2E6SA

Solution structure of the phd domain in ring finger protein 107
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
77
structure length
77
Chain Sequence
GSSGSSGRNDTECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF2
publication title Solution structure of the PHD domain in RING finger protein 107
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 3
structure length 77
sequence length 77
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2e6sA00
5FB1A 4AP4A 1IYMA 3M99A 2VNFA 1WESA 3EB6A 3ZNIA 4GB0A 5TBNA 2KR4A 3PUQA 2K1JA 2MNZA 1WEQA 3DQVR 1WE9A 5B77A 4A0CD 1FP0A 4S3OC 4FO9A 1ZBDB 1WENA 1X4UA 4B7YC 5TRBA 2G45A 4AYCA 4WZ0A 2EA6A 2G43A 4UP0A 4QF3A 5LKTA 3IHPA 3L11A 4ZUXU 5AIUA 3SOXA 2ECTA 2UZGA 4BHWA 2VJFB 2KWOA 5G05B 2MUMA 3N9MA 3HCUA 3NG2A 5B79A 3SOUA 4PTBA 2C2LA 5EYAF 3O37A 4YBSA 2AN6A 1WEMA 1WEOA 3N9LA 2HYED 2KU3A 2CKLA 2MNYA 3LQJA 2L0BA 5H9MA 5B76A 2ECJA 2LXPC 1WEPA 5LKXA 4O64A 1MM3A 5J3XA 1XWHA 5KH3A 5C11A 2KIZA 2YHNA 3ZPVE 2NAAA 2KE1A 2M6MA 3O33A 4UP5A 4A4CA 4YBMA 3RPGB 4GNEA 1G25A 4YC9A 1JOCA 2Y1MA 5B75A 5TABA 5D1KB 4I7DA 4N4FA 1WIMA 2M3HA 2CSYA 1K2FA 2E6SA 3U5PA 3U5MA 1X4JA 2VP7A 2LGLA 5G0FA 2DX8A 2YW8A 5D1LB 4YADA 1X4IA 4LJNA 1Z6UA 3N9OA 3O34A 2ECVA 4X3GA 3N9PA 2K17A 4YABA 4NN2A 2KWNA 2G6QA 2YHOA 2JMDA 4V3KC 2QICA 2H0DA 3FL2A 4ZDTA 3VK6A 1LDJB 4LK9A 2ZETC 4LADB 2VJEA 1U6GB 1WEEA 2JMIA 2YSMA 4MVTA 5DINA 2EODA 5C13A 1WILA 2F42A 5JG6A 5LKZA 3HCSA 3N9NA 2YYRA 1WFKA 5LCWB 4PPEA 1WEWA 3ZPV1 2VPBA 5D1MB 3O70A 2KWJA 3GL6A 1F62A 1LDKC 3ASLA 5FB0A 2KREA 2KYUA 1RMDA 2ECGA 4UI9B 2ECNA 2ECWA 3KNVA 1WGMA 4WZ2A 2FSAA 5FERA 2K16A 3LQHA 1HYJA 4R2YA 4YAXA 2PNXA 5B78A 2XEUA 4GNGA 3PHDA 2FUIA 3KV6A 4GNFA 2F6NA 4N3WA 3RTRB 2YURA 3EB5A 3O7AA 3T6RA 1VFYA 4A4BA 2PUYA 5AITA 5I3LA 3ZVZB 1N87A 3M63A 2IDAA 3HCTA 1JM7B 4ZQLA 1E4UA 2OXQC 2LXHC 2YU4A 2M1RA 3C6WA 5H1TA 4YATA 3RPGC 4FK5A 3U5OA 2YQLA 1VD4A 4B86C 2MA5A 2F6JA 5LKUA 5TDWA 2QIZA 3T7LA 3SOWA 4V3LC 2JMJA 3ZYQA 2H0DB 3N9QA 4IC2A 2K4DA 2LDRA 2YT5A 2LGKA 1CHCA 5B8DA 4AUQB 1DVPA 3QZVA 2YQMA 4S3OB 3O36A 2YSJA 2JRJA 4FIPA 4AYCB 3C5KA 2VPEA 3PURA 3U5NA 2XB1A 4GNDA 2YREA 3ZVYA 4WA6A 2VPGA 4MSXA 2CSZA 2KWKA 2I50A 2MT5A 2MD7B 4LLBA 4TKPB 2L80A 2RSDA 3HTKC 2E6RA 4P5OB 4R8PK 1VYXA 2L5UA 2L75A 4FJCA 4Q6FA 3DPLR 2CKLB 2VPDA 4I7BA 2LQ6A 2D8SA 2FUUA 4QF2A 2VJFA 2BAYA 2MIQA 4LKAA 3L1ZB 4F52B 5G04B 2EGPA 4CCGX 4YBTA 3O35A 2M85A 1MM2A 