2HDPA

Solution structure of hdm2 ring finger domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
SLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-protein ligase E3 Mdm2
publication title Solution structure of the Hdm2 C2H2C4 RING, a domain critical for ubiquitination of p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 9
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2hdpA00
3ZTGA 2H0DA 2KR4A 2NAAA 3ZPV1 2KU3A 2LXPC 4FJCA 4YABA 4WZ0A 2KGGA 1MM3A 4WZ2A 3LQJA 5TDRA 1WIMA 4S3OB 2KWNA 4X3GA 3DQVR 4W4UA 3GV4A 5AITA 4GB0A 3T6RA 3O33A 4YATA 4ZQLA 2F42A 4WZ3B 1WEQA 3ZVYA 2FUIA 3C5KA 5B76A 4Q6FA 1V87A 3O36A 3LQHA 4BBQA 3N9PA 4YAXA 3ZYQA 4YC9A 2MA6A 1BORA 3MHSA 4WA6A 3T7LA 3HTKC 2QJ0A 4P5OB 3MHHA 3N9LA 5H1UA 2LGKA 5LKXA 5B79A 1T1HA 4LLBA 3RPGB 1WEPA 3ZVZB 3U5PA 2VPEA 5FB0A 5DINA 2MUMA 2VNFA 2VJFA 4F52B 2LGGA 4LADB 1ZBDB 2CT2A 3N9NA 5FERA 2FUUA 4AUQB 5LKTA 1K2FA 2I50A 4YBMA 4GNEA 3FL2A 2ECVA 4A4CA 3L11A 4FK5A 2E6SA 2H0DB 5C11A 2RSDA 5D1KB 5KH3A 5LKZA 4V3KC 2L80A 2EGPA 4R7EA 4S3OC 5TRBA 2KWKA 2K4DA 5D1MB 4ZDTA 2C2VS 3O7AA 4A4BA 4C9ZA 1WEVA 3EB6A 3M63A 2YSJA 5KH7A 2YQLA 2HYED 2LN0A 2K16A 4GNFA 1Z2QA 5G0FA 4B7YC 4YADA 2M3HA 2ZETC 4MVTA 2M6MA 2L43A 3ASLA 3U5NA 2LV9A 2ECTA 5LCWB 5B78A 3KV6A 2LRIC 5I3LA 2JMJA 5D1LB 3N9QA 5LKUA 4IC2A 2VPGA 5AIUA 5TABA 1HYIA 3PUQA 4QF3A 4I7BA 4R8PK 2MNZA 2LGLA 2QIZA 2XB1A 1RMDA 3SOWA 3EB5A 3RPGC 3M62A 4FO9A 3SHBA 3N9OA 2CKLB 2KFTA 2YREA 2VP7A 2HDPA 2MT5A 2PUYA 2YSMA 1X4UA 4AVXA 1WEUA 2KE1A 5G05B 2RI7A 2CSZA 3N9MA 2LQ6A 3PHDA 5H1VA 5EYAF 1JM7B 2YW8A 2VJFB 2M1RA 3KV5A 2CKLA 2VJEB 2KWOA 2MIQA 4I7DA 2FSAA 2UZGA 2IDAA 1FBVA 3ZNIA 2YUCA 2KWJA 2F6JA 1JM7A 2YURA 4O64A 4TKPB 2LXHC 2JRJA 1WILA 2VJEA 1LDJB 2Y43A 4UP0A 4LK9A 2C2LA 5KH9A 2MD8C 4LKAA 4L7XA 3HCUA 3C6WA 1WEWA 1MM2A 4UP5A 4MSXA 4AP4A 4NN2A 1FP0A 2YQMA 3VK6A 2YT5A 5B77A 3KNVA 2F6NA 2EODA 2Y1NA 1Z6UA 1WESA 1N87A 2YHNA 5J3XA 4ZUXU 5DKAA 4UI9B 2KGIA 3SOXA 2LDRA 3PURA 2MD7B 5B8DA 2JMDA 2MNYA 2ECJA 2CSYA 2KYUA 4YBSA 2E6RA 5FEYA 4A49A 4A0CD 2M85A 2Y1MA 2VPBA 1WEOA 4YBTA 3HCSA 4B86C 5TBNA 1WEMA 3U5OA 2OXQC 3HCTA 3LRQA 2DX8A 3I2DA 4CA1A 2AN6A 4XI1A 1WGMA 2EA6A 5TDWA 1WEEA 4I7CA 1IYMA 3O37A 5JG6A 2G6QA 2YU4A 1E4UA 4N4FA 2JMIA 3L1ZB 2PNXA 2YYRA 2VPDA 3O35A 3U5MA 4IC3A 5C13A 4AYCB 2ECWA 3GL6A 5B75A 2D8SA 3O70A 1JOCA 2G45A 1LDKC 2L5UA 3L1XA 4GNGA 2MA5A 4QF2A 4V3LC 1VYXA 3LQIA 4L58A 1G25A 3QZVA 4AYCA 2YHOA 1XWHA 3NG2A 3SOUA 3DPLR 1WE9A 2ECGA 3V43A 5H9MA 5G04B 3RTRB 5H1TA 2L75A 4GNDA 4R2YA 3ZPVE 1HYJA 2ECNA 4PTBA 1CHCA 2ECIA 1WFKA 1WENA 2K17A 1X4IA 2KREA 3M99A 2L0BA 2QICA 2BAYA 4FIPA 4N3WA 1VD4A 3IHPA 5FB1A 3O34A 2K1JA 4LJNA 2G43A 1VFYA 2KIZA 3KQIA 4BHWA 4CCGX 1DVPA 2XEUA 4PPEA 1Z60A 2LGVA 1F62A 1X4JA 1U6GB
