2HDPA

Solution structure of hdm2 ring finger domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
b'SLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-protein ligase E3 Mdm2
publication title Solution structure of the Hdm2 C2H2C4 RING, a domain critical for ubiquitination of p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 9
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2hdpA00
2KGIA 4L7XA 2M1RA 1U6GB 5G05B 3O33A 4IC2A 5H1TA 1MM3A 3L11A 4IC3A 2Y43A 3N9LA 2LN0A 2EODA 4V3KC 2JMDA 3N9MA 2MT5A 2VNFA 2KWJA 3HCSA 2ECNA 2KWOA 2MD8C 1HYJA 4B86C 5B75A 2ECVA 2BAYA 2YQLA 1WFKA 1WIMA 2YU4A 1IYMA 4MVTA 2IDAA 4B7YC 2Y1MA 4XI1A 4BBQA 2F6JA 4ZUXU 5D1LB 4A49A 5TRBA 5G0FA 4R8PK 2LGLA 2YSMA 4AYCA 3N9QA 1MM2A 2KYUA 2L75A 4QF2A 3HCUA 2VJEB 3ZVYA 1WEPA 3SHBA 2YW8A 4FO9A 2YHOA 5KH9A 2CKLB 3HTKC 3O36A 2LGVA 2ECIA 1VFYA 3LQHA 1WE9A 2K4DA 3DPLR 2NAAA 2XEUA 4NN2A 4CA1A 5LKXA 3SOXA 4UI9B 1HYIA 2YUCA 4WZ3B 3M63A 2JRJA 3L1XA 2F6NA 1JOCA 3EB5A 2L43A 3L1ZB 4PPEA 2K16A 4TKPB 5C13A 4A4CA 2I50A 2KGGA 2ECTA 1WEVA 1WEMA 3PURA 1FP0A 2Y1NA 2L80A 2DX8A 4C9ZA 1CHCA 4UP0A 2YT5A 2E6SA 2VP7A 3N9PA 5B79A 1Z60A 2YHNA 1ZBDB 2FSAA 2CT2A 5LCWB 5TDWA 3O70A 3EB6A 2CKLA 1N87A 2LDRA 1WILA 2KREA 2QIZA 2YQMA 4A0CD 2L0BA 4F52B 2G43A 3U5PA 1F62A 3M99A 5B78A 3MHSA 2YSJA 5D1KB 4LADB 2M3HA 4R2YA 2ECGA 2K1JA 3VK6A 2K17A 2VPEA 3GV4A 2KU3A 4LK9A 4N3WA 4N4FA 4V3LC 2YURA 3SOWA 5JG6A 4MSXA 2VPGA 4GB0A 5B8DA 1X4IA 4PTBA 2AN6A 3HCTA 2KWKA 5TABA 1WEWA 3SOUA 4YBMA 2PNXA 4O64A 5B77A 2G6QA 3FL2A 4YATA 2MD7B 3O7AA 3DQVR 3O34A 3RPGC 2VJFB 1WEOA 1T1HA 3KQIA 2YREA 4LLBA 1X4JA 1WESA 2C2VS 3KV5A 2KFTA 3ZTGA 5FERA 2EA6A 2KE1A 5LKUA 1WEUA 3C5KA 1RMDA 4UP5A 1DVPA 2G45A 2VPDA 2D8SA 3NG2A 2M85A 2MA6A 5TDRA 2E6RA 3U5OA 2LV9A 1VD4A 3U5NA 1G25A 5LKTA 2MUMA 4LJNA 4FK5A 4WZ0A 1WEQA 2F42A 5KH7A 3V43A 4BHWA 5AITA 2LGGA 4WZ2A 1VYXA 3LQJA 1V87A 4S3OC 4GNGA 2VJFA 4YABA 4CCGX 2FUIA 2PUYA 4FIPA 5H1UA 2MA5A 4X3GA 3C6WA 5D1MB 4WA6A 2MNYA 2FUUA 4GNEA 2LXPC 4Q6FA 4YBSA 4GNDA 2LGKA 2KWNA 2CSYA 3RPGB 3O37A 1Z6UA 5H1VA 2EGPA 1JM7B 3I2DA 3PHDA 1LDJB 2QJ0A 4L58A 1FBVA 2MIQA 5FEYA 3ZVZB 2RSDA 3T7LA 2QICA 2JMJA 2UZGA 2ECWA 3T6RA 3MHHA 1E4UA 1Z2QA 4YC9A 3N9NA 4LKAA 1XWHA 2H0DB 2XB1A 3KNVA 4YBTA 2LQ6A 2MNZA 3ZPV1 3IHPA 5DKAA 3ZYQA 2KIZA 1X4UA 4P5OB 4FJCA 3RTRB 2LXHC 4GNFA 2ZETC 3ZPVE 3LRQA 4YAXA 4ZQLA 5FB1A 4S3OB 2HDPA 3PUQA 3O35A 3QZVA 1WEEA 1WENA 4R7EA 4AUQB 2KR4A 1JM7A 4I7BA 4I7DA 2VPBA 5B76A 5FB0A 4A4BA 2RI7A 3ASLA 3KV6A 3ZNIA 2L5UA 5TBNA 5LKZA 3GL6A 2HYED 1LDKC 4W4UA 5J3XA 2H0DA 4QF3A 4I7CA 2OXQC 5H9MA 4ZDTA 2M6MA 4AP4A 1BORA 5DINA 5EYAF 5C11A 1K2FA 1WGMA 2CSZA 3N9OA 2ECJA 4AVXA 3LQIA 3M62A 2C2LA 5AIUA 2VJEA 2YYRA 3U5MA 2JMIA 2LRIC 5KH3A 4AYCB 4YADA 5G04B 5I3LA