1FBVA 3V43A 3ZTGA 2LN0A 4IC3A 4XI1A 3MHHA 3MHSA 5H1VA 3I2DA 5FEYA 4L7XA 2HDPA 3GV4A 3SHBA 2MA6A 5KH9A 3LQIA 5TDRA 3KV5A 2RI7A 1Z60A 4W4UA 4A49A 2KGGA 1BORA 2YUCA 5DKAA 4R7EA 1V87A 2LGGA 4BBQA 2C2VS 2KGIA 3KQIA 2Y1NA 2Y43A 4C9ZA 1HYIA 3L1XA 1T1HA 2CT2A 2LRIC 2L43A 2MD8C 4L58A 1WEUA 3M62A 4AVXA 1Z2QA 1JM7A 2ECIA 4WZ3B 2LGVA 2QJ0A 5H1UA 5KH7A 4CA1A 4I7CA 2KFTA 1WEVA 2LV9A 2VJEB 3LRQA
chains in the Genus database with same CATH superfamily
5FB1A 4AP4A 1IYMA 3M99A 2VNFA 1WESA 3EB6A 3ZNIA 3FAOA 4GB0A 5TBNA 2KR4A 3PUQA 2K1JA 2MNZA 1WEQA 3DQVR 1WE9A 5B77A 4A0CD 1FP0A 2JUNA 4S3OC 4FO9A 1ZBDB 3DWDA 1WENA 1X4UA 4B7YC 2EXUA 5TRBA 2G45A 4AYCA 4WZ0A 2EA6A 2G43A 4UP0A 4QF3A 5LKTA 2XOZA 3IHPA 3L11A 4ZUXU 5AIUA 4Z0OA 2ECTA 2UZGA 3SOXA 4BHWA 2VJFB 2KWOA 5G05B 2MUMA 3N9MA 3HCUA 3LVQE 3NG2A 5B79A 4OGEA 3SOUA 4PTBA 2C2LA 5EYAF 3O37A 4YBSA 2AN6A 1WEMA 1WEOA 3N9LA 2HYED 2KU3A 2CKLA 2MNYA 3LQJA 2L0BA 2CRWA 5H9MA 5B76A 2ECJA 2LXPC 1WEPA 2M13A 5LKXA 4O64A 1MBMA 1MM3A 5J3XA 1XWHA 5KH3A 5C11A 2KIZA 2YHNA 2CRRA 3ZPVE 2NAAA 2KE1A 2M6MA 3O33A 4UP5A 3LJUX 4A4CA 4YBMA 2DJAA 3RPGB 4GNEA 1G25A 3H7HA 4YC9A 2KKXA 1JOCA 2Y1MA 5B75A 5TABA 5D1KB 4I7DA 4N4FA 1WIMA 2M3HA 2CSYA 1K2FA 2E6SA 3U5PA 3U5MA 1X4JA 2VP7A 2LGLA 2CSVA 5G0FA 2D8UA 2DX8A 2YW8A 5D1LB 4YADA 3FJUB 1X4IA 2MKEA 4LJNA 1Z6UA 2L7PA 3N9OA 3O34A 2ECVA 4X3GA 3N9PA 2K17A 4YABA 4NN2A 2KWNA 2G6QA 2YHOA 2JMDA 4V3KC 2QICA 2H0DA 3FL2A 4ZDTA 3VK6A 1LDJB 4LK9A 3M7KA 2ZETC 4LADB 2VJEA 1U6GB 1WEEA 2JMIA 2YSMA 4MVTA 5DINA 2EODA 3KDEC 5C13A 1WILA 2F42A 5JG6A 3PLWA 5LKZA 3HCSA 3N9NA 2YYRA 1WFKA 3FM8C 4PPEA 5LCWB 1WEWA 3ZPV1 2VPBA 5D1MB 5SVIA 3O70A 2FFWA 2KWJA 3GL6A 1F62A 1LDKC 3ASLA 5FB0A 2KREA 2KYUA 1RMDA 2ECGA 4UI9B 2ECNA 2ECWA 3KNVA 1WGMA 4WZ2A 2FSAA 5FERA 2K16A 3LQHA 1HYJA 4R2YA 4YAXA 2PNXA 2XOCA 5B78A 3LDYA 2XEUA 4GNGA 3PHDA 2FUIA 3KV6A 4GNFA 2F6NA 2E61A 4N3WA 3JUEA 3RTRB 2YURA 3EB5A 2XP0A 3O7AA 3T6RA 1VFYA 4A4BA 2PUYA 5AITA 5I3LA 3ZVZB 1N87A 3Q1DA 3DDTA 3M63A 2IDAA 3HCTA 1JM7B 4ZQLA 1E4UA 2OXQC 2LXHC 2YU4A 2M1RA 2XOYA 3C6WA 5H1TA 4YATA 3RPGC 4FK5A 3U5OA 2YQLA 1VD4A 2FD4A 2MA5A 4B86C 2F6JA 5LKUA 5TDWA 2QIZA 3MDBC 3T7LA 3SOWA 5K3QA 4V3LC 2JMJA 2KKYA 3ZYQA 2H0DB 3N9QA 4IC2A 2K4DA 2LDRA 2OWAA 2YT5A 2LGKA 1CHCA 5B8DA 4AUQB 1DVPA 3QZVA 2YQMA 3O36A 4S3OB 2YSJA 2JRJA 4O62A 4FIPA 4AYCB 3C5KA 2VPEA 3PURA 3U5NA 2XB1A 4GNDA 2YREA 3ZVYA 4WA6A 2VPGA 4MSXA 2CSZA 2KWKA 2I50A 