2HDPA

Solution structure of hdm2 ring finger domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
SLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the Hdm2 C2H2C4 RING, a domain critical for ubiquitination of p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-protein ligase E3 Mdm2
total genus 9
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2hdpA00
5FEYA 2EGPA 4LLBA 2LN0A 3EB5A 1WGMA 2YYRA 5LKTA 2LXPC 5G04B 2MNZA 3PHDA 2NAAA 2CT2A 2YREA 3O7AA 1FP0A 2MT5A 2L43A 2EA6A 4AYCB 2KGIA 1K2FA 2QJ0A 4QF3A 3HCUA 2JMIA 4FO9A 2FUUA 2QIZA 3ZVZB 1WEOA 3DPLR 3HTKC 1HYJA 1Z60A 2E6SA 4W4UA 4I7CA 3VK6A 4ZUXU 1X4JA 2KREA 2VNFA 3M62A 4A4BA 3FL2A 2YW8A 2YT5A 5B78A 1WEEA 2L75A 3LQHA 1ZBDB 2JRJA 1RMDA 5LKUA 4PPEA 3LQJA 3RPGC 2KWOA 1LDJB 1JOCA 3U5OA 4LJNA 2D8SA 4V3LC 4AP4A 4N3WA 2F6NA 3ASLA 2VJFA 1U6GB 2K1JA 2VJEA 3N9PA 5TDRA 2MA5A 2LQ6A 2KR4A 1WIMA 2VPGA 4ZQLA 1X4IA 3O36A 4XI1A 4BHWA 3T6RA 2YSMA 2YU4A 4LKAA 2Y1MA 2ECJA 3GV4A 1G25A 3ZPVE 4GB0A 2ECGA 2L0BA 3RTRB 2YQLA 1WENA 4GNFA 4UI9B 3KV6A 3N9OA 3SOXA 3KNVA 5TDWA 1CHCA 1FBVA 3SOWA 4A49A 2C2VS 3PUQA 3O35A 2JMDA 2YQMA 4UP0A 5D1KB 3O33A 4YBMA 1WEPA 3C6WA 4Q6FA 5TBNA 2YHNA 4QF2A 2KE1A 2VJFB 2KWJA 4S3OB 1Z2QA 5H1TA 2CKLA 2Y1NA 5LCWB 2XB1A 2LRIC 1WEUA 1WFKA 2ECTA 2M85A 3ZPV1 5FERA 4AUQB 1Z6UA 3U5MA 1VD4A 3QZVA 4WZ2A 4ZDTA 2VP7A 4YC9A 4WZ0A 5DKAA 2FUIA 5H1VA 1DVPA 5FB1A 2E6RA 4A4CA 5G05B 3SHBA 5D1LB 4UP5A 4WA6A 2DX8A 4A0CD 4AYCA 5LKXA 2HDPA 2F42A 3N9LA 2YURA 3GL6A 2MUMA 2ECNA 5FB0A 4YAXA 5B76A 3RPGB 1N87A 2K16A 2RI7A 2G43A 2H0DA 4N4FA 4S3OC 5H9MA 2I50A 4YADA 2BAYA 4I7DA 3L1ZB 2KWNA 4GNDA 4C9ZA 5TRBA 4P5OB 4MSXA 4YBTA 4L58A 3U5PA 2H0DB 3M99A 1HYIA 2JMJA 5B8DA 2HYED 2MA6A 2MIQA 2YUCA 2MD8C 3O37A 3T7LA 3L1XA 5I3LA 4GNEA 3KQIA 3MHHA 2ZETC 3ZYQA 3U5NA 3O70A 4YBSA 4IC3A 2OXQC 1V87A 4I7BA 2QICA 1F62A 2CSYA 5J3XA 3KV5A 5TABA 3LRQA 4B7YC 5C11A 2G6QA 2PUYA 1T1HA 1XWHA 4V3KC 2M3HA 4YATA 5G0FA 1WILA 4NN2A 3IHPA 3L11A 2KGGA 1E4UA 4CA1A 1IYMA 2VJEB 1MM3A 4IC2A 2KWKA 4O64A 2YSJA 2VPEA 1WEMA 2K17A 2ECIA 2G45A 1LDKC 3SOUA 5DINA 3N9QA 4R2YA 3EB6A 3N9NA 1WEVA 4PTBA 5EYAF 5C13A 2EODA 2CSZA 4L7XA 3NG2A 2M1RA 4F52B 3DQVR 2LDRA 2LXHC 3M63A 5JG6A 2KYUA 4FIPA 1VYXA 4B86C 4R7EA 4YABA 2LGKA 1WEWA 2XEUA 4BBQA 4GNGA 5AITA 2YHOA 1JM7A 4MVTA 1X4UA 5KH7A 5B79A 3V43A 3N9MA 2UZGA 2KIZA 1WESA 2L80A 2IDAA 4FK5A 4TKPB 2LGVA 2M6MA 2KFTA 2LGLA 5D1MB 2K4DA 3LQIA 1BORA 2F6JA 5KH3A 5LKZA 5B77A 3ZTGA 2C2LA 2PNXA 2KU3A 4LADB 4CCGX 3I2DA 4X3GA 3HCSA 4WZ3B 2VPDA 4AVXA 2VPBA 5H1UA 2LV9A 4FJCA 4R8PK 2ECWA 5KH9A 2LGGA 3O34A 3ZVYA 3MHSA 3PURA 2RSDA 2AN6A 2FSAA 4LK9A 5AIUA 1VFYA 1JM7B 2Y43A 5B75A 2L5UA 1WE9A 2MNYA 2CKLB 2MD7B 1MM2A 3C5KA 3ZNIA 2ECVA 3HCTA 1WEQA
