCT A;  5B8D A;  3ZYQ A;  1DVP A;  3T6R A;  2L75 A;  3N9O A;  3SOX A;  1K2F A;  2F42 A;  3ZPV 1;  2HYE D;  2MA6 A;  4F52 B;  2F6N A;  4I7B A;  2EA6 A;  5KH3 A;  3U5O A;  2E6R A;  2DX8 A;  1WFK A;  5D1K B;  5DKA A;  3T7L A;  2QIZ A;  4N3W A;  2MUM A;  5EYA F;  5B75 A;  1VYX A;  1JM7 B;  2E6S A;  3HCS A;  1G25 A;  4WA6 A;  4TKP B;  5I3L A;  4IC3 A;  1WEE A;  2KGG A;  3O35 A;  4FK5 A;  4A0C D;  2XEU A;  2YSM A;  5TDR A;  3L11 A;  2K16 A;  5LKX A;  3LQH A;  4AUQ B;  2AN6 A;  2JMI A;  1WEV A;  2Y43 A;  2ZET C;  2FSA A;  2K17 A;  2F6J A;  3VK6 A;  2ECI A;  2PUY A;  5B78 A;  3V43 A;  3ASL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...