2DSMA 2MT5A 2YVRA 2MD7B 4LLBA 4TKPB 2L80A 2RSDA 3HTKC 2E6RA 4P5OB 4R8PK 1VYXA 5SVIB 2L5UA 2L75A 4FJCA 4Q6FA 3DPLR 2IQJA 2JM3A 3E2DA 2CKLB 2VPDA 4I7BA 2LQ6A 2D8SA 2FUUA 4QF2A 2VJFA 2EGMA 2BAYA 2MIQA 4LKAA 3L1ZB 4F52B 5G04B 2EGPA 4CCGX 4YBTA 3O35A 2M85A 1MM2A 1FBVA 3V43A 3ZTGA 5SVYA 2LN0A 4IC3A 3SUBA 4XI1A 3MHHA 3MHSA 5H1VA 3I2DA 5FEYA 4L7XA 2HDPA 3GV4A 4Z0RA 3SHBA 2MA6A 5KH9A 3FANA 3LQIA 5TDRA 3KV5A 2RI7A 1Z60A 4OGCA 4W4UA 5SVXA 4H9DA 4A49A 2KGGA 1BORA 4F1PA 2YUCA 5DKAA 4R7EA 1V87A 2CONA 1DCQA 2LGGA 4BBQA 3LVRE 4QQ4A 3FEHA 2C2VS 2KGIA 3KQIA 2Y1NA 2Y43A 2P57A 2RR4A 4C9ZA 3T9KA 3L1XA 1HYIA 1T1HA 2CT2A 2LAUA 2LRIC 2L43A 2MD8C 4L58A 1WEUA 3M62A 4AVXA 1Z2QA 1JM7A 3O47A 2ECIA 4WZ3B 2LGVA 2QJ0A 2B0OE 5H1UA 5KH7A 4CA1A 4I7CA 2KFTA 1WEVA 2LV9A 2VJEB 3LRQA
chains in the Genus database with same CATH topology
5FB1A 4AP4A 1IYMA 3M99A 2VNFA 1WESA 3EB6A 3ZNIA 4GB0A 5TBNA 2KR4A 3PUQA 2K1JA 2MNZA 1WEQA 3DQVR 1WE9A 5B77A 4A0CD 1FP0A 4S3OC 4FO9A 1ZBDB 1WENA 1X4UA 4B7YC 5TRBA 2G45A 4AYCA 4WZ0A 2EA6A 2G43A 4UP0A 4QF3A 5LKTA 3IHPA 3L11A 4ZUXU 5AIUA 3SOXA 2ECTA 2UZGA 4BHWA 2VJFB 2KWOA 5G05B 2MUMA 3N9MA 3HCUA 3NG2A 5B79A 3SOUA 4PTBA 2C2LA 5EYAF 3O37A 4YBSA 2AN6A 1WEMA 1WEOA 3N9LA 2HYED 2KU3A 2CKLA 2MNYA 3LQJA 2L0BA 5H9MA 5B76A 2ECJA 2LXPC 1WEPA 5LKXA 4O64A 1MM3A 5J3XA 1XWHA 5KH3A 5C11A 2KIZA 2YHNA 3ZPVE 2NAAA 2KE1A 2M6MA 3O33A 4UP5A 4A4CA 4YBMA 3RPGB 4GNEA 1G25A 4YC9A 1JOCA 2Y1MA 5B75A 5TABA 5D1KB 4I7DA 4N4FA 1WIMA 2M3HA 2CSYA 1K2FA 2E6SA 3U5PA 3U5MA 1X4JA 2VP7A 2LGLA 5G0FA 2DX8A 2YW8A 5D1LB 4YADA 1X4IA 4LJNA 1Z6UA 3N9OA 3O34A 2ECVA 4X3GA 3N9PA 2K17A 4YABA 4NN2A 2KWNA 2G6QA 2YHOA 2JMDA 4V3KC 2QICA 2H0DA 3FL2A 4ZDTA 3VK6A 1LDJB 4LK9A 2ZETC 4LADB 2VJEA 1U6GB 1WEEA 2JMIA 2YSMA 4MVTA 5DINA 2EODA 5C13A 1WILA 2F42A 5JG6A 5LKZA 3HCSA 3N9NA 2YYRA 1WFKA 5LCWB 4PPEA 1WEWA 3ZPV1 2VPBA 5D1MB 3O70A 2KWJA 3GL6A 1F62A 1LDKC 3ASLA 5FB0A 2KREA 2KYUA 1RMDA 2ECGA 4UI9B 2ECNA 2ECWA 3KNVA 1WGMA 4WZ2A 2FSAA 5FERA 2K16A 3LQHA 1HYJA 4R2YA 4YAXA 2PNXA 5B78A 2XEUA 4GNGA 3PHDA 2FUIA 3KV6A 4GNFA 2F6NA 4N3WA 3RTRB 2YURA 3EB5A 3O7AA 3T6RA 1VFYA 4A4BA 2PUYA 5AITA 5I3LA 3ZVZB 1N87A 3M63A 2IDAA 3HCTA 1JM7B 4ZQLA 1E4UA 2OXQC 2LXHC 2YU4A 2M1RA 3C6WA 5H1TA 4YATA 3RPGC 4FK5A 3U5OA 2YQLA 1VD4A 4B86C 2MA5A 2F6JA 5LKUA 5TDWA 2QIZA 3T7LA 3SOWA 4V3LC 2JMJA 3ZYQA 2H0DB 3N9QA 4IC2A 2K4DA 2LDRA 2YT5A 2LGKA 1CHCA 5B8DA 4AUQB 1DVPA 3QZVA 