chains in the Genus database with same CATH superfamily
5FEYA 2EGPA 4LLBA 2LN0A 3EB5A 1WGMA 2YYRA 5LKTA 2LXPC 4Z0RA 5G04B 1MBMA 2RR4A 2MNZA 3PHDA 2NAAA 2CT2A 2YREA 3O7AA 1FP0A 2MT5A 2L43A 2EA6A 4AYCB 2KGIA 1K2FA 2QJ0A 4QF3A 3HCUA 3O47A 2JMIA 4FO9A 2FUUA 2QIZA 3ZVZB 5SVYA 1WEOA 3DPLR 3HTKC 1HYJA 1Z60A 2E6SA 4W4UA 4I7CA 3VK6A 2JUNA 4ZUXU 1X4JA 2KREA 2VNFA 3M62A 4A4BA 2LAUA 3FL2A 2YW8A 3FM8C 2YT5A 5B78A 1WEEA 2L75A 3LQHA 1ZBDB 2JRJA 1RMDA 5LKUA 2IQJA 4PPEA 3LQJA 3RPGC 2CRWA 2KWOA 1LDJB 1JOCA 4Z0OA 3U5OA 4LJNA 2D8SA 4V3LC 4AP4A 4N3WA 2F6NA 3ASLA 2VJFA 1U6GB 2K1JA 3Q1DA 2VJEA 2XP0A 3N9PA 5TDRA 2MA5A 2LQ6A 2KR4A 1WIMA 4ZQLA 2VPGA 1X4IA 3O36A 4XI1A 4BHWA 3T6RA 2YSMA 2YU4A 4LKAA 2Y1MA 2ECJA 3GV4A 1G25A 3ZPVE 4GB0A 2ECGA 2L0BA 3RTRB 2YQLA 1WENA 4GNFA 4OGCA 3MDBC 3KV6A 4UI9B 3N9OA 3SOXA 3KNVA 2OWAA 5TDWA 1CHCA 1FBVA 3SOWA 4A49A 2C2VS 3PUQA 3O35A 2JMDA 2M13A 2YQMA 2KKXA 4UP0A 5D1KB 3O33A 4YBMA 5K3QA 1WEPA 3C6WA 3FAOA 4Q6FA 5TBNA 2YHNA 4QF2A 3FEHA 2KE1A 2VJFB 2KWJA 4S3OB 2CONA 1Z2QA 5H1TA 2CKLA 2Y1NA 5LCWB 2XB1A 2LRIC 3E2DA 1WEUA 1WFKA 2ECTA 2M85A 3ZPV1 5FERA 4AUQB 1Z6UA 2E61A 3U5MA 1VD4A 3QZVA 2FFWA 4WZ2A 4ZDTA 4H9DA 2VP7A 4YC9A 4WZ0A 5DKAA 2FUIA 5H1VA 4O62A 1DVPA 5FB1A 2E6RA 4A4CA 5G05B 3SHBA 5D1LB 4UP5A 4WA6A 2DX8A 4A0CD 4AYCA 5LKXA 2HDPA 2F42A 3LJUX 3FJUB 3M7KA 3N9LA 2YURA 3GL6A 2MUMA 2ECNA 3KDEC 2D8UA 5FB0A 4YAXA 5B76A 3RPGB 1N87A 2DSMA 2K16A 2RI7A 2G43A 2H0DA 4N4FA 4S3OC 5H9MA 2I50A 4YADA 2BAYA 2XOCA 2CRRA 4I7DA 3L1ZB 2KWNA 4GNDA 4C9ZA 5TRBA 4P5OB 4MSXA 4YBTA 4L58A 3U5PA 3LDYA 2H0DB 3M99A 1HYIA 2JMJA 5B8DA 2HYED 3JUEA 2MA6A 2MIQA 2YUCA 2MD8C 3O37A 3T7LA 1DCQA 2L7PA 3L1XA 5I3LA 4GNEA 3KQIA 5SVIA 4OGEA 3MHHA 2ZETC 3DDTA 3ZYQA 3U5NA 3O70A 5SVXA 4YBSA 4IC3A 2OXQC 1V87A 4I7BA 2QICA 1F62A 3LVQE 2CSYA 2DJAA 5J3XA 3KV5A 5TABA 3PLWA 3LRQA 4B7YC 4F1PA 5C11A 2G6QA 2KKYA 2PUYA 1T1HA 1XWHA 4V3KC 2M3HA 4YATA 5G0FA 1WILA 4NN2A 3IHPA 3L11A 2KGGA 1E4UA 2FD4A 4CA1A 1IYMA 2VJEB 1MM3A 4IC2A 2XOYA 4O64A 2KWKA 2YSJA 2VPEA 1WEMA 2K17A 2B0OE 2ECIA 2G45A 1LDKC 3SOUA 2P57A 5DINA 3N9QA 4R2YA 3EB6A 