chains in the Genus database with same CATH superfamily
3ZTGA 2H0DA 1DCQA 2KR4A 2NAAA 3ZPV1 2KU3A 2LXPC 4FJCA 4YABA 4WZ0A 2KGGA 1MM3A 4WZ2A 3LQJA 5TDRA 1WIMA 3LVQE 4S3OB 2KWNA 4X3GA 3DQVR 4W4UA 3GV4A 3Q1DA 5AITA 4GB0A 3T6RA 3O33A 4YATA 4ZQLA 2F42A 4WZ3B 1WEQA 3ZVYA 2FUIA 3C5KA 5B76A 4Q6FA 1V87A 2XP0A 3O36A 3LQHA 4BBQA 2M13A 3N9PA 4YAXA 2OWAA 5K3QA 2B0OE 3ZYQA 4YC9A 2MA6A 1BORA 3MHSA 4WA6A 3T7LA 3HTKC 2QJ0A 4P5OB 3MHHA 3N9LA 5H1UA 2LGKA 2KKXA 5LKXA 5B79A 1T1HA 5SVYA 4LLBA 3RPGB 1WEPA 3ZVZB 5SVXA 3U5PA 2VPEA 5FB0A 5DINA 2MUMA 2VNFA 2VJFA 4F52B 4O62A 2LGGA 2JM3A 4LADB 1ZBDB 2CT2A 3DDTA 3N9NA 5FERA 2FUUA 4QQ4A 4AUQB 5LKTA 1K2FA 2I50A 4YBMA 4GNEA 3FL2A 2ECVA 4A4CA 3L11A 4FK5A 2E6SA 2H0DB 5C11A 2RSDA 5D1KB 5KH3A 5LKZA 4V3KC 2L80A 2EGPA 4R7EA 4S3OC 5TRBA 2KWKA 2K4DA 5D1MB 4ZDTA 2C2VS 3O7AA 4A4BA 4C9ZA 1WEVA 2EGMA 3EB6A 3M63A 2YSJA 5KH7A 2YQLA 2HYED 3H7HA 2XOYA 2LN0A 2K16A 4GNFA 1Z2QA 5G0FA 4B7YC 4YADA 2M3HA 2ZETC 4MVTA 3T9KA 2M6MA 2L43A 3ASLA 3U5NA 2LV9A 2ECTA 5LCWB 5B78A 4F1PA 3KV6A 2LRIC 5I3LA 2JMJA 2CRRA 5D1LB 3N9QA 5LKUA 4IC2A 2VPGA 5AIUA 2IQJA 5TABA 1HYIA 3PUQA 4QF3A 4I7BA 4R8PK 2MNZA 2LGLA 2QIZA 2XB1A 3E2DA 1RMDA 5SVIB 3SOWA 3EB5A 3RPGC 3M62A 4FO9A 3SHBA 3N9OA 2CKLB 2KFTA 2YREA 2VP7A 2HDPA 2MT5A 2PUYA 2YSMA 1X4UA 4AVXA 3LVRE 1WEUA 2KE1A 5G05B 2RI7A 2CSZA 3N9MA 2LQ6A 2JUNA 3PHDA 5H1VA 2YVRA 5EYAF 1JM7B 2YW8A 5SVIA 2VJFB 4OGEA 2M1RA 3KV5A 2CKLA 3PLWA 2FD4A 2VJEB 2KWOA 2MIQA 4I7DA 2FSAA 2UZGA 2IDAA 1FBVA 3FM8C 3ZNIA 2YUCA 2KWJA 2F6JA 2CSVA 1JM7A 2YURA 3FEHA 4O64A 4TKPB 3KDEC 2LXHC 4OGCA 2JRJA 1WILA 2VJEA 1LDJB 2Y43A 4UP0A 4LK9A 3M7KA 2C2LA 5KH9A 2MD8C 4LKAA 4L7XA 3HCUA 4H9DA 3C6WA 2KKYA 1WEWA 1MM2A 4UP5A 2CRWA 4MSXA 4AP4A 4NN2A 1FP0A 2YQMA 3FAOA 3VK6A 3SUBA 2YT5A 5B77A 3KNVA 2F6NA 2EODA 2Y1NA 1Z6UA 4Z0RA 1WESA 1N87A 2YHNA 5J3XA 2E61A 4ZUXU 5DKAA 4UI9B 3JUEA 2KGIA 3SOXA 2LDRA 3PURA 2XOCA 2MD7B 5B8DA 2FFWA 2JMDA 2DSMA 2MNYA 2ECJA 3LDYA 2XOZA 2CSYA 2KYUA 2DJAA 4YBSA 2E6RA 5FEYA 4A49A 4A0CD 2M85A 2Y1MA 3O47A 2VPBA 1WEOA 4YBTA 3HCSA 4B86C 5TBNA 1WEMA 