2YQMA 4S3OB 3O36A 2YSJA 2JRJA 4FIPA 4AYCB 3C5KA 2VPEA 3PURA 3U5NA 2XB1A 4GNDA 2YREA 3ZVYA 4WA6A 2VPGA 4MSXA 2CSZA 2KWKA 2I50A 2MT5A 2MD7B 4LLBA 4TKPB 2L80A 2RSDA 3HTKC 2E6RA 4P5OB 4R8PK 1VYXA 2L5UA 2L75A 4FJCA 4Q6FA 3DPLR 2CKLB 2VPDA 4I7BA 2LQ6A 2D8SA 2FUUA 4QF2A 2VJFA 2BAYA 2MIQA 4LKAA 3L1ZB 4F52B 5G04B 2EGPA 4CCGX 4YBTA 3O35A 2M85A 1MM2A 1FBVA 3V43A 3ZTGA 2LN0A 4IC3A 4XI1A 3MHHA 3MHSA 5H1VA 3I2DA 5FEYA 4L7XA 2HDPA 3GV4A 3SHBA 2MA6A 5KH9A 3LQIA 5TDRA 3KV5A 2RI7A 1Z60A 4W4UA 4A49A 2KGGA 1BORA 2YUCA 5DKAA 4R7EA 1V87A 2LGGA 4BBQA 2C2VS 2KGIA 3KQIA 2Y1NA 2Y43A 4C9ZA 1HYIA 3L1XA 1T1HA 2CT2A 2LRIC 2L43A 2MD8C 4L58A 1WEUA 3M62A 4AVXA 1Z2QA 1JM7A 2ECIA 4WZ3B 2LGVA 2QJ0A 5H1UA 5KH7A 4CA1A 4I7CA 2KFTA 1WEVA 2LV9A 2VJEB 3LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB1 A;  4AP4 A;  1IYM A;  3M99 A;  2VNF A;  1WES A;  3EB6 A;  3ZNI A;  4GB0 A;  5TBN A;  2KR4 A;  3PUQ A;  2K1J A;  2MNZ A;  1WEQ A;  3DQV R;  1WE9 A;  5B77 A;  4A0C D;  1FP0 A;  4S3O C;  4FO9 A;  1ZBD B;  1WEN A;  1X4U A;  4B7Y C;  5TRB A;  2G45 A;  4AYC A;  4WZ0 A;  2EA6 A;  2G43 A;  4UP0 A;  4QF3 A;  5LKT A;  3IHP A;  3L11 A;  4ZUX U;  5AIU A;  3SOX A;  2ECT A;  2UZG A;  4BHW A;  2VJF B;  2KWO A;  5G05 B;  2MUM A;  3N9M A;  3HCU A;  3NG2 A;  5B79 A;  3SOU A;  4PTB A;  2C2L A;  5EYA F;  3O37 A;  4YBS A;  2AN6 A;  1WEM A;  1WEO A;  3N9L A;  2HYE D;  2KU3 A;  2CKL A;  2MNY A;  3LQJ A;  2L0B A;  5H9M A;  5B76 A;  2ECJ A;  2LXP C;  1WEP A;  5LKX A;  4O64 A;  1MM3 A;  5J3X A;  1XWH A;  5KH3 A;  5C11 A;  2KIZ A;  2YHN A;  3ZPV E;  2NAA A;  2KE1 A;  2M6M A;  3O33 A;  4UP5 A;  4A4C A;  4YBM A;  3RPG B;  4GNE A;  1G25 A;  4YC9 A;  1JOC A;  2Y1M A;  5B75 A;  5TAB A;  5D1K B;  4I7D A;  4N4F A;  1WIM A;  2M3H A;  2CSY A;  1K2F A;  2E6S A;  3U5P A;  3U5M A;  1X4J A;  2VP7 A;  2LGL A;  5G0F A;  2DX8 A;  2YW8 A;  5D1L B;  4YAD A;  1X4I A;  4LJN A;  1Z6U A;  3N9O A;  3O34 A;  2ECV A;  4X3G A;  3N9P A;  2K17 A;  4YAB A;  4NN2 A;  2KWN A;  2G6Q A;  2YHO A;  2JMD A;  4V3K C;  2QIC A;  2H0D A;  3FL2 A;  4ZDT A;  3VK6 A;  1LDJ B;  4LK9 A;  2ZET C;  4LAD B;  2VJE A;  1U6G B;  1WEE A;  2JMI A;  2YSM A;  4MVT A;  5DIN A;  2EOD A;  5C13 A;  1WIL A;  2F42 A;  5JG6 A;  5LKZ A;  3HCS A;  3N9N A;  2YYR A;  1WFK A;  5LCW B;  4PPE A;  1WEW A;  3ZPV 1;  2VPB A;  5D1M B;  3O70 A;  2KWJ A;  3GL6 A;  1F62 A;  1LDK C;  3ASL A;  5FB0 A;  2KRE