3N9NA 1WEVA 4PTBA 5EYAF 5C13A 2EODA 2CSZA 2JM3A 4L7XA 3NG2A 2M1RA 4F52B 3DQVR 2LDRA 2LXHC 3M63A 5JG6A 2KYUA 2MKEA 4FIPA 1VYXA 4B86C 4R7EA 4YABA 2LGKA 1WEWA 2XEUA 4BBQA 4GNGA 5AITA 5SVIB 2YHOA 1JM7A 4MVTA 1X4UA 5KH7A 5B79A 3V43A 3N9MA 2UZGA 3SUBA 2KIZA 1WESA 2L80A 2IDAA 4FK5A 4TKPB 2LGVA 2M6MA 2KFTA 2LGLA 5D1MB 2K4DA 3LQIA 1BORA 2F6JA 5KH3A 5LKZA 5B77A 3ZTGA 2C2LA 2PNXA 2KU3A 4LADB 4CCGX 3I2DA 3FANA 4X3GA 3HCSA 4WZ3B 2VPDA 4AVXA 3H7HA 2VPBA 5H1UA 2LV9A 4FJCA 4R8PK 2ECWA 5KH9A 2LGGA 3LVRE 2CSVA 3O34A 2EXUA 3ZVYA 3MHSA 3PURA 2RSDA 2AN6A 2FSAA 3T9KA 4LK9A 5AIUA 1VFYA 1JM7B 2Y43A 5B75A 2L5UA 1WE9A 2MNYA 2CKLB 2MD7B 1MM2A 3C5KA 2YVRA 3ZNIA 2ECVA 3HCTA 2XOZA 4QQ4A 2EGMA 3DWDA 1WEQA
chains in the Genus database with same CATH topology
5FEYA 2EGPA 4LLBA 2LN0A 3EB5A 1WGMA 2YYRA 5LKTA 2LXPC 5G04B 2MNZA 3PHDA 2NAAA 2CT2A 2YREA 3O7AA 1FP0A 2MT5A 2L43A 2EA6A 4AYCB 2KGIA 1K2FA 2QJ0A 4QF3A 3HCUA 2JMIA 4FO9A 2FUUA 2QIZA 3ZVZB 1WEOA 3DPLR 3HTKC 1HYJA 1Z60A 2E6SA 4W4UA 4I7CA 3VK6A 4ZUXU 1X4JA 2KREA 2VNFA 3M62A 4A4BA 3FL2A 2YW8A 2YT5A 5B78A 1WEEA 2L75A 3LQHA 1ZBDB 2JRJA 1RMDA 5LKUA 4PPEA 3LQJA 3RPGC 2KWOA 1LDJB 1JOCA 3U5OA 4LJNA 2D8SA 4V3LC 4AP4A 4N3WA 2F6NA 3ASLA 2VJFA 1U6GB 2K1JA 2VJEA 3N9PA 5TDRA 2MA5A 2LQ6A 2KR4A 1WIMA 2VPGA 4ZQLA 1X4IA 3O36A 4XI1A 4BHWA 3T6RA 2YSMA 2YU4A 4LKAA 2Y1MA 2ECJA 3GV4A 1G25A 3ZPVE 4GB0A 2ECGA 2L0BA 3RTRB 2YQLA 1WENA 4GNFA 4UI9B 3KV6A 3N9OA 3SOXA 3KNVA 5TDWA 1CHCA 1FBVA 3SOWA 4A49A 2C2VS 3PUQA 3O35A 2JMDA 2YQMA 4UP0A 5D1KB 3O33A 4YBMA 1WEPA 3C6WA 4Q6FA 5TBNA 2YHNA 4QF2A 2KE1A 2VJFB 2KWJA 4S3OB 1Z2QA 5H1TA 2CKLA 2Y1NA 5LCWB 2XB1A 2LRIC 1WEUA 1WFKA 2ECTA 2M85A 3ZPV1 5FERA 4AUQB 1Z6UA 3U5MA 1VD4A 3QZVA 4WZ2A 4ZDTA 2VP7A 4YC9A 4WZ0A 5DKAA 2FUIA 5H1VA 1DVPA 5FB1A 2E6RA 4A4CA 5G05B 3SHBA 5D1LB 4UP5A 4WA6A 2DX8A 4A0CD 4AYCA 5LKXA 2HDPA 2F42A 3N9LA 2YURA 3GL6A 2MUMA 2ECNA 5FB0A 4YAXA 5B76A 3RPGB 1N87A 2K16A 2RI7A 2G43A 2H0DA 4N4FA 4S3OC 5H9MA 2I50A 4YADA 2BAYA 4I7DA 3L1ZB 2KWNA 4GNDA 4C9ZA 5TRBA 4P5OB 4MSXA 4YBTA 4L58A 3U5PA 2H0DB 3M99A 1HYIA 2JMJA 5B8DA 2HYED 2MA6A 2MIQA 2YUCA 2MD8C 3O37A 3T7LA 3L1XA 5I3LA 4GNEA 3KQIA 3MHHA 2ZETC 3ZYQA 3U5NA 3O70A 4YBSA 4IC3A 2OXQC 1V87A 4I7BA 2QICA 1F62A 2CSYA 5J3XA 3KV5A 5TABA 3LRQA 4B7YC 5C11A 2G6QA 2PUYA 1T1HA 1XWHA 4V3KC 2M3HA 4YATA 5G0FA 1WILA 4NN2A 3IHPA 3L11A 2KGGA 1E4UA 4CA1A 1IYMA 2VJEB 1MM3A 4IC2A 2KWKA 4O64A 