chains in the Genus database with same CATH superfamily
2KGIA 4L7XA 2M1RA 1U6GB 5G05B 3O33A 4IC2A 5H1TA 1MM3A 3L11A 4IC3A 2Y43A 3N9LA 2LN0A 3MDBC 2EODA 4V3KC 2JMDA 3N9MA 2MT5A 2VNFA 2KWJA 3HCSA 3LDYA 2ECNA 2KWOA 2MD8C 1HYJA 4B86C 5B75A 2ECVA 2BAYA 2YQLA 1WFKA 1WIMA 2YU4A 2CRWA 1IYMA 4MVTA 2DSMA 2IDAA 4B7YC 2FD4A 2Y1MA 4XI1A 4BBQA 2F6JA 4ZUXU 5D1LB 4A49A 5TRBA 5G0FA 4R8PK 2LGLA 3SUBA 2YSMA 4AYCA 3N9QA 1MM2A 2KYUA 2L75A 4QF2A 3HCUA 3LJUX 2VJEB 3ZVYA 1WEPA 3SHBA 2YW8A 4FO9A 2YHOA 3LVQE 5KH9A 2CKLB 3HTKC 3O36A 2LGVA 2ECIA 1VFYA 1MBMA 3LQHA 1WE9A 2K4DA 3DPLR 2NAAA 2XEUA 4NN2A 4CA1A 5LKXA 5SVXA 3SOXA 4UI9B 1HYIA 2YUCA 4WZ3B 3M63A 2JRJA 3L1XA 2F6NA 1JOCA 3EB5A 2L43A 3L1ZB 4PPEA 2K16A 4TKPB 5C13A 3E2DA 4A4CA 2I50A 2KGGA 2ECTA 1WEVA 1WEMA 3PURA 1FP0A 2Y1NA 2L80A 2DX8A 4C9ZA 1CHCA 2XOYA 4UP0A 2YT5A 2E6SA 2VP7A 2RR4A 3N9PA 5B79A 1Z60A 2YHNA 3DDTA 2DJAA 1ZBDB 2JM3A 2FSAA 2CT2A 5LCWB 5TDWA 3O70A 3EB6A 2CKLA 1N87A 2XOZA 2LDRA 1WILA 2KREA 2QIZA 2YQMA 4A0CD 2L0BA 3PLWA 4F52B 2G43A 3U5PA 1F62A 3M99A 5B78A 3MHSA 4F1PA 3KDEC 2YSJA 5D1KB 4LADB 2M3HA 4R2YA 2ECGA 2K1JA 3VK6A 2K17A 2VPEA 3FEHA 3GV4A 3H7HA 2KU3A 3FM8C 4LK9A 4N3WA 5K3QA 4N4FA 4V3LC 2YURA 3SOWA 5JG6A 4MSXA 2VPGA 4GB0A 5B8DA 1X4IA 4PTBA 2AN6A 3HCTA 4H9DA 2KWKA 2CSVA 5TABA 1WEWA 3SOUA 4YBMA 2PNXA 4O64A 5B77A 2G6QA 3FL2A 4YATA 2MD7B 3O7AA 3DQVR 2B0OE 3O34A 3RPGC 3DWDA 3T9KA 2VJFB 1WEOA 1T1HA 3KQIA 2YREA 4LLBA 1X4JA 1WESA 2C2VS 3KV5A 2KFTA 3ZTGA 5FERA 2EA6A 2KE1A 1DCQA 5LKUA 2E61A 1WEUA 4Z0OA 3C5KA 1RMDA 4UP5A 1DVPA 4OGEA 2G45A 2VPDA 2D8SA 3NG2A 4O62A 2M85A 2MA6A 2L7PA 5TDRA 2E6RA 3U5OA 2LV9A 1VD4A 3U5NA 1G25A 5LKTA 2MUMA 4LJNA 4FK5A 4WZ0A 1WEQA 2F42A 5KH7A 3V43A 4BHWA 5AITA 2LGGA 4WZ2A 1VYXA 3LQJA 1V87A 2EXUA 4S3OC 4GNGA 3Q1DA 2LAUA 2VJFA 4YABA 3FAOA 4CCGX 2FUIA 2PUYA 4FIPA 5H1UA 2MA5A 4X3GA 3C6WA 4OGCA 5D1MB 4WA6A 2MNYA 2FUUA 4GNEA 2JUNA 2LXPC 4Q6FA 2CRRA 4QQ4A 4YBSA 4GNDA 2LGKA 2KWNA 2CSYA 3RPGB 2OWAA 3O37A 2CONA 1Z6UA 5H1VA 2EGPA 1JM7B 3I2DA 3PHDA 2KKYA 1LDJB 2QJ0A 4L58A 2P57A 1FBVA 2MIQA 3JUEA 2M13A 