3U5OA 2OXQC 3HCTA 3LRQA 2DX8A 3I2DA 2RR4A 4CA1A 2MKEA 2AN6A 4XI1A 1WGMA 1MBMA 2EA6A 5TDWA 1WEEA 4I7CA 1IYMA 3O37A 5JG6A 2G6QA 2YU4A 1E4UA 2D8UA 4N4FA 2JMIA 3L1ZB 2PNXA 2LAUA 2YYRA 4Z0OA 2VPDA 3FJUB 2L7PA 3O35A 3U5MA 3DWDA 4IC3A 5C13A 4AYCB 2ECWA 3GL6A 3MDBC 5B75A 2D8SA 3O70A 1JOCA 2G45A 1LDKC 2L5UA 3L1XA 4GNGA 2MA5A 4QF2A 4V3LC 1VYXA 3LQIA 4L58A 1G25A 3QZVA 4AYCA 2YHOA 1XWHA 3NG2A 3SOUA 3DPLR 1WE9A 2ECGA 3V43A 5H9MA 5G04B 3RTRB 5H1TA 2L75A 4GNDA 3LJUX 2EXUA 4R2YA 3ZPVE 1HYJA 2ECNA 4PTBA 1CHCA 2ECIA 1WFKA 1WENA 3FANA 2K17A 1X4IA 2CONA 2KREA 3M99A 2L0BA 2QICA 2BAYA 4FIPA 4N3WA 1VD4A 3IHPA 5FB1A 3O34A 2K1JA 4LJNA 2G43A 1VFYA 2P57A 2KIZA 3KQIA 4BHWA 4CCGX 1DVPA 2XEUA 4PPEA 1Z60A 2LGVA 1F62A 1X4JA 1U6GB
chains in the Genus database with same CATH topology
3ZTGA 2H0DA 2KR4A 2NAAA 3ZPV1 2KU3A 2LXPC 4FJCA 4YABA 4WZ0A 2KGGA 1MM3A 4WZ2A 3LQJA 5TDRA 1WIMA 4S3OB 2KWNA 4X3GA 3DQVR 4W4UA 3GV4A 5AITA 4GB0A 3T6RA 3O33A 4YATA 4ZQLA 2F42A 4WZ3B 1WEQA 3ZVYA 2FUIA 3C5KA 5B76A 4Q6FA 1V87A 3O36A 3LQHA 4BBQA 3N9PA 4YAXA 3ZYQA 4YC9A 2MA6A 1BORA 3MHSA 4WA6A 3T7LA 3HTKC 2QJ0A 4P5OB 3MHHA 3N9LA 5H1UA 2LGKA 5LKXA 5B79A 1T1HA 4LLBA 3RPGB 1WEPA 3ZVZB 3U5PA 2VPEA 5FB0A 5DINA 2MUMA 2VNFA 2VJFA 4F52B 2LGGA 4LADB 1ZBDB 2CT2A 3N9NA 5FERA 2FUUA 4AUQB 5LKTA 1K2FA 2I50A 4YBMA 4GNEA 3FL2A 2ECVA 4A4CA 3L11A 4FK5A 2E6SA 2H0DB 5C11A 2RSDA 5D1KB 5KH3A 5LKZA 4V3KC 2L80A 2EGPA 4R7EA 4S3OC 5TRBA 2KWKA 2K4DA 5D1MB 4ZDTA 2C2VS 3O7AA 4A4BA 4C9ZA 1WEVA 3EB6A 3M63A 2YSJA 5KH7A 2YQLA 2HYED 2LN0A 2K16A 4GNFA 1Z2QA 5G0FA 4B7YC 4YADA 2M3HA 2ZETC 4MVTA 2M6MA 2L43A 3ASLA 3U5NA 2LV9A 2ECTA 5LCWB 5B78A 3KV6A 2LRIC 5I3LA 2JMJA 5D1LB 3N9QA 5LKUA 4IC2A 2VPGA 5AIUA 5TABA 1HYIA 3PUQA 4QF3A 4I7BA 4R8PK 2MNZA 2LGLA 2QIZA 2XB1A 1RMDA 3SOWA 3EB5A 3RPGC 3M62A 4FO9A 3SHBA 3N9OA 2CKLB 2KFTA 2YREA 2VP7A 2HDPA 2MT5A 2PUYA 2YSMA 1X4UA 4AVXA 1WEUA 2KE1A 5G05B 2RI7A 2CSZA 3N9MA 2LQ6A 3PHDA 5H1VA 5EYAF 1JM7B 2YW8A 2VJFB 2M1RA 3KV5A 2CKLA 2VJEB 2KWOA 2MIQA 4I7DA 2FSAA 2UZGA 2IDAA 1FBVA 3ZNIA 2YUCA 2KWJA 2F6JA 1JM7A 2YURA 4O64A 4TKPB 2LXHC 2JRJA 1WILA 2VJEA 1LDJB 2Y43A 4UP0A 4LK9A 2C2LA 5KH9A 2MD8C 4LKAA 4L7XA 3HCUA 3C6WA 1WEWA 1MM2A 4UP5A 4MSXA 4AP4A 4NN2A 1FP0A 2YQMA 3VK6A 2YT5A 5B77A 3KNVA 2F6NA 2EODA 2Y1NA 1Z6UA 1WESA 1N87A 2YHNA 5J3XA 4ZUXU 5DKAA 4UI9B 2KGIA 3SOXA 2LDRA 3PURA 2MD7B 5B8DA 2JMDA 2MNYA 2ECJA 2CSYA 2KYUA 4YBSA 2E6RA 5FEYA 