2YSJA 2VPEA 1WEMA 2K17A 2ECIA 2G45A 1LDKC 3SOUA 5DINA 3N9QA 4R2YA 3EB6A 3N9NA 1WEVA 4PTBA 5EYAF 5C13A 2EODA 2CSZA 4L7XA 3NG2A 2M1RA 4F52B 3DQVR 2LDRA 2LXHC 3M63A 5JG6A 2KYUA 4FIPA 1VYXA 4B86C 4R7EA 4YABA 2LGKA 1WEWA 2XEUA 4BBQA 4GNGA 5AITA 2YHOA 1JM7A 4MVTA 1X4UA 5KH7A 5B79A 3V43A 3N9MA 2UZGA 2KIZA 1WESA 2L80A 2IDAA 4FK5A 4TKPB 2LGVA 2M6MA 2KFTA 2LGLA 5D1MB 2K4DA 3LQIA 1BORA 2F6JA 5KH3A 5LKZA 5B77A 3ZTGA 2C2LA 2PNXA 2KU3A 4LADB 4CCGX 3I2DA 4X3GA 3HCSA 4WZ3B 2VPDA 4AVXA 2VPBA 5H1UA 2LV9A 4FJCA 4R8PK 2ECWA 5KH9A 2LGGA 3O34A 3ZVYA 3MHSA 3PURA 2RSDA 2AN6A 2FSAA 4LK9A 5AIUA 1VFYA 1JM7B 2Y43A 5B75A 2L5UA 1WE9A 2MNYA 2CKLB 2MD7B 1MM2A 3C5KA 3ZNIA 2ECVA 3HCTA 1WEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FEY A;  2EGP A;  4LLB A;  2LN0 A;  3EB5 A;  1WGM A;  2YYR A;  5LKT A;  2LXP C;  5G04 B;  2MNZ A;  3PHD A;  2NAA A;  2CT2 A;  2YRE A;  3O7A A;  1FP0 A;  2MT5 A;  2L43 A;  2EA6 A;  4AYC B;  2KGI A;  1K2F A;  2QJ0 A;  4QF3 A;  3HCU A;  2JMI A;  4FO9 A;  2FUU A;  2QIZ A;  3ZVZ B;  1WEO A;  3DPL R;  3HTK C;  1HYJ A;  1Z60 A;  2E6S A;  4W4U A;  4I7C A;  3VK6 A;  4ZUX U;  1X4J A;  2KRE A;  2VNF A;  3M62 A;  4A4B A;  3FL2 A;  2YW8 A;  2YT5 A;  5B78 A;  1WEE A;  2L75 A;  3LQH A;  1ZBD B;  2JRJ A;  1RMD A;  5LKU A;  4PPE A;  3LQJ A;  3RPG C;  2KWO A;  1LDJ B;  1JOC A;  3U5O A;  4LJN A;  2D8S A;  4V3L C;  4AP4 A;  4N3W A;  2F6N A;  3ASL A;  2VJF A;  1U6G B;  2K1J A;  2VJE A;  3N9P A;  5TDR A;  2MA5 A;  2LQ6 A;  2KR4 A;  1WIM A;  2VPG A;  4ZQL A;  1X4I A;  3O36 A;  4XI1 A;  4BHW A;  3T6R A;  2YSM A;  2YU4 A;  4LKA A;  2Y1M A;  2ECJ A;  3GV4 A;  1G25 A;  3ZPV E;  4GB0 A;  2ECG A;  2L0B A;  3RTR B;  2YQL A;  1WEN A;  4GNF A;  4UI9 B;  3KV6 A;  3N9O A;  3SOX A;  3KNV A;  5TDW A;  1CHC A;  1FBV A;  3SOW A;  4A49 A;  2C2V S;  3PUQ A;  3O35 A;  2JMD A;  2YQM A;  4UP0 A;  5D1K B;  3O33 A;  4YBM A;  1WEP A;  3C6W A;  4Q6F A;  5TBN A;  2YHN A;  4QF2 A;  2KE1 A;  2VJF B;  2KWJ A;  4S3O B;  1Z2Q A;  5H1T A;  2CKL A;  2Y1N A;  5LCW B;  2XB1 A;  2LRI C;  1WEU A;  1WFK A;  2ECT A;  2M85 A;  3ZPV 1;  5FER A;  4AUQ B;  1Z6U A;  3U5M A;  1VD4 A;  3QZV A;  4WZ2 A;  4ZDT A;  2VP7 A;  4YC9 A;  4WZ0 A;  5DKA A;  2FUI A;  5H1V A;  1DVP A;  5FB1 A;  2E6R A;  4A4C A;  5G05 B;  3SHB A;  5D1L B;  4UP5 A;  4WA6 A;  2DX8 A;  4A0C D;  4AYC A;  5LKX A;  2HDP A;  2F42 A;  3N9L A;  2YUR A;  3GL6 A;  