5FEYA 3ZVZB 2RSDA 3T7LA 2QICA 2JMJA 2UZGA 2ECWA 3T6RA 3MHHA 1E4UA 1Z2QA 4YC9A 3N9NA 4LKAA 3M7KA 3O47A 1XWHA 2H0DB 2XB1A 3KNVA 4YBTA 2LQ6A 2MNZA 2IQJA 3ZPV1 2KKXA 3IHPA 3FANA 4Z0RA 5DKAA 3ZYQA 2EGMA 2KIZA 1X4UA 4P5OB 4FJCA 2LXHC 3RTRB 4GNFA 2XP0A 2ZETC 3ZPVE 3LRQA 4YAXA 4ZQLA 5FB1A 4S3OB 2HDPA 3PUQA 2XOCA 3O35A 3QZVA 2YVRA 1WEEA 5SVIB 1WENA 4R7EA 4AUQB 2KR4A 1JM7A 3FJUB 4I7BA 4I7DA 2VPBA 5B76A 5FB0A 4A4BA 2RI7A 2FFWA 5SVYA 3ASLA 3KV6A 3ZNIA 2L5UA 5TBNA 5LKZA 3GL6A 2HYED 1LDKC 4W4UA 5J3XA 2H0DA 4QF3A 4I7CA 2OXQC 5H9MA 4ZDTA 2D8UA 2M6MA 4AP4A 1BORA 5DINA 5EYAF 5C11A 1K2FA 1WGMA 2CSZA 3N9OA 2ECJA 4AVXA 3LQIA 2MKEA 3M62A 2C2LA 5AIUA 3LVRE 2VJEA 2YYRA 5SVIA 3U5MA 2JMIA 2LRIC 5KH3A 4AYCB 4YADA 5G04B 5I3LA
chains in the Genus database with same CATH topology
2KGIA 4L7XA 2M1RA 1U6GB 5G05B 3O33A 4IC2A 5H1TA 1MM3A 3L11A 4IC3A 2Y43A 3N9LA 2LN0A 2EODA 4V3KC 2JMDA 3N9MA 2MT5A 2VNFA 2KWJA 3HCSA 2ECNA 2KWOA 2MD8C 1HYJA 4B86C 5B75A 2ECVA 2BAYA 2YQLA 1WFKA 1WIMA 2YU4A 1IYMA 4MVTA 2IDAA 4B7YC 2Y1MA 4XI1A 4BBQA 2F6JA 4ZUXU 5D1LB 4A49A 5TRBA 5G0FA 4R8PK 2LGLA 2YSMA 4AYCA 3N9QA 1MM2A 2KYUA 2L75A 4QF2A 3HCUA 2VJEB 3ZVYA 1WEPA 3SHBA 2YW8A 4FO9A 2YHOA 5KH9A 2CKLB 3HTKC 3O36A 2LGVA 2ECIA 1VFYA 3LQHA 1WE9A 2K4DA 3DPLR 2NAAA 2XEUA 4NN2A 4CA1A 5LKXA 3SOXA 4UI9B 1HYIA 2YUCA 4WZ3B 3M63A 2JRJA 3L1XA 2F6NA 1JOCA 3EB5A 2L43A 3L1ZB 4PPEA 2K16A 4TKPB 5C13A 4A4CA 2I50A 2KGGA 2ECTA 1WEVA 1WEMA 3PURA 1FP0A 2Y1NA 2L80A 2DX8A 4C9ZA 1CHCA 4UP0A 2YT5A 2E6SA 2VP7A 3N9PA 5B79A 1Z60A 2YHNA 1ZBDB 2FSAA 2CT2A 5LCWB 5TDWA 3O70A 3EB6A 2CKLA 1N87A 2LDRA 1WILA 2KREA 2QIZA 2YQMA 4A0CD 2L0BA 4F52B 2G43A 3U5PA 1F62A 3M99A 5B78A 3MHSA 2YSJA 5D1KB 4LADB 2M3HA 4R2YA 2ECGA 2K1JA 3VK6A 2K17A 2VPEA 3GV4A 2KU3A 4LK9A 4N3WA 4N4FA 4V3LC 2YURA 3SOWA 5JG6A 4MSXA 2VPGA 4GB0A 5B8DA 1X4IA 4PTBA 2AN6A 3HCTA 2KWKA 5TABA 1WEWA 3SOUA 4YBMA 2PNXA 4O64A 5B77A 2G6QA 3FL2A 4YATA 2MD7B 3O7AA 3DQVR 3O34A 3RPGC 2VJFB 1WEOA 1T1HA 3KQIA 2YREA 4LLBA 1X4JA 1WESA 2C2VS 3KV5A 2KFTA 3ZTGA 5FERA 2EA6A 2KE1A 5LKUA 1WEUA 3C5KA 1RMDA 4UP5A 1DVPA 2G45A 2VPDA 2D8SA 3NG2A 2M85A 2MA6A 5TDRA 2E6RA 3U5OA 2LV9A 1VD4A 3U5NA 1G25A 5LKTA 2MUMA 4LJNA 4FK5A 4WZ0A 1WEQA 2F42A 5KH7A 3V43A 4BHWA 5AITA 2LGGA 4WZ2A 1VYXA 3LQJA 1V87A 4S3OC 4GNGA 2VJFA 4YABA 4CCGX 2FUIA 2PUYA 4FIPA 5H1UA 2MA5A 4X3GA 3C6WA 5D1MB 4WA6A 2MNYA 2FUUA 4GNEA 2LXPC 4Q6FA 4YBSA 4GNDA 2LGKA 2KWNA 