4A49A 4A0CD 2M85A 2Y1MA 2VPBA 1WEOA 4YBTA 3HCSA 4B86C 5TBNA 1WEMA 3U5OA 2OXQC 3HCTA 3LRQA 2DX8A 3I2DA 4CA1A 2AN6A 4XI1A 1WGMA 2EA6A 5TDWA 1WEEA 4I7CA 1IYMA 3O37A 5JG6A 2G6QA 2YU4A 1E4UA 4N4FA 2JMIA 3L1ZB 2PNXA 2YYRA 2VPDA 3O35A 3U5MA 4IC3A 5C13A 4AYCB 2ECWA 3GL6A 5B75A 2D8SA 3O70A 1JOCA 2G45A 1LDKC 2L5UA 3L1XA 4GNGA 2MA5A 4QF2A 4V3LC 1VYXA 3LQIA 4L58A 1G25A 3QZVA 4AYCA 2YHOA 1XWHA 3NG2A 3SOUA 3DPLR 1WE9A 2ECGA 3V43A 5H9MA 5G04B 3RTRB 5H1TA 2L75A 4GNDA 4R2YA 3ZPVE 1HYJA 2ECNA 4PTBA 1CHCA 2ECIA 1WFKA 1WENA 2K17A 1X4IA 2KREA 3M99A 2L0BA 2QICA 2BAYA 4FIPA 4N3WA 1VD4A 3IHPA 5FB1A 3O34A 2K1JA 4LJNA 2G43A 1VFYA 2KIZA 3KQIA 4BHWA 4CCGX 1DVPA 2XEUA 4PPEA 1Z60A 2LGVA 1F62A 1X4JA 1U6GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTG A;  2H0D A;  2KR4 A;  2NAA A;  3ZPV 1;  2KU3 A;  2LXP C;  4FJC A;  4YAB A;  4WZ0 A;  2KGG A;  1MM3 A;  4WZ2 A;  3LQJ A;  5TDR A;  1WIM A;  4S3O B;  2KWN A;  4X3G A;  3DQV R;  4W4U A;  3GV4 A;  5AIT A;  4GB0 A;  3T6R A;  3O33 A;  4YAT A;  4ZQL A;  2F42 A;  4WZ3 B;  1WEQ A;  3ZVY A;  2FUI A;  3C5K A;  5B76 A;  4Q6F A;  1V87 A;  3O36 A;  3LQH A;  4BBQ A;  3N9P A;  4YAX A;  3ZYQ A;  4YC9 A;  2MA6 A;  1BOR A;  3MHS A;  4WA6 A;  3T7L A;  3HTK C;  2QJ0 A;  4P5O B;  3MHH A;  3N9L A;  5H1U A;  2LGK A;  5LKX A;  5B79 A;  1T1H A;  4LLB A;  3RPG B;  1WEP A;  3ZVZ B;  3U5P A;  2VPE A;  5FB0 A;  5DIN A;  2MUM A;  2VNF A;  2VJF A;  4F52 B;  2LGG A;  4LAD B;  1ZBD B;  2CT2 A;  3N9N A;  5FER A;  2FUU A;  4AUQ B;  5LKT A;  1K2F A;  2I50 A;  4YBM A;  4GNE A;  3FL2 A;  2ECV A;  4A4C A;  3L11 A;  4FK5 A;  2E6S A;  2H0D B;  5C11 A;  2RSD A;  5D1K B;  5KH3 A;  5LKZ A;  4V3K C;  2L80 A;  2EGP A;  4R7E A;  4S3O C;  5TRB A;  2KWK A;  2K4D A;  5D1M B;  4ZDT A;  2C2V S;  3O7A A;  4A4B A;  4C9Z A;  1WEV A;  3EB6 A;  3M63 A;  2YSJ A;  5KH7 A;  2YQL A;  2HYE D;  2LN0 A;  2K16 A;  4GNF A;  1Z2Q A;  5G0F A;  4B7Y C;  4YAD A;  2M3H A;  2ZET C;  4MVT A;  2M6M A;  2L43 A;  3ASL A;  3U5N A;  2LV9 A;  2ECT A;  5LCW B;  5B78 A;  3KV6 A;  2LRI C;  5I3L A;  2JMJ A;  5D1L B;  3N9Q A;  5LKU A;  4IC2 A;  2VPG A;  5AIU A;  5TAB A;  1HYI A;  3PUQ A;  4QF3 A;  4I7B A;  4R8P K;  2MNZ A;  2LGL A;  2QIZ A;  2XB1 A;  1RMD A;  3SOW A;  3EB5 A;  3RPG C;  3M62 A;  4FO9 A;  3SHB A;  3N9O A;  2CKL B;  2KFT A;  2YRE A;  2VP7 A;  2HDP A;  2MT5 A;  2PUY A;  2YSM A;  1X4U A;  4AVX A;  1WEU A;  2KE1 