2MUM A;  2ECN A;  5FB0 A;  4YAX A;  5B76 A;  3RPG B;  1N87 A;  2K16 A;  2RI7 A;  2G43 A;  2H0D A;  4N4F A;  4S3O C;  5H9M A;  2I50 A;  4YAD A;  2BAY A;  4I7D A;  3L1Z B;  2KWN A;  4GND A;  4C9Z A;  5TRB A;  4P5O B;  4MSX A;  4YBT A;  4L58 A;  3U5P A;  2H0D B;  3M99 A;  1HYI A;  2JMJ A;  5B8D A;  2HYE D;  2MA6 A;  2MIQ A;  2YUC A;  2MD8 C;  3O37 A;  3T7L A;  3L1X A;  5I3L A;  4GNE A;  3KQI A;  3MHH A;  2ZET C;  3ZYQ A;  3U5N A;  3O70 A;  4YBS A;  4IC3 A;  2OXQ C;  1V87 A;  4I7B A;  2QIC A;  1F62 A;  2CSY A;  5J3X A;  3KV5 A;  5TAB A;  3LRQ A;  4B7Y C;  5C11 A;  2G6Q A;  2PUY A;  1T1H A;  1XWH A;  4V3K C;  2M3H A;  4YAT A;  5G0F A;  1WIL A;  4NN2 A;  3IHP A;  3L11 A;  2KGG A;  1E4U A;  4CA1 A;  1IYM A;  2VJE B;  1MM3 A;  4IC2 A;  2KWK A;  4O64 A;  2YSJ A;  2VPE A;  1WEM A;  2K17 A;  2ECI A;  2G45 A;  1LDK C;  3SOU A;  5DIN A;  3N9Q A;  4R2Y A;  3EB6 A;  3N9N A;  1WEV A;  4PTB A;  5EYA F;  5C13 A;  2EOD A;  2CSZ A;  4L7X A;  3NG2 A;  2M1R A;  4F52 B;  3DQV R;  2LDR A;  2LXH C;  3M63 A;  5JG6 A;  2KYU A;  4FIP A;  1VYX A;  4B86 C;  4R7E A;  4YAB A;  2LGK A;  1WEW A;  2XEU A;  4BBQ A;  4GNG A;  5AIT A;  2YHO A;  1JM7 A;  4MVT A;  1X4U A;  5KH7 A;  5B79 A;  3V43 A;  3N9M A;  2UZG A;  2KIZ A;  1WES A;  2L80 A;  2IDA A;  4FK5 A;  4TKP B;  2LGV A;  2M6M A;  2KFT A;  2LGL A;  5D1M B;  2K4D A;  3LQI A;  1BOR A;  2F6J A;  5KH3 A;  5LKZ A;  5B77 A;  3ZTG A;  2C2L A;  2PNX A;  2KU3 A;  4LAD B;  4CCG X;  3I2D A;  4X3G A;  3HCS A;  4WZ3 B;  2VPD A;  4AVX A;  2VPB A;  5H1U A;  2LV9 A;  4FJC A;  4R8P K;  2ECW A;  5KH9 A;  2LGG A;  3O34 A;  3ZVY A;  3MHS A;  3PUR A;  2RSD A;  2AN6 A;  2FSA A;  4LK9 A;  5AIU A;  1VFY A;  1JM7 B;  2Y43 A;  5B75 A;  2L5U A;  1WE9 A;  2MNY A;  2CKL B;  2MD7 B;  1MM2 A;  3C5K A;  3ZNI A;  2ECV A;  3HCT A;  1WEQ A; 
#chains in the Genus database with same CATH topology
 5FEY A;  2EGP A;  4LLB A;  2LN0 A;  3EB5 A;  1WGM A;  2YYR A;  5LKT A;  2LXP C;  4Z0R A;  5G04 B;  1MBM A;  2RR4 A;  2MNZ A;  3PHD A;  2NAA A;  2CT2 A;  2YRE A;  3O7A A;  1FP0 A;  2MT5 A;  2L43 A;  2EA6 A;  4AYC B;  2KGI A;  1K2F A;  2QJ0 A;  4QF3 A;  3HCU A;  3O47 A;  2JMI A;  4FO9 A;  2FUU A;  2QIZ A;  3ZVZ B;  5SVY A;  1WEO A;  3DPL R;  3HTK C;  1HYJ A;  1Z60 A;  2E6S A;  4W4U A;  4I7C A;  3VK6 A;  2JUN A;  4ZUX U;  1X4J A;  2KRE A;  2VNF A;  3M62 A;  4A4B A;  2LAU A;  3FL2 A;  2YW8 