2CSYA 3RPGB 3O37A 1Z6UA 5H1VA 2EGPA 1JM7B 3I2DA 3PHDA 1LDJB 2QJ0A 4L58A 1FBVA 2MIQA 5FEYA 3ZVZB 2RSDA 3T7LA 2QICA 2JMJA 2UZGA 2ECWA 3T6RA 3MHHA 1E4UA 1Z2QA 4YC9A 3N9NA 4LKAA 1XWHA 2H0DB 2XB1A 3KNVA 4YBTA 2LQ6A 2MNZA 3ZPV1 3IHPA 5DKAA 3ZYQA 2KIZA 1X4UA 4P5OB 4FJCA 3RTRB 2LXHC 4GNFA 2ZETC 3ZPVE 3LRQA 4YAXA 4ZQLA 5FB1A 4S3OB 2HDPA 3PUQA 3O35A 3QZVA 1WEEA 1WENA 4R7EA 4AUQB 2KR4A 1JM7A 4I7BA 4I7DA 2VPBA 5B76A 5FB0A 4A4BA 2RI7A 3ASLA 3KV6A 3ZNIA 2L5UA 5TBNA 5LKZA 3GL6A 2HYED 1LDKC 4W4UA 5J3XA 2H0DA 4QF3A 4I7CA 2OXQC 5H9MA 4ZDTA 2M6MA 4AP4A 1BORA 5DINA 5EYAF 5C11A 1K2FA 1WGMA 2CSZA 3N9OA 2ECJA 4AVXA 3LQIA 3M62A 2C2LA 5AIUA 2VJEA 2YYRA 3U5MA 2JMIA 2LRIC 5KH3A 4AYCB 4YADA 5G04B 5I3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGI A;  4L7X A;  2M1R A;  1U6G B;  5G05 B;  3O33 A;  4IC2 A;  5H1T A;  1MM3 A;  3L11 A;  4IC3 A;  2Y43 A;  3N9L A;  2LN0 A;  2EOD A;  4V3K C;  2JMD A;  3N9M A;  2MT5 A;  2VNF A;  2KWJ A;  3HCS A;  2ECN A;  2KWO A;  2MD8 C;  1HYJ A;  4B86 C;  5B75 A;  2ECV A;  2BAY A;  2YQL A;  1WFK A;  1WIM A;  2YU4 A;  1IYM A;  4MVT A;  2IDA A;  4B7Y C;  2Y1M A;  4XI1 A;  4BBQ A;  2F6J A;  4ZUX U;  5D1L B;  4A49 A;  5TRB A;  5G0F A;  4R8P K;  2LGL A;  2YSM A;  4AYC A;  3N9Q A;  1MM2 A;  2KYU A;  2L75 A;  4QF2 A;  3HCU A;  2VJE B;  3ZVY A;  1WEP A;  3SHB A;  2YW8 A;  4FO9 A;  2YHO A;  5KH9 A;  2CKL B;  3HTK C;  3O36 A;  2LGV A;  2ECI A;  1VFY A;  3LQH A;  1WE9 A;  2K4D A;  3DPL R;  2NAA A;  2XEU A;  4NN2 A;  4CA1 A;  5LKX A;  3SOX A;  4UI9 B;  1HYI A;  2YUC A;  4WZ3 B;  3M63 A;  2JRJ A;  3L1X A;  2F6N A;  1JOC A;  3EB5 A;  2L43 A;  3L1Z B;  4PPE A;  2K16 A;  4TKP B;  5C13 A;  4A4C A;  2I50 A;  2KGG A;  2ECT A;  1WEV A;  1WEM A;  3PUR A;  1FP0 A;  2Y1N A;  2L80 A;  2DX8 A;  4C9Z A;  1CHC A;  4UP0 A;  2YT5 A;  2E6S A;  2VP7 A;  3N9P A;  5B79 A;  1Z60 A;  2YHN A;  1ZBD B;  2FSA A;  2CT2 A;  5LCW B;  5TDW A;  3O70 A;  3EB6 A;  2CKL A;  1N87 A;  2LDR A;  1WIL A;  2KRE A;  2QIZ A;  2YQM A;  4A0C D;  2L0B A;  4F52 B;  2G43 A;  3U5P A;  1F62 A;  3M99 A;  5B78 A;  3MHS A;  2YSJ A;  5D1K B;  4LAD B;  2M3H A;  4R2Y A;  2ECG A;  2K1J A;  3VK6 A;  2K17 A;  2VPE A;  3GV4 A;  2KU3 A;  4LK9 A;  4N3W A;  4N4F A;  4V3L C;  2YUR A;  3SOW A;  5JG6 A;  4MSX A;  2VPG A;  4GB0 A;  5B8D A;  1X4I A;  4PTB A;  2AN6 A;  3HCT A;  2KWK A;  5TAB A;  1WEW A;  3SOU A;  4YBM A;  2PNX A;  4O64 