A;  5G05 B;  2RI7 A;  2CSZ A;  3N9M A;  2LQ6 A;  3PHD A;  5H1V A;  5EYA F;  1JM7 B;  2YW8 A;  2VJF B;  2M1R A;  3KV5 A;  2CKL A;  2VJE B;  2KWO A;  2MIQ A;  4I7D A;  2FSA A;  2UZG A;  2IDA A;  1FBV A;  3ZNI A;  2YUC A;  2KWJ A;  2F6J A;  1JM7 A;  2YUR A;  4O64 A;  4TKP B;  2LXH C;  2JRJ A;  1WIL A;  2VJE A;  1LDJ B;  2Y43 A;  4UP0 A;  4LK9 A;  2C2L A;  5KH9 A;  2MD8 C;  4LKA A;  4L7X A;  3HCU A;  3C6W A;  1WEW A;  1MM2 A;  4UP5 A;  4MSX A;  4AP4 A;  4NN2 A;  1FP0 A;  2YQM A;  3VK6 A;  2YT5 A;  5B77 A;  3KNV A;  2F6N A;  2EOD A;  2Y1N A;  1Z6U A;  1WES A;  1N87 A;  2YHN A;  5J3X A;  4ZUX U;  5DKA A;  4UI9 B;  2KGI A;  3SOX A;  2LDR A;  3PUR A;  2MD7 B;  5B8D A;  2JMD A;  2MNY A;  2ECJ A;  2CSY A;  2KYU A;  4YBS A;  2E6R A;  5FEY A;  4A49 A;  4A0C D;  2M85 A;  2Y1M A;  2VPB A;  1WEO A;  4YBT A;  3HCS A;  4B86 C;  5TBN A;  1WEM A;  3U5O A;  2OXQ C;  3HCT A;  3LRQ A;  2DX8 A;  3I2D A;  4CA1 A;  2AN6 A;  4XI1 A;  1WGM A;  2EA6 A;  5TDW A;  1WEE A;  4I7C A;  1IYM A;  3O37 A;  5JG6 A;  2G6Q A;  2YU4 A;  1E4U A;  4N4F A;  2JMI A;  3L1Z B;  2PNX A;  2YYR A;  2VPD A;  3O35 A;  3U5M A;  4IC3 A;  5C13 A;  4AYC B;  2ECW A;  3GL6 A;  5B75 A;  2D8S A;  3O70 A;  1JOC A;  2G45 A;  1LDK C;  2L5U A;  3L1X A;  4GNG A;  2MA5 A;  4QF2 A;  4V3L C;  1VYX A;  3LQI A;  4L58 A;  1G25 A;  3QZV A;  4AYC A;  2YHO A;  1XWH A;  3NG2 A;  3SOU A;  3DPL R;  1WE9 A;  2ECG A;  3V43 A;  5H9M A;  5G04 B;  3RTR B;  5H1T A;  2L75 A;  4GND A;  4R2Y A;  3ZPV E;  1HYJ A;  2ECN A;  4PTB A;  1CHC A;  2ECI A;  1WFK A;  1WEN A;  2K17 A;  1X4I A;  2KRE A;  3M99 A;  2L0B A;  2QIC A;  2BAY A;  4FIP A;  4N3W A;  1VD4 A;  3IHP A;  5FB1 A;  3O34 A;  2K1J A;  4LJN A;  2G43 A;  1VFY A;  2KIZ A;  3KQI A;  4BHW A;  4CCG X;  1DVP A;  2XEU A;  4PPE A;  1Z60 A;  2LGV A;  1F62 A;  1X4J A;  1U6G B; 
#chains in the Genus database with same CATH topology
 3ZTG A;  2H0D A;  1DCQ A;  2KR4 A;  2NAA A;  3ZPV 1;  2KU3 A;  2LXP C;  4FJC A;  4YAB A;  4WZ0 A;  2KGG A;  1MM3 A;  4WZ2 A;  3LQJ A;  5TDR A;  1WIM A;  3LVQ E;  4S3O B;  2KWN A;  4X3G A;  3DQV R;  4W4U A;  3GV4 A;  3Q1D A;  5AIT A;  4GB0 A;  3T6R A;  3O33 A;  4YAT A;  4ZQL A;  2F42 A;  4WZ3 B;  1WEQ A;  3ZVY A;  2FUI A;  3C5K A;  5B76 A;  4Q6F A;  1V87 A;  2XP0 A;  3O36 A;  3LQH A;  4BBQ A;  2M13 A;  3N9P A;  4YAX A;  2OWA A;  5K3Q A;  2B0O E;  3ZYQ A;  4YC9 A;  2MA6 A;  