A;  3FM8 C;  2YT5 A;  5B78 A;  1WEE A;  2L75 A;  3LQH A;  1ZBD B;  2JRJ A;  1RMD A;  5LKU A;  2IQJ A;  4PPE A;  3LQJ A;  3RPG C;  2CRW A;  2KWO A;  1LDJ B;  1JOC A;  4Z0O A;  3U5O A;  4LJN A;  2D8S A;  4V3L C;  4AP4 A;  4N3W A;  2F6N A;  3ASL A;  2VJF A;  1U6G B;  2K1J A;  3Q1D A;  2VJE A;  2XP0 A;  3N9P A;  5TDR A;  2MA5 A;  2LQ6 A;  2KR4 A;  1WIM A;  4ZQL A;  2VPG A;  1X4I A;  3O36 A;  4XI1 A;  4BHW A;  3T6R A;  2YSM A;  2YU4 A;  4LKA A;  2Y1M A;  2ECJ A;  3GV4 A;  1G25 A;  3ZPV E;  4GB0 A;  2ECG A;  2L0B A;  3RTR B;  2YQL A;  1WEN A;  4GNF A;  4OGC A;  3MDB C;  3KV6 A;  4UI9 B;  3N9O A;  3SOX A;  3KNV A;  2OWA A;  5TDW A;  1CHC A;  1FBV A;  3SOW A;  4A49 A;  2C2V S;  3PUQ A;  3O35 A;  2JMD A;  2M13 A;  2YQM A;  2KKX A;  4UP0 A;  5D1K B;  3O33 A;  4YBM A;  5K3Q A;  1WEP A;  3C6W A;  3FAO A;  4Q6F A;  5TBN A;  2YHN A;  4QF2 A;  3FEH A;  2KE1 A;  2VJF B;  2KWJ A;  4S3O B;  2CON A;  1Z2Q A;  5H1T A;  2CKL A;  2Y1N A;  5LCW B;  2XB1 A;  2LRI C;  3E2D A;  1WEU A;  1WFK A;  2ECT A;  2M85 A;  3ZPV 1;  5FER A;  4AUQ B;  1Z6U A;  2E61 A;  3U5M A;  1VD4 A;  3QZV A;  2FFW A;  4WZ2 A;  4ZDT A;  4H9D A;  2VP7 A;  4YC9 A;  4WZ0 A;  5DKA A;  2FUI A;  5H1V A;  4O62 A;  1DVP A;  5FB1 A;  2E6R A;  4A4C A;  5G05 B;  3SHB A;  5D1L B;  4UP5 A;  4WA6 A;  2DX8 A;  4A0C D;  4AYC A;  5LKX A;  2HDP A;  2F42 A;  3LJU X;  3FJU B;  3M7K A;  3N9L A;  2YUR A;  3GL6 A;  2MUM A;  2ECN A;  3KDE C;  2D8U A;  5FB0 A;  4YAX A;  5B76 A;  3RPG B;  1N87 A;  2DSM A;  2K16 A;  2RI7 A;  2G43 A;  2H0D A;  4N4F A;  4S3O C;  5H9M A;  2I50 A;  4YAD A;  2BAY A;  2XOC A;  2CRR A;  4I7D A;  3L1Z B;  2KWN A;  4GND A;  4C9Z A;  5TRB A;  4P5O B;  4MSX A;  4YBT A;  4L58 A;  3U5P A;  3LDY A;  2H0D B;  3M99 A;  1HYI A;  2JMJ A;  5B8D A;  2HYE D;  3JUE A;  2MA6 A;  2MIQ A;  2YUC A;  2MD8 C;  3O37 A;  3T7L A;  1DCQ A;  2L7P A;  3L1X A;  5I3L A;  4GNE A;  3KQI A;  5SVI A;  4OGE A;  3MHH A;  2ZET C;  3DDT A;  3ZYQ A;  3U5N A;  3O70 A;  5SVX A;  4YBS A;  4IC3 A;  2OXQ C;  1V87 A;  4I7B A;  2QIC A;  1F62 A;  3LVQ E;  2CSY A;  2DJA A;  5J3X A;  3KV5 A;  5TAB A;  3PLW A;  3LRQ A;  4B7Y C;  4F1P A;  5C11 A;  2G6Q A;  2KKY A;  2PUY A;  1T1H A;  1XWH A;  4V3K C;  2M3H A;  4YAT A;  5G0F A;  1WIL A;  4NN2 A;  3IHP A;  3L11 A;  2KGG A;  1E4U A;  2FD4 A;  4CA1 A;  1IYM A;  2VJE B;  1MM3 A;  4IC2 A;  2XOY A;  4O64 A;  2KWK A;  