A;  5B77 A;  2G6Q A;  3FL2 A;  4YAT A;  2MD7 B;  3O7A A;  3DQV R;  3O34 A;  3RPG C;  2VJF B;  1WEO A;  1T1H A;  3KQI A;  2YRE A;  4LLB A;  1X4J A;  1WES A;  2C2V S;  3KV5 A;  2KFT A;  3ZTG A;  5FER A;  2EA6 A;  2KE1 A;  5LKU A;  1WEU A;  3C5K A;  1RMD A;  4UP5 A;  1DVP A;  2G45 A;  2VPD A;  2D8S A;  3NG2 A;  2M85 A;  2MA6 A;  5TDR A;  2E6R A;  3U5O A;  2LV9 A;  1VD4 A;  3U5N A;  1G25 A;  5LKT A;  2MUM A;  4LJN A;  4FK5 A;  4WZ0 A;  1WEQ A;  2F42 A;  5KH7 A;  3V43 A;  4BHW A;  5AIT A;  2LGG A;  4WZ2 A;  1VYX A;  3LQJ A;  1V87 A;  4S3O C;  4GNG A;  2VJF A;  4YAB A;  4CCG X;  2FUI A;  2PUY A;  4FIP A;  5H1U A;  2MA5 A;  4X3G A;  3C6W A;  5D1M B;  4WA6 A;  2MNY A;  2FUU A;  4GNE A;  2LXP C;  4Q6F A;  4YBS A;  4GND A;  2LGK A;  2KWN A;  2CSY A;  3RPG B;  3O37 A;  1Z6U A;  5H1V A;  2EGP A;  1JM7 B;  3I2D A;  3PHD A;  1LDJ B;  2QJ0 A;  4L58 A;  1FBV A;  2MIQ A;  5FEY A;  3ZVZ B;  2RSD A;  3T7L A;  2QIC A;  2JMJ A;  2UZG A;  2ECW A;  3T6R A;  3MHH A;  1E4U A;  1Z2Q A;  4YC9 A;  3N9N A;  4LKA A;  1XWH A;  2H0D B;  2XB1 A;  3KNV A;  4YBT A;  2LQ6 A;  2MNZ A;  3ZPV 1;  3IHP A;  5DKA A;  3ZYQ A;  2KIZ A;  1X4U A;  4P5O B;  4FJC A;  3RTR B;  2LXH C;  4GNF A;  2ZET C;  3ZPV E;  3LRQ A;  4YAX A;  4ZQL A;  5FB1 A;  4S3O B;  2HDP A;  3PUQ A;  3O35 A;  3QZV A;  1WEE A;  1WEN A;  4R7E A;  4AUQ B;  2KR4 A;  1JM7 A;  4I7B A;  4I7D A;  2VPB A;  5B76 A;  5FB0 A;  4A4B A;  2RI7 A;  3ASL A;  3KV6 A;  3ZNI A;  2L5U A;  5TBN A;  5LKZ A;  3GL6 A;  2HYE D;  1LDK C;  4W4U A;  5J3X A;  2H0D A;  4QF3 A;  4I7C A;  2OXQ C;  5H9M A;  4ZDT A;  2M6M A;  4AP4 A;  1BOR A;  5DIN A;  5EYA F;  5C11 A;  1K2F A;  1WGM A;  2CSZ A;  3N9O A;  2ECJ A;  4AVX A;  3LQI A;  3M62 A;  2C2L A;  5AIU A;  2VJE A;  2YYR A;  3U5M A;  2JMI A;  2LRI C;  5KH3 A;  4AYC B;  4YAD A;  5G04 B;  5I3L A; 
#chains in the Genus database with same CATH topology
 2KGI A;  4L7X A;  2M1R A;  1U6G B;  5G05 B;  3O33 A;  4IC2 A;  5H1T A;  1MM3 A;  3L11 A;  4IC3 A;  2Y43 A;  3N9L A;  2LN0 A;  3MDB C;  2EOD A;  4V3K C;  2JMD A;  3N9M A;  2MT5 A;  2VNF A;  2KWJ A;  3HCS A;  3LDY A;  2ECN A;  2KWO A;  2MD8 C;  1HYJ A;  4B86 C;  5B75 A;  2ECV A;  2BAY A;  2YQL A;  1WFK A;  1WIM A;  2YU4 A;  2CRW A;  1IYM A;  4MVT A;  2DSM A;  2IDA A;  4B7Y C;  2FD4 A;  2Y1M A;  4XI1 A;  4BBQ A;  2F6J A;  4ZUX U;  5D1L B;  4A49 A;  5TRB A;  5G0F A;  4R8P K;  