A;  2KYU A;  1RMD A;  2ECG A;  4UI9 B;  2ECN A;  2ECW A;  3KNV A;  1WGM A;  4WZ2 A;  2FSA A;  5FER A;  2K16 A;  3LQH A;  1HYJ A;  4R2Y A;  4YAX A;  2PNX A;  5B78 A;  2XEU A;  4GNG A;  3PHD A;  2FUI A;  3KV6 A;  4GNF A;  2F6N A;  4N3W A;  3RTR B;  2YUR A;  3EB5 A;  3O7A A;  3T6R A;  1VFY A;  4A4B A;  2PUY A;  5AIT A;  5I3L A;  3ZVZ B;  1N87 A;  3M63 A;  2IDA A;  3HCT A;  1JM7 B;  4ZQL A;  1E4U A;  2OXQ C;  2LXH C;  2YU4 A;  2M1R A;  3C6W A;  5H1T A;  4YAT A;  3RPG C;  4FK5 A;  3U5O A;  2YQL A;  1VD4 A;  4B86 C;  2MA5 A;  2F6J A;  5LKU A;  5TDW A;  2QIZ A;  3T7L A;  3SOW A;  4V3L C;  2JMJ A;  3ZYQ A;  2H0D B;  3N9Q A;  4IC2 A;  2K4D A;  2LDR A;  2YT5 A;  2LGK A;  1CHC A;  5B8D A;  4AUQ B;  1DVP A;  3QZV A;  2YQM A;  4S3O B;  3O36 A;  2YSJ A;  2JRJ A;  4FIP A;  4AYC B;  3C5K A;  2VPE A;  3PUR A;  3U5N A;  2XB1 A;  4GND A;  2YRE A;  3ZVY A;  4WA6 A;  2VPG A;  4MSX A;  2CSZ A;  2KWK A;  2I50 A;  2MT5 A;  2MD7 B;  4LLB A;  4TKP B;  2L80 A;  2RSD A;  3HTK C;  2E6R A;  4P5O B;  4R8P K;  1VYX A;  2L5U A;  2L75 A;  4FJC A;  4Q6F A;  3DPL R;  2CKL B;  2VPD A;  4I7B A;  2LQ6 A;  2D8S A;  2FUU A;  4QF2 A;  2VJF A;  2BAY A;  2MIQ A;  4LKA A;  3L1Z B;  4F52 B;  5G04 B;  2EGP A;  4CCG X;  4YBT A;  3O35 A;  2M85 A;  1MM2 A;  1FBV A;  3V43 A;  3ZTG A;  2LN0 A;  4IC3 A;  4XI1 A;  3MHH A;  3MHS A;  5H1V A;  3I2D A;  5FEY A;  4L7X A;  2HDP A;  3GV4 A;  3SHB A;  2MA6 A;  5KH9 A;  3LQI A;  5TDR A;  3KV5 A;  2RI7 A;  1Z60 A;  4W4U A;  4A49 A;  2KGG A;  1BOR A;  2YUC A;  5DKA A;  4R7E A;  1V87 A;  2LGG A;  4BBQ A;  2C2V S;  2KGI A;  3KQI A;  2Y1N A;  2Y43 A;  4C9Z A;  1HYI A;  3L1X A;  1T1H A;  2CT2 A;  2LRI C;  2L43 A;  2MD8 C;  4L58 A;  1WEU A;  3M62 A;  4AVX A;  1Z2Q A;  1JM7 A;  2ECI A;  4WZ3 B;  2LGV A;  2QJ0 A;  5H1U A;  5KH7 A;  4CA1 A;  4I7C A;  2KFT A;  1WEV A;  2LV9 A;  2VJE B;  3LRQ A; 
#chains in the Genus database with same CATH topology
 5FB1 A;  4AP4 A;  1IYM A;  3M99 A;  2VNF A;  1WES A;  3EB6 A;  3ZNI A;  3FAO A;  4GB0 A;  5TBN A;  2KR4 A;  3PUQ A;  2K1J A;  2MNZ A;  1WEQ A;  3DQV R;  1WE9 A;  5B77 A;  4A0C D;  1FP0 A;  2JUN A;  4S3O C;  4FO9 A;  1ZBD B;  3DWD A;  1WEN A;  1X4U A;  4B7Y C;  2EXU A;  5TRB A;  2G45 A;  4AYC A;  4WZ0 A;  2EA6 A;  2G43 A;  4UP0 A;  4QF3 A;  5LKT A;  2XOZ A;  3IHP A;  3L11 A;  4ZUX U;  5AIU A;  4Z0O A;  2ECT A;  2UZG A;  3SOX A;  4BHW A;  2VJF B;  2KWO