1BOR A;  3MHS A;  4WA6 A;  3T7L A;  3HTK C;  2QJ0 A;  4P5O B;  3MHH A;  3N9L A;  5H1U A;  2LGK A;  2KKX A;  5LKX A;  5B79 A;  1T1H A;  5SVY A;  4LLB A;  3RPG B;  1WEP A;  3ZVZ B;  5SVX A;  3U5P A;  2VPE A;  5FB0 A;  5DIN A;  2MUM A;  2VNF A;  2VJF A;  4F52 B;  4O62 A;  2LGG A;  2JM3 A;  4LAD B;  1ZBD B;  2CT2 A;  3DDT A;  3N9N A;  5FER A;  2FUU A;  4QQ4 A;  4AUQ B;  5LKT A;  1K2F A;  2I50 A;  4YBM A;  4GNE A;  3FL2 A;  2ECV A;  4A4C A;  3L11 A;  4FK5 A;  2E6S A;  2H0D B;  5C11 A;  2RSD A;  5D1K B;  5KH3 A;  5LKZ A;  4V3K C;  2L80 A;  2EGP A;  4R7E A;  4S3O C;  5TRB A;  2KWK A;  2K4D A;  5D1M B;  4ZDT A;  2C2V S;  3O7A A;  4A4B A;  4C9Z A;  1WEV A;  2EGM A;  3EB6 A;  3M63 A;  2YSJ A;  5KH7 A;  2YQL A;  2HYE D;  3H7H A;  2XOY A;  2LN0 A;  2K16 A;  4GNF A;  1Z2Q A;  5G0F A;  4B7Y C;  4YAD A;  2M3H A;  2ZET C;  4MVT A;  3T9K A;  2M6M A;  2L43 A;  3ASL A;  3U5N A;  2LV9 A;  2ECT A;  5LCW B;  5B78 A;  4F1P A;  3KV6 A;  2LRI C;  5I3L A;  2JMJ A;  2CRR A;  5D1L B;  3N9Q A;  5LKU A;  4IC2 A;  2VPG A;  5AIU A;  2IQJ A;  5TAB A;  1HYI A;  3PUQ A;  4QF3 A;  4I7B A;  4R8P K;  2MNZ A;  2LGL A;  2QIZ A;  2XB1 A;  3E2D A;  1RMD A;  5SVI B;  3SOW A;  3EB5 A;  3RPG C;  3M62 A;  4FO9 A;  3SHB A;  3N9O A;  2CKL B;  2KFT A;  2YRE A;  2VP7 A;  2HDP A;  2MT5 A;  2PUY A;  2YSM A;  1X4U A;  4AVX A;  3LVR E;  1WEU A;  2KE1 A;  5G05 B;  2RI7 A;  2CSZ A;  3N9M A;  2LQ6 A;  2JUN A;  3PHD A;  5H1V A;  2YVR A;  5EYA F;  1JM7 B;  2YW8 A;  5SVI A;  2VJF B;  4OGE A;  2M1R A;  3KV5 A;  2CKL A;  3PLW A;  2FD4 A;  2VJE B;  2KWO A;  2MIQ A;  4I7D A;  2FSA A;  2UZG A;  2IDA A;  1FBV A;  3FM8 C;  3ZNI A;  2YUC A;  2KWJ A;  2F6J A;  2CSV A;  1JM7 A;  2YUR A;  3FEH A;  4O64 A;  4TKP B;  3KDE C;  2LXH C;  4OGC A;  2JRJ A;  1WIL A;  2VJE A;  1LDJ B;  2Y43 A;  4UP0 A;  4LK9 A;  3M7K A;  2C2L A;  5KH9 A;  2MD8 C;  4LKA A;  4L7X A;  3HCU A;  4H9D A;  3C6W A;  2KKY A;  1WEW A;  1MM2 A;  4UP5 A;  2CRW A;  4MSX A;  4AP4 A;  4NN2 A;  1FP0 A;  2YQM A;  3FAO A;  3VK6 A;  3SUB A;  2YT5 A;  5B77 A;  3KNV A;  2F6N A;  2EOD A;  2Y1N A;  1Z6U A;  4Z0R A;  1WES A;  1N87 A;  2YHN A;  5J3X A;  2E61 A;  4ZUX U;  5DKA A;  4UI9 B;  3JUE A;  2KGI A;  3SOX A;  2LDR A;  3PUR A;  2XOC A;  2MD7 B;  5B8D A;  2FFW A;  2JMD A;  2DSM A;  2MNY A;  2ECJ A;  3LDY A;  2XOZ A;  2CSY A;  2KYU A;  2DJA A;  4YBS A;  2E6R A;  5FEY A;  4A49 A;  