2LGL A;  3SUB A;  2YSM A;  4AYC A;  3N9Q A;  1MM2 A;  2KYU A;  2L75 A;  4QF2 A;  3HCU A;  3LJU X;  2VJE B;  3ZVY A;  1WEP A;  3SHB A;  2YW8 A;  4FO9 A;  2YHO A;  3LVQ E;  5KH9 A;  2CKL B;  3HTK C;  3O36 A;  2LGV A;  2ECI A;  1VFY A;  1MBM A;  3LQH A;  1WE9 A;  2K4D A;  3DPL R;  2NAA A;  2XEU A;  4NN2 A;  4CA1 A;  5LKX A;  5SVX A;  3SOX A;  4UI9 B;  1HYI A;  2YUC A;  4WZ3 B;  3M63 A;  2JRJ A;  3L1X A;  2F6N A;  1JOC A;  3EB5 A;  2L43 A;  3L1Z B;  4PPE A;  2K16 A;  4TKP B;  5C13 A;  3E2D A;  4A4C A;  2I50 A;  2KGG A;  2ECT A;  1WEV A;  1WEM A;  3PUR A;  1FP0 A;  2Y1N A;  2L80 A;  2DX8 A;  4C9Z A;  1CHC A;  2XOY A;  4UP0 A;  2YT5 A;  2E6S A;  2VP7 A;  2RR4 A;  3N9P A;  5B79 A;  1Z60 A;  2YHN A;  3DDT A;  2DJA A;  1ZBD B;  2JM3 A;  2FSA A;  2CT2 A;  5LCW B;  5TDW A;  3O70 A;  3EB6 A;  2CKL A;  1N87 A;  2XOZ A;  2LDR A;  1WIL A;  2KRE A;  2QIZ A;  2YQM A;  4A0C D;  2L0B A;  3PLW A;  4F52 B;  2G43 A;  3U5P A;  1F62 A;  3M99 A;  5B78 A;  3MHS A;  4F1P A;  3KDE C;  2YSJ A;  5D1K B;  4LAD B;  2M3H A;  4R2Y A;  2ECG A;  2K1J A;  3VK6 A;  2K17 A;  2VPE A;  3FEH A;  3GV4 A;  3H7H A;  2KU3 A;  3FM8 C;  4LK9 A;  4N3W A;  5K3Q A;  4N4F A;  4V3L C;  2YUR A;  3SOW A;  5JG6 A;  4MSX A;  2VPG A;  4GB0 A;  5B8D A;  1X4I A;  4PTB A;  2AN6 A;  3HCT A;  4H9D A;  2KWK A;  2CSV A;  5TAB A;  1WEW A;  3SOU A;  4YBM A;  2PNX A;  4O64 A;  5B77 A;  2G6Q A;  3FL2 A;  4YAT A;  2MD7 B;  3O7A A;  3DQV R;  2B0O E;  3O34 A;  3RPG C;  3DWD A;  3T9K A;  2VJF B;  1WEO A;  1T1H A;  3KQI A;  2YRE A;  4LLB A;  1X4J A;  1WES A;  2C2V S;  3KV5 A;  2KFT A;  3ZTG A;  5FER A;  2EA6 A;  2KE1 A;  1DCQ A;  5LKU A;  2E61 A;  1WEU A;  4Z0O A;  3C5K A;  1RMD A;  4UP5 A;  1DVP A;  4OGE A;  2G45 A;  2VPD A;  2D8S A;  3NG2 A;  4O62 A;  2M85 A;  2MA6 A;  2L7P A;  5TDR A;  2E6R A;  3U5O A;  2LV9 A;  1VD4 A;  3U5N A;  1G25 A;  5LKT A;  2MUM A;  4LJN A;  4FK5 A;  4WZ0 A;  1WEQ A;  2F42 A;  5KH7 A;  3V43 A;  4BHW A;  5AIT A;  2LGG A;  4WZ2 A;  1VYX A;  3LQJ A;  1V87 A;  2EXU A;  4S3O C;  4GNG A;  3Q1D A;  2LAU A;  2VJF A;  4YAB A;  3FAO A;  4CCG X;  2FUI A;  2PUY A;  4FIP A;  5H1U A;  2MA5 A;  4X3G A;  3C6W A;  4OGC A;  5D1M B;  4WA6 A;  2MNY A;  2FUU A;  4GNE A;  2JUN A;  2LXP C;  4Q6F A;  2CRR A;  4QQ4 A;  4YBS A;  4GND A;  2LGK A;  2KWN A;  2CSY A;  3RPG B;  2OWA A;  3O37 A;  2CON A;  1Z6U A;  5H1V A;  2EGP A;  1JM7 B;  