A;  5G05 B;  2MUM A;  3N9M A;  3HCU A;  3LVQ E;  3NG2 A;  5B79 A;  4OGE A;  3SOU A;  4PTB A;  2C2L A;  5EYA F;  3O37 A;  4YBS A;  2AN6 A;  1WEM A;  1WEO A;  3N9L A;  2HYE D;  2KU3 A;  2CKL A;  2MNY A;  3LQJ A;  2L0B A;  2CRW A;  5H9M A;  5B76 A;  2ECJ A;  2LXP C;  1WEP A;  2M13 A;  5LKX A;  4O64 A;  1MBM A;  1MM3 A;  5J3X A;  1XWH A;  5KH3 A;  5C11 A;  2KIZ A;  2YHN A;  2CRR A;  3ZPV E;  2NAA A;  2KE1 A;  2M6M A;  3O33 A;  4UP5 A;  3LJU X;  4A4C A;  4YBM A;  2DJA A;  3RPG B;  4GNE A;  1G25 A;  3H7H A;  4YC9 A;  2KKX A;  1JOC A;  2Y1M A;  5B75 A;  5TAB A;  5D1K B;  4I7D A;  4N4F A;  1WIM A;  2M3H A;  2CSY A;  1K2F A;  2E6S A;  3U5P A;  3U5M A;  1X4J A;  2VP7 A;  2LGL A;  2CSV A;  5G0F A;  2D8U A;  2DX8 A;  2YW8 A;  5D1L B;  4YAD A;  3FJU B;  1X4I A;  2MKE A;  4LJN A;  1Z6U A;  2L7P A;  3N9O A;  3O34 A;  2ECV A;  4X3G A;  3N9P A;  2K17 A;  4YAB A;  4NN2 A;  2KWN A;  2G6Q A;  2YHO A;  2JMD A;  4V3K C;  2QIC A;  2H0D A;  3FL2 A;  4ZDT A;  3VK6 A;  1LDJ B;  4LK9 A;  3M7K A;  2ZET C;  4LAD B;  2VJE A;  1U6G B;  1WEE A;  2JMI A;  2YSM A;  4MVT A;  5DIN A;  2EOD A;  3KDE C;  5C13 A;  1WIL A;  2F42 A;  5JG6 A;  3PLW A;  5LKZ A;  3HCS A;  3N9N A;  2YYR A;  1WFK A;  3FM8 C;  4PPE A;  5LCW B;  1WEW A;  3ZPV 1;  2VPB A;  5D1M B;  5SVI A;  3O70 A;  2FFW A;  2KWJ A;  3GL6 A;  1F62 A;  1LDK C;  3ASL A;  5FB0 A;  2KRE A;  2KYU A;  1RMD A;  2ECG A;  4UI9 B;  2ECN A;  2ECW A;  3KNV A;  1WGM A;  4WZ2 A;  2FSA A;  5FER A;  2K16 A;  3LQH A;  1HYJ A;  4R2Y A;  4YAX A;  2PNX A;  2XOC A;  5B78 A;  3LDY A;  2XEU A;  4GNG A;  3PHD A;  2FUI A;  3KV6 A;  4GNF A;  2F6N A;  2E61 A;  4N3W A;  3JUE A;  3RTR B;  2YUR A;  3EB5 A;  2XP0 A;  3O7A A;  3T6R A;  1VFY A;  4A4B A;  2PUY A;  5AIT A;  5I3L A;  3ZVZ B;  1N87 A;  3Q1D A;  3DDT A;  3M63 A;  2IDA A;  3HCT A;  1JM7 B;  4ZQL A;  1E4U A;  2OXQ C;  2LXH C;  2YU4 A;  2M1R A;  2XOY A;  3C6W A;  5H1T A;  4YAT A;  3RPG C;  4FK5 A;  3U5O A;  2YQL A;  1VD4 A;  2FD4 A;  2MA5 A;  4B86 C;  2F6J A;  5LKU A;  5TDW A;  2QIZ A;  3MDB C;  3T7L A;  3SOW A;  5K3Q A;  4V3L C;  2JMJ A;  2KKY A;  3ZYQ A;  2H0D B;  3N9Q A;  4IC2 A;  2K4D A;  2LDR A;  2OWA A;  2YT5 A;  2LGK A;  1CHC A;  5B8D A;  4AUQ B;  1DVP A;  3QZV A;  2YQM A;  3O36 A;  4S3O B;  2YSJ A;  2JRJ A;  4O62 A;  4FIP A;  4AYC B;  3C5K A;  2VPE A;  3PUR A;  3U5N A;  2XB1 A;  4GND A;  2YRE A;  3ZVY A;  4WA6 A;  