2YSJ A;  2VPE A;  1WEM A;  2K17 A;  2B0O E;  2ECI A;  2G45 A;  1LDK C;  3SOU A;  2P57 A;  5DIN A;  3N9Q A;  4R2Y A;  3EB6 A;  3N9N A;  1WEV A;  4PTB A;  5EYA F;  5C13 A;  2EOD A;  2CSZ A;  2JM3 A;  4L7X A;  3NG2 A;  2M1R A;  4F52 B;  3DQV R;  2LDR A;  2LXH C;  3M63 A;  5JG6 A;  2KYU A;  2MKE A;  4FIP A;  1VYX A;  4B86 C;  4R7E A;  4YAB A;  2LGK A;  1WEW A;  2XEU A;  4BBQ A;  4GNG A;  5AIT A;  5SVI B;  2YHO A;  1JM7 A;  4MVT A;  1X4U A;  5KH7 A;  5B79 A;  3V43 A;  3N9M A;  2UZG A;  3SUB A;  2KIZ A;  1WES A;  2L80 A;  2IDA A;  4FK5 A;  4TKP B;  2LGV A;  2M6M A;  2KFT A;  2LGL A;  5D1M B;  2K4D A;  3LQI A;  1BOR A;  2F6J A;  5KH3 A;  5LKZ A;  5B77 A;  3ZTG A;  2C2L A;  2PNX A;  2KU3 A;  4LAD B;  4CCG X;  3I2D A;  3FAN A;  4X3G A;  3HCS A;  4WZ3 B;  2VPD A;  4AVX A;  3H7H A;  2VPB A;  5H1U A;  2LV9 A;  4FJC A;  4R8P K;  2ECW A;  5KH9 A;  2LGG A;  3LVR E;  2CSV A;  3O34 A;  2EXU A;  3ZVY A;  3MHS A;  3PUR A;  2RSD A;  2AN6 A;  2FSA A;  3T9K A;  4LK9 A;  5AIU A;  1VFY A;  1JM7 B;  2Y43 A;  5B75 A;  2L5U A;  1WE9 A;  2MNY A;  2CKL B;  2MD7 B;  1MM2 A;  3C5K A;  2YVR A;  3ZNI A;  2ECV A;  3HCT A;  2XOZ A;  4QQ4 A;  2EGM A;  3DWD A;  1WEQ A; 
#chains in the Genus database with same CATH homology
 5FEY A;  2EGP A;  4LLB A;  2LN0 A;  3EB5 A;  1WGM A;  2YYR A;  5LKT A;  2LXP C;  5G04 B;  2MNZ A;  3PHD A;  2NAA A;  2CT2 A;  2YRE A;  3O7A A;  1FP0 A;  2MT5 A;  2L43 A;  2EA6 A;  4AYC B;  2KGI A;  1K2F A;  2QJ0 A;  4QF3 A;  3HCU A;  2JMI A;  4FO9 A;  2FUU A;  2QIZ A;  3ZVZ B;  1WEO A;  3DPL R;  3HTK C;  1HYJ A;  1Z60 A;  2E6S A;  4W4U A;  4I7C A;  3VK6 A;  4ZUX U;  1X4J A;  2KRE A;  2VNF A;  3M62 A;  4A4B A;  3FL2 A;  2YW8 A;  2YT5 A;  5B78 A;  1WEE A;  2L75 A;  3LQH A;  1ZBD B;  2JRJ A;  1RMD A;  5LKU A;  4PPE A;  3LQJ A;  3RPG C;  2KWO A;  1LDJ B;  1JOC A;  3U5O A;  4LJN A;  2D8S A;  4V3L C;  4AP4 A;  4N3W A;  2F6N A;  3ASL A;  2VJF A;  1U6G B;  2K1J A;  2VJE A;  3N9P A;  5TDR A;  2MA5 A;  2LQ6 A;  2KR4 A;  1WIM A;  2VPG A;  4ZQL A;  1X4I A;  3O36 A;  4XI1 A;  4BHW A;  3T6R A;  2YSM A;  2YU4 A;  4LKA A;  2Y1M A;  2ECJ A;  3GV4 A;  1G25 A;  3ZPV E;  4GB0 A;  2ECG A;  2L0B A;  3RTR B;  2YQL A;  1WEN A;  4GNF A;  4UI9 B;  3KV6 A;  3N9O A;  3SOX A;  3KNV A;  5TDW A;  1CHC A;  1FBV A;  3SOW A;  4A49 A;  2C2V S;  3PUQ A;  3O35 A;  2JMD A;  2YQM A;  4UP0 A;  5D1K B;  3O33 A;  