3I2D A;  3PHD A;  2KKY A;  1LDJ B;  2QJ0 A;  4L58 A;  2P57 A;  1FBV A;  2MIQ A;  3JUE A;  2M13 A;  5FEY A;  3ZVZ B;  2RSD A;  3T7L A;  2QIC A;  2JMJ A;  2UZG A;  2ECW A;  3T6R A;  3MHH A;  1E4U A;  1Z2Q A;  4YC9 A;  3N9N A;  4LKA A;  3M7K A;  3O47 A;  1XWH A;  2H0D B;  2XB1 A;  3KNV A;  4YBT A;  2LQ6 A;  2MNZ A;  2IQJ A;  3ZPV 1;  2KKX A;  3IHP A;  3FAN A;  4Z0R A;  5DKA A;  3ZYQ A;  2EGM A;  2KIZ A;  1X4U A;  4P5O B;  4FJC A;  2LXH C;  3RTR B;  4GNF A;  2XP0 A;  2ZET C;  3ZPV E;  3LRQ A;  4YAX A;  4ZQL A;  5FB1 A;  4S3O B;  2HDP A;  3PUQ A;  2XOC A;  3O35 A;  3QZV A;  2YVR A;  1WEE A;  5SVI B;  1WEN A;  4R7E A;  4AUQ B;  2KR4 A;  1JM7 A;  3FJU B;  4I7B A;  4I7D A;  2VPB A;  5B76 A;  5FB0 A;  4A4B A;  2RI7 A;  2FFW A;  5SVY A;  3ASL A;  3KV6 A;  3ZNI A;  2L5U A;  5TBN A;  5LKZ A;  3GL6 A;  2HYE D;  1LDK C;  4W4U A;  5J3X A;  2H0D A;  4QF3 A;  4I7C A;  2OXQ C;  5H9M A;  4ZDT A;  2D8U A;  2M6M A;  4AP4 A;  1BOR A;  5DIN A;  5EYA F;  5C11 A;  1K2F A;  1WGM A;  2CSZ A;  3N9O A;  2ECJ A;  4AVX A;  3LQI A;  2MKE A;  3M62 A;  2C2L A;  5AIU A;  3LVR E;  2VJE A;  2YYR A;  5SVI A;  3U5M A;  2JMI A;  2LRI C;  5KH3 A;  4AYC B;  4YAD A;  5G04 B;  5I3L A; 
#chains in the Genus database with same CATH homology
 2KGI A;  4L7X A;  2M1R A;  1U6G B;  5G05 B;  3O33 A;  4IC2 A;  5H1T A;  1MM3 A;  3L11 A;  4IC3 A;  2Y43 A;  3N9L A;  2LN0 A;  2EOD A;  4V3K C;  2JMD A;  3N9M A;  2MT5 A;  2VNF A;  2KWJ A;  3HCS A;  2ECN A;  2KWO A;  2MD8 C;  1HYJ A;  4B86 C;  5B75 A;  2ECV A;  2BAY A;  2YQL A;  1WFK A;  1WIM A;  2YU4 A;  1IYM A;  4MVT A;  2IDA A;  4B7Y C;  2Y1M A;  4XI1 A;  4BBQ A;  2F6J A;  4ZUX U;  5D1L B;  4A49 A;  5TRB A;  5G0F A;  4R8P K;  2LGL A;  2YSM A;  4AYC A;  3N9Q A;  1MM2 A;  2KYU A;  2L75 A;  4QF2 A;  3HCU A;  2VJE B;  3ZVY A;  1WEP A;  3SHB A;  2YW8 A;  4FO9 A;  2YHO A;  5KH9 A;  2CKL B;  3HTK C;  3O36 A;  2LGV A;  2ECI A;  1VFY A;  3LQH A;  1WE9 A;  2K4D A;  3DPL R;  2NAA A;  2XEU A;  4NN2 A;  4CA1 A;  5LKX A;  3SOX A;  4UI9 B;  1HYI A;  2YUC A;  4WZ3 B;  3M63 A;  2JRJ A;  3L1X A;  2F6N A;  1JOC A;  3EB5 A;  2L43 A;  3L1Z B;  4PPE A;  2K16 A;  4TKP B;  5C13 A;  4A4C A;  2I50 A;  2KGG A;  2ECT A;  1WEV A;  1WEM A;  3PUR A;  1FP0 A;  2Y1N A;  2L80 A;  2DX8 A;  4C9Z A;  1CHC A;  4UP0 A;  2YT5 A;  2E6S A;  2VP7 A;  3N9P A;  5B79 A;  1Z60 A;  2YHN A;  1ZBD B;  2FSA A;  2CT2 