4A0C D;  2M85 A;  2Y1M A;  3O47 A;  2VPB A;  1WEO A;  4YBT A;  3HCS A;  4B86 C;  5TBN A;  1WEM A;  3U5O A;  2OXQ C;  3HCT A;  3LRQ A;  2DX8 A;  3I2D A;  2RR4 A;  4CA1 A;  2MKE A;  2AN6 A;  4XI1 A;  1WGM A;  1MBM A;  2EA6 A;  5TDW A;  1WEE A;  4I7C A;  1IYM A;  3O37 A;  5JG6 A;  2G6Q A;  2YU4 A;  1E4U A;  2D8U A;  4N4F A;  2JMI A;  3L1Z B;  2PNX A;  2LAU A;  2YYR A;  4Z0O A;  2VPD A;  3FJU B;  2L7P A;  3O35 A;  3U5M A;  3DWD A;  4IC3 A;  5C13 A;  4AYC B;  2ECW A;  3GL6 A;  3MDB C;  5B75 A;  2D8S A;  3O70 A;  1JOC A;  2G45 A;  1LDK C;  2L5U A;  3L1X A;  4GNG A;  2MA5 A;  4QF2 A;  4V3L C;  1VYX A;  3LQI A;  4L58 A;  1G25 A;  3QZV A;  4AYC A;  2YHO A;  1XWH A;  3NG2 A;  3SOU A;  3DPL R;  1WE9 A;  2ECG A;  3V43 A;  5H9M A;  5G04 B;  3RTR B;  5H1T A;  2L75 A;  4GND A;  3LJU X;  2EXU A;  4R2Y A;  3ZPV E;  1HYJ A;  2ECN A;  4PTB A;  1CHC A;  2ECI A;  1WFK A;  1WEN A;  3FAN A;  2K17 A;  1X4I A;  2CON A;  2KRE A;  3M99 A;  2L0B A;  2QIC A;  2BAY A;  4FIP A;  4N3W A;  1VD4 A;  3IHP A;  5FB1 A;  3O34 A;  2K1J A;  4LJN A;  2G43 A;  1VFY A;  2P57 A;  2KIZ A;  3KQI A;  4BHW A;  4CCG X;  1DVP A;  2XEU A;  4PPE A;  1Z60 A;  2LGV A;  1F62 A;  1X4J A;  1U6G B; 
#chains in the Genus database with same CATH homology
 3ZTG A;  2H0D A;  2KR4 A;  2NAA A;  3ZPV 1;  2KU3 A;  2LXP C;  4FJC A;  4YAB A;  4WZ0 A;  2KGG A;  1MM3 A;  4WZ2 A;  3LQJ A;  5TDR A;  1WIM A;  4S3O B;  2KWN A;  4X3G A;  3DQV R;  4W4U A;  3GV4 A;  5AIT A;  4GB0 A;  3T6R A;  3O33 A;  4YAT A;  4ZQL A;  2F42 A;  4WZ3 B;  1WEQ A;  3ZVY A;  2FUI A;  3C5K A;  5B76 A;  4Q6F A;  1V87 A;  3O36 A;  3LQH A;  4BBQ A;  3N9P A;  4YAX A;  3ZYQ A;  4YC9 A;  2MA6 A;  1BOR A;  3MHS A;  4WA6 A;  3T7L A;  3HTK C;  2QJ0 A;  4P5O B;  3MHH A;  3N9L A;  5H1U A;  2LGK A;  5LKX A;  5B79 A;  1T1H A;  4LLB A;  3RPG B;  1WEP A;  3ZVZ B;  3U5P A;  2VPE A;  5FB0 A;  5DIN A;  2MUM A;  2VNF A;  2VJF A;  4F52 B;  2LGG A;  4LAD B;  1ZBD B;  2CT2 A;  3N9N A;  5FER A;  2FUU A;  4AUQ B;  5LKT A;  1K2F A;  2I50 A;  4YBM A;  4GNE A;  3FL2 A;  2ECV A;  4A4C A;  3L11 A;  4FK5 A;  2E6S A;  2H0D B;  5C11 A;  2RSD A;  5D1K B;  5KH3 A;  5LKZ A;  4V3K C;  2L80 A;  2EGP A;  4R7E A;  4S3O C;  5TRB A;  2KWK A;  2K4D A;  5D1M B;  4ZDT A;  2C2V S;  3O7A A;  4A4B A;  4C9Z A;  1WEV A;  3EB6 A;  3M63 A;  2YSJ A;  5KH7 A;  2YQL A;  2HYE D;  2LN0 A;  2K16 A;  4GNF A;  1Z2Q A;  