4YBM A;  1WEP A;  3C6W A;  4Q6F A;  5TBN A;  2YHN A;  4QF2 A;  2KE1 A;  2VJF B;  2KWJ A;  4S3O B;  1Z2Q A;  5H1T A;  2CKL A;  2Y1N A;  5LCW B;  2XB1 A;  2LRI C;  1WEU A;  1WFK A;  2ECT A;  2M85 A;  3ZPV 1;  5FER A;  4AUQ B;  1Z6U A;  3U5M A;  1VD4 A;  3QZV A;  4WZ2 A;  4ZDT A;  2VP7 A;  4YC9 A;  4WZ0 A;  5DKA A;  2FUI A;  5H1V A;  1DVP A;  5FB1 A;  2E6R A;  4A4C A;  5G05 B;  3SHB A;  5D1L B;  4UP5 A;  4WA6 A;  2DX8 A;  4A0C D;  4AYC A;  5LKX A;  2HDP A;  2F42 A;  3N9L A;  2YUR A;  3GL6 A;  2MUM A;  2ECN A;  5FB0 A;  4YAX A;  5B76 A;  3RPG B;  1N87 A;  2K16 A;  2RI7 A;  2G43 A;  2H0D A;  4N4F A;  4S3O C;  5H9M A;  2I50 A;  4YAD A;  2BAY A;  4I7D A;  3L1Z B;  2KWN A;  4GND A;  4C9Z A;  5TRB A;  4P5O B;  4MSX A;  4YBT A;  4L58 A;  3U5P A;  2H0D B;  3M99 A;  1HYI A;  2JMJ A;  5B8D A;  2HYE D;  2MA6 A;  2MIQ A;  2YUC A;  2MD8 C;  3O37 A;  3T7L A;  3L1X A;  5I3L A;  4GNE A;  3KQI A;  3MHH A;  2ZET C;  3ZYQ A;  3U5N A;  3O70 A;  4YBS A;  4IC3 A;  2OXQ C;  1V87 A;  4I7B A;  2QIC A;  1F62 A;  2CSY A;  5J3X A;  3KV5 A;  5TAB A;  3LRQ A;  4B7Y C;  5C11 A;  2G6Q A;  2PUY A;  1T1H A;  1XWH A;  4V3K C;  2M3H A;  4YAT A;  5G0F A;  1WIL A;  4NN2 A;  3IHP A;  3L11 A;  2KGG A;  1E4U A;  4CA1 A;  1IYM A;  2VJE B;  1MM3 A;  4IC2 A;  2KWK A;  4O64 A;  2YSJ A;  2VPE A;  1WEM A;  2K17 A;  2ECI A;  2G45 A;  1LDK C;  3SOU A;  5DIN A;  3N9Q A;  4R2Y A;  3EB6 A;  3N9N A;  1WEV A;  4PTB A;  5EYA F;  5C13 A;  2EOD A;  2CSZ A;  4L7X A;  3NG2 A;  2M1R A;  4F52 B;  3DQV R;  2LDR A;  2LXH C;  3M63 A;  5JG6 A;  2KYU A;  4FIP A;  1VYX A;  4B86 C;  4R7E A;  4YAB A;  2LGK A;  1WEW A;  2XEU A;  4BBQ A;  4GNG A;  5AIT A;  2YHO A;  1JM7 A;  4MVT A;  1X4U A;  5KH7 A;  5B79 A;  3V43 A;  3N9M A;  2UZG A;  2KIZ A;  1WES A;  2L80 A;  2IDA A;  4FK5 A;  4TKP B;  2LGV A;  2M6M A;  2KFT A;  2LGL A;  5D1M B;  2K4D A;  3LQI A;  1BOR A;  2F6J A;  5KH3 A;  5LKZ A;  5B77 A;  3ZTG A;  2C2L A;  2PNX A;  2KU3 A;  4LAD B;  4CCG X;  3I2D A;  4X3G A;  3HCS A;  4WZ3 B;  2VPD A;  4AVX A;  2VPB A;  5H1U A;  2LV9 A;  4FJC A;  4R8P K;  2ECW A;  5KH9 A;  2LGG A;  3O34 A;  3ZVY A;  3MHS A;  3PUR A;  2RSD A;  2AN6 A;  2FSA A;  4LK9 A;  5AIU A;  1VFY A;  1JM7 B;  2Y43 A;  5B75 A;  2L5U A;  1WE9 A;  2MNY A;  2CKL B;  2MD7 B;  1MM2 A;  3C5K A;  3ZNI A;  2ECV A;  3HCT A;  1WEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...