A;  5LCW B;  5TDW A;  3O70 A;  3EB6 A;  2CKL A;  1N87 A;  2LDR A;  1WIL A;  2KRE A;  2QIZ A;  2YQM A;  4A0C D;  2L0B A;  4F52 B;  2G43 A;  3U5P A;  1F62 A;  3M99 A;  5B78 A;  3MHS A;  2YSJ A;  5D1K B;  4LAD B;  2M3H A;  4R2Y A;  2ECG A;  2K1J A;  3VK6 A;  2K17 A;  2VPE A;  3GV4 A;  2KU3 A;  4LK9 A;  4N3W A;  4N4F A;  4V3L C;  2YUR A;  3SOW A;  5JG6 A;  4MSX A;  2VPG A;  4GB0 A;  5B8D A;  1X4I A;  4PTB A;  2AN6 A;  3HCT A;  2KWK A;  5TAB A;  1WEW A;  3SOU A;  4YBM A;  2PNX A;  4O64 A;  5B77 A;  2G6Q A;  3FL2 A;  4YAT A;  2MD7 B;  3O7A A;  3DQV R;  3O34 A;  3RPG C;  2VJF B;  1WEO A;  1T1H A;  3KQI A;  2YRE A;  4LLB A;  1X4J A;  1WES A;  2C2V S;  3KV5 A;  2KFT A;  3ZTG A;  5FER A;  2EA6 A;  2KE1 A;  5LKU A;  1WEU A;  3C5K A;  1RMD A;  4UP5 A;  1DVP A;  2G45 A;  2VPD A;  2D8S A;  3NG2 A;  2M85 A;  2MA6 A;  5TDR A;  2E6R A;  3U5O A;  2LV9 A;  1VD4 A;  3U5N A;  1G25 A;  5LKT A;  2MUM A;  4LJN A;  4FK5 A;  4WZ0 A;  1WEQ A;  2F42 A;  5KH7 A;  3V43 A;  4BHW A;  5AIT A;  2LGG A;  4WZ2 A;  1VYX A;  3LQJ A;  1V87 A;  4S3O C;  4GNG A;  2VJF A;  4YAB A;  4CCG X;  2FUI A;  2PUY A;  4FIP A;  5H1U A;  2MA5 A;  4X3G A;  3C6W A;  5D1M B;  4WA6 A;  2MNY A;  2FUU A;  4GNE A;  2LXP C;  4Q6F A;  4YBS A;  4GND A;  2LGK A;  2KWN A;  2CSY A;  3RPG B;  3O37 A;  1Z6U A;  5H1V A;  2EGP A;  1JM7 B;  3I2D A;  3PHD A;  1LDJ B;  2QJ0 A;  4L58 A;  1FBV A;  2MIQ A;  5FEY A;  3ZVZ B;  2RSD A;  3T7L A;  2QIC A;  2JMJ A;  2UZG A;  2ECW A;  3T6R A;  3MHH A;  1E4U A;  1Z2Q A;  4YC9 A;  3N9N A;  4LKA A;  1XWH A;  2H0D B;  2XB1 A;  3KNV A;  4YBT A;  2LQ6 A;  2MNZ A;  3ZPV 1;  3IHP A;  5DKA A;  3ZYQ A;  2KIZ A;  1X4U A;  4P5O B;  4FJC A;  3RTR B;  2LXH C;  4GNF A;  2ZET C;  3ZPV E;  3LRQ A;  4YAX A;  4ZQL A;  5FB1 A;  4S3O B;  2HDP A;  3PUQ A;  3O35 A;  3QZV A;  1WEE A;  1WEN A;  4R7E A;  4AUQ B;  2KR4 A;  1JM7 A;  4I7B A;  4I7D A;  2VPB A;  5B76 A;  5FB0 A;  4A4B A;  2RI7 A;  3ASL A;  3KV6 A;  3ZNI A;  2L5U A;  5TBN A;  5LKZ A;  3GL6 A;  2HYE D;  1LDK C;  4W4U A;  5J3X A;  2H0D A;  4QF3 A;  4I7C A;  2OXQ C;  5H9M A;  4ZDT A;  2M6M A;  4AP4 A;  1BOR A;  5DIN A;  5EYA F;  5C11 A;  1K2F A;  1WGM A;  2CSZ A;  3N9O A;  2ECJ A;  4AVX A;  3LQI A;  3M62 A;  2C2L A;  5AIU A;  2VJE A;  2YYR A;  3U5M A;  2JMI A;  2LRI C;  5KH3 A;  4AYC B;  4YAD A;  5G04 B;  5I3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...