5G0F A;  4B7Y C;  4YAD A;  2M3H A;  2ZET C;  4MVT A;  2M6M A;  2L43 A;  3ASL A;  3U5N A;  2LV9 A;  2ECT A;  5LCW B;  5B78 A;  3KV6 A;  2LRI C;  5I3L A;  2JMJ A;  5D1L B;  3N9Q A;  5LKU A;  4IC2 A;  2VPG A;  5AIU A;  5TAB A;  1HYI A;  3PUQ A;  4QF3 A;  4I7B A;  4R8P K;  2MNZ A;  2LGL A;  2QIZ A;  2XB1 A;  1RMD A;  3SOW A;  3EB5 A;  3RPG C;  3M62 A;  4FO9 A;  3SHB A;  3N9O A;  2CKL B;  2KFT A;  2YRE A;  2VP7 A;  2HDP A;  2MT5 A;  2PUY A;  2YSM A;  1X4U A;  4AVX A;  1WEU A;  2KE1 A;  5G05 B;  2RI7 A;  2CSZ A;  3N9M A;  2LQ6 A;  3PHD A;  5H1V A;  5EYA F;  1JM7 B;  2YW8 A;  2VJF B;  2M1R A;  3KV5 A;  2CKL A;  2VJE B;  2KWO A;  2MIQ A;  4I7D A;  2FSA A;  2UZG A;  2IDA A;  1FBV A;  3ZNI A;  2YUC A;  2KWJ A;  2F6J A;  1JM7 A;  2YUR A;  4O64 A;  4TKP B;  2LXH C;  2JRJ A;  1WIL A;  2VJE A;  1LDJ B;  2Y43 A;  4UP0 A;  4LK9 A;  2C2L A;  5KH9 A;  2MD8 C;  4LKA A;  4L7X A;  3HCU A;  3C6W A;  1WEW A;  1MM2 A;  4UP5 A;  4MSX A;  4AP4 A;  4NN2 A;  1FP0 A;  2YQM A;  3VK6 A;  2YT5 A;  5B77 A;  3KNV A;  2F6N A;  2EOD A;  2Y1N A;  1Z6U A;  1WES A;  1N87 A;  2YHN A;  5J3X A;  4ZUX U;  5DKA A;  4UI9 B;  2KGI A;  3SOX A;  2LDR A;  3PUR A;  2MD7 B;  5B8D A;  2JMD A;  2MNY A;  2ECJ A;  2CSY A;  2KYU A;  4YBS A;  2E6R A;  5FEY A;  4A49 A;  4A0C D;  2M85 A;  2Y1M A;  2VPB A;  1WEO A;  4YBT A;  3HCS A;  4B86 C;  5TBN A;  1WEM A;  3U5O A;  2OXQ C;  3HCT A;  3LRQ A;  2DX8 A;  3I2D A;  4CA1 A;  2AN6 A;  4XI1 A;  1WGM A;  2EA6 A;  5TDW A;  1WEE A;  4I7C A;  1IYM A;  3O37 A;  5JG6 A;  2G6Q A;  2YU4 A;  1E4U A;  4N4F A;  2JMI A;  3L1Z B;  2PNX A;  2YYR A;  2VPD A;  3O35 A;  3U5M A;  4IC3 A;  5C13 A;  4AYC B;  2ECW A;  3GL6 A;  5B75 A;  2D8S A;  3O70 A;  1JOC A;  2G45 A;  1LDK C;  2L5U A;  3L1X A;  4GNG A;  2MA5 A;  4QF2 A;  4V3L C;  1VYX A;  3LQI A;  4L58 A;  1G25 A;  3QZV A;  4AYC A;  2YHO A;  1XWH A;  3NG2 A;  3SOU A;  3DPL R;  1WE9 A;  2ECG A;  3V43 A;  5H9M A;  5G04 B;  3RTR B;  5H1T A;  2L75 A;  4GND A;  4R2Y A;  3ZPV E;  1HYJ A;  2ECN A;  4PTB A;  1CHC A;  2ECI A;  1WFK A;  1WEN A;  2K17 A;  1X4I A;  2KRE A;  3M99 A;  2L0B A;  2QIC A;  2BAY A;  4FIP A;  4N3W A;  1VD4 A;  3IHP A;  5FB1 A;  3O34 A;  2K1J A;  4LJN A;  2G43 A;  1VFY A;  2KIZ A;  3KQI A;  4BHW A;  4CCG X;  1DVP A;  2XEU A;  4PPE A;  1Z60 A;  2LGV A;  1F62 A;  1X4J A;  1U6G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...