2VPG A;  4MSX A;  2CSZ A;  2KWK A;  2I50 A;  2DSM A;  2MT5 A;  2YVR A;  2MD7 B;  4LLB A;  4TKP B;  2L80 A;  2RSD A;  3HTK C;  2E6R A;  4P5O B;  4R8P K;  1VYX A;  5SVI B;  2L5U A;  2L75 A;  4FJC A;  4Q6F A;  3DPL R;  2IQJ A;  2JM3 A;  3E2D A;  2CKL B;  2VPD A;  4I7B A;  2LQ6 A;  2D8S A;  2FUU A;  4QF2 A;  2VJF A;  2EGM A;  2BAY A;  2MIQ A;  4LKA A;  3L1Z B;  4F52 B;  5G04 B;  2EGP A;  4CCG X;  4YBT A;  3O35 A;  2M85 A;  1MM2 A;  1FBV A;  3V43 A;  3ZTG A;  5SVY A;  2LN0 A;  4IC3 A;  3SUB A;  4XI1 A;  3MHH A;  3MHS A;  5H1V A;  3I2D A;  5FEY A;  4L7X A;  2HDP A;  3GV4 A;  4Z0R A;  3SHB A;  2MA6 A;  5KH9 A;  3FAN A;  3LQI A;  5TDR A;  3KV5 A;  2RI7 A;  1Z60 A;  4OGC A;  4W4U A;  5SVX A;  4H9D A;  4A49 A;  2KGG A;  1BOR A;  4F1P A;  2YUC A;  5DKA A;  4R7E A;  1V87 A;  2CON A;  1DCQ A;  2LGG A;  4BBQ A;  3LVR E;  4QQ4 A;  3FEH A;  2C2V S;  2KGI A;  3KQI A;  2Y1N A;  2Y43 A;  2P57 A;  2RR4 A;  4C9Z A;  3T9K A;  3L1X A;  1HYI A;  1T1H A;  2CT2 A;  2LAU A;  2LRI C;  2L43 A;  2MD8 C;  4L58 A;  1WEU A;  3M62 A;  4AVX A;  1Z2Q A;  1JM7 A;  3O47 A;  2ECI A;  4WZ3 B;  2LGV A;  2QJ0 A;  2B0O E;  5H1U A;  5KH7 A;  4CA1 A;  4I7C A;  2KFT A;  1WEV A;  2LV9 A;  2VJE B;  3LRQ A; 
#chains in the Genus database with same CATH homology
 5FB1 A;  4AP4 A;  1IYM A;  3M99 A;  2VNF A;  1WES A;  3EB6 A;  3ZNI A;  4GB0 A;  5TBN A;  2KR4 A;  3PUQ A;  2K1J A;  2MNZ A;  1WEQ A;  3DQV R;  1WE9 A;  5B77 A;  4A0C D;  1FP0 A;  4S3O C;  4FO9 A;  1ZBD B;  1WEN A;  1X4U A;  4B7Y C;  5TRB A;  2G45 A;  4AYC A;  4WZ0 A;  2EA6 A;  2G43 A;  4UP0 A;  4QF3 A;  5LKT A;  3IHP A;  3L11 A;  4ZUX U;  5AIU A;  3SOX A;  2ECT A;  2UZG A;  4BHW A;  2VJF B;  2KWO A;  5G05 B;  2MUM A;  3N9M A;  3HCU A;  3NG2 A;  5B79 A;  3SOU A;  4PTB A;  2C2L A;  5EYA F;  3O37 A;  4YBS A;  2AN6 A;  1WEM A;  1WEO A;  3N9L A;  2HYE D;  2KU3 A;  2CKL A;  2MNY A;  3LQJ A;  2L0B A;  5H9M A;  5B76 A;  2ECJ A;  2LXP C;  1WEP A;  5LKX A;  4O64 A;  1MM3 A;  5J3X A;  1XWH A;  5KH3 A;  5C11 A;  2KIZ A;  2YHN A;  3ZPV E;  2NAA A;  2KE1 A;  2M6M A;  3O33 A;  4UP5 A;  4A4C A;  4YBM A;  3RPG B;  4GNE A;  1G25 A;  4YC9 A;  1JOC A;  2Y1M A;  5B75 A;  5TAB A;  5D1K B;  4I7D A;  4N4F A;  1WIM A;  2M3H A;  2CSY A;  1K2F A;  2E6S A;  3U5P A;  3U5M A;  1X4J A;  2VP7 A;  2LGL A;  5G0F A;  2DX8 A;  2YW8 A;  5D1L B;  4YAD A;  1X4I A;  4LJN A;  1Z6U A;  3N9O A;  3O34 A;  2ECV A;  4X3G A;  3N9P A;  2K17 A;  4YAB A;  4NN2 A;  2KWN A;  2G6Q A;  2YHO A;  2JMD A;  4V3K C;  2QIC A;  2H0D A;  3FL2 A;  4ZDT A;  3VK6 A;  1LDJ B;  4LK9 A;  2ZET C;  4LAD B;  2VJE A;  1U6G B;  1WEE A;  2JMI A;  2YSM A;  4MVT A;  5DIN A;  2EOD A;  5C13 A;  1WIL A;  2F42 A;  5JG6 A;  5LKZ A;  3HCS A;  3N9N A;  2YYR A;  1WFK A;  5LCW B;  4PPE A;  1WEW A;  3ZPV 1;  2VPB A;  5D1M B;  3O70 A;  2KWJ A;  3GL6 A;  1F62 A;  1LDK C;  3ASL A;  5FB0 A;  2KRE A;  2KYU A;  1RMD A;  2ECG A;  4UI9 B;  2ECN A;  2ECW A;  3KNV A;  1WGM A;  4WZ2 A;  2FSA A;  5FER A;  2K16 A;  3LQH A;  1HYJ A;  4R2Y A;  4YAX A;  2PNX A;  5B78 A;  2XEU A;  4GNG A;  3PHD A;  2FUI A;  3KV6 A;  4GNF A;  2F6N A;  4N3W A;  3RTR B;  2YUR A;  3EB5 A;  3O7A A;  3T6R A;  1VFY A;  4A4B A;  2PUY A;  5AIT A;  5I3L A;  3ZVZ B;  1N87 A;  3M63 A;  2IDA A;  3HCT A;  1JM7 B;  4ZQL A;  1E4U A;  2OXQ C;  2LXH C;  2YU4 A;  2M1R A;  3C6W A;  5H1T A;  4YAT A;  3RPG C;  4FK5 A;  3U5O A;  2YQL A;  1VD4 A;  4B86 C;  2MA5 A;  2F6J A;  5LKU A;  5TDW A;  2QIZ A;  3T7L A;  3SOW A;  4V3L C;  2JMJ A;  3ZYQ A;  2H0D B;  3N9Q A;  4IC2 A;  2K4D A;  2LDR A;  2YT5 A;  2LGK A;  1CHC A;  5B8D A;  4AUQ B;  1DVP A;  3QZV A;  2YQM A;  4S3O B;  3O36 A;  2YSJ A;  2JRJ A;  4FIP A;  4AYC B;  3C5K A;  2VPE A;  3PUR A;  3U5N A;  2XB1 A;  4GND A;  2YRE A;  3ZVY A;  4WA6 A;  2VPG A;  4MSX A;  2CSZ A;  2KWK A;  2I50 A;  2MT5 A;  2MD7 B;  4LLB A;  4TKP B;  2L80 A;  2RSD A;  3HTK C;  2E6R A;  4P5O B;  4R8P K;  1VYX A;  2L5U A;  2L75 A;  4FJC A;  4Q6F A;  3DPL R;  2CKL B;  2VPD A;  4I7B A;  2LQ6 A;  2D8S A;  2FUU A;  4QF2 A;  2VJF A;  2BAY A;  2MIQ A;  4LKA A;  3L1Z B;  4F52 B;  5G04 B;  2EGP A;  4CCG X;  4YBT A;  3O35 A;  2M85 A;  1MM2 A;  1FBV A;  3V43 A;  3ZTG A;  2LN0 A;  4IC3 A;  4XI1 A;  3MHH A;  3MHS A;  5H1V A;  3I2D A;  5FEY A;  4L7X A;  2HDP A;  3GV4 A;  3SHB A;  2MA6 A;  5KH9 A;  3LQI A;  5TDR A;  3KV5 A;  2RI7 A;  1Z60 A;  4W4U A;  4A49 A;  2KGG A;  1BOR A;  2YUC A;  5DKA A;  4R7E A;  1V87 A;  2LGG A;  4BBQ A;  2C2V S;  2KGI A;  3KQI A;  2Y1N A;  2Y43 A;  4C9Z A;  1HYI A;  3L1X A;  1T1H A;  2CT2 A;  2LRI C;  2L43 A;  2MD8 C;  4L58 A;  1WEU A;  3M62 A;  4AVX A;  1Z2Q A;  1JM7 A;  2ECI A;  4WZ3 B;  2LGV A;  2QJ0 A;  5H1U A;  5KH7 A;  4CA1 A;  4I7C A;  2KFT A;  1WEV A;  2LV9 A;  2VJE B;  3LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...