3KQIA

Crystal structure of phf2 phd domain complexed with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GSMATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 2
publication title Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kqiA00
2ECGA 3T6RA 2LGKA 3O35A 2FUIA 5TBNA 2D8SA 1WEVA 2YT5A 3U5NA 2ECVA 1Z60A 4A4CA 1FBVA 5H1VA 2VPDA 2G6QA 3NG2A 4UP0A 2MIQA 1HYIA 3GL6A 1V87A 1X4JA 1JOCA 3O37A 2YU4A 2Y1NA 2JMDA 1WEMA 4XI1A 4FJCA 5FEYA 2PNXA 5B8DA 1CHCA 3RPGC 3ZPVE 3KV6A 2MA5A 4AVXA 4LADB 2CSYA 3ZVZB 3SHBA 3PUQA 3EB5A 3O33A 2OXQC 2C2LA 4I7DA 2YHOA 4I7BA 2KWJA 2KIZA 5C11A 2KWOA 3ZNIA 4IC2A 3HCUA 1BORA 2Y43A 2EGPA 2YQLA 3ASLA 2K4DA 1WESA 2VP7A 4CCGX 3SOXA 2ECTA 2EODA 1WILA 2ECWA 3QZVA 2YYRA 5DKAA 4YBTA 3ZPV1 3HCTA 1N87A 2EA6A 1ZBDB 2M85A 4GNEA 5H1TA 4YABA 1WGMA 3U5PA 1Z2QA 1LDJB 2H0DB 4WZ2A 1FP0A 1T1HA 2LRIC 2VJEB 2IDAA 1JM7B 3M62A 4IC3A 5B79A 4PPEA 1VFYA 2YREA 1WIMA 4YATA 5LKUA 5JG6A 2F42A 5B76A 4BHWA 4ZUXU 4A0CD 2K16A 2FSAA 5EYAF 2RI7A 3ZTGA 3L11A 2KGGA 2K1JA 2KREA 4TKPB 1WEPA 2VNFA 3KQIA 2MNZA 2ZETC 1WEEA 2QICA 1WFKA 3KV5A 1U6GB 2LN0A 2KR4A 2LV9A 2BAYA 1XWHA 3SOUA 3N9MA 4WZ0A 3HTKC 1VYXA 4UP5A 1VD4A 3PHDA 1F62A 2L80A 2L43A 2JMIA 2FUUA 3GV4A 2ECIA 4ZDTA 4L7XA 3C5KA 3O70A 4L58A 3N9OA 4YAXA 5KH7A 3I2DA 2JMJA 5FB0A 4GB0A 2QJ0A 1WE9A 2L75A 2PUYA 3HCSA 2KE1A 4MVTA 4YC9A 3LQJA 2CKLB 1WEUA 4YADA 2E6RA 3U5OA 2F6NA 2L5UA 2H0DA 4N3WA 2VJEA 2VPGA 1JM7A 1WEQA 2G45A 2UZGA 3N9LA 4R8PK 4N4FA 4AP4A 4WZ3B 4AUQB 3ZVYA 3O7AA 4GNGA 2YSMA 4BBQA 4LKAA 5LCWB 4A49A 4GNFA 5J3XA 5TRBA 2JRJA 5KH3A 3C6WA 5FERA 2M1RA 4QF3A 3RPGB 2KWNA 1X4IA 4YBSA 2YQMA 4P5OB 2VJFB 4YBMA 5LKZA 4UI9B 3MHHA 1LDKC 2AN6A 5C13A 5I3LA 2NAAA 5H1UA 2KFTA 5G0FA 1K2FA 1E4UA 2LXPC 1WEWA 4LLBA 3RTRB 3DQVR 4X3GA 4PTBA 1DVPA 3LQIA 2LXHC 3N9QA 1X4UA 5KH9A 3L1ZB 2DX8A 3V43A 5H9MA 4I7CA 1IYMA 2YHNA 2ECJA 5LKTA 5B75A 2RSDA 3EB6A 2LDRA 5TABA 3M99A 2CKLA 3MHSA 3M63A 3FL2A 1RMDA 2YUCA 3IHPA 4V3LC 4NN2A 4FO9A 5AITA 3N9NA 2HYED 1HYJA 2XEUA 4S3OB 4AYCA 5D1KB 4W4UA 2M6MA 4O64A 4WA6A 4ZQLA 2F6JA 2MUMA 3VK6A 4F52B 2YURA 3T7LA 4MSXA 2KGIA 3LRQA 2VJFA 1WENA 5G05B 2C2VS 2I50A 2MT5A 2MD7B 3SOWA 5AIUA 3L1XA 2XB1A 2KYUA 2G43A 2LQ6A 4V3KC 2QIZA 2HDPA 4R7EA 4A4BA 4FIPA 4AYCB 4FK5A 2CT2A 5FB1A 4B86C 2LGGA 3U5MA 2YW8A 3DPLR 4LK9A 5D1MB 5TDRA 1MM3A 2VPBA 2MD8C 3ZYQA 2M3HA 1Z6UA 1G25A 2CSZA 3KNVA 4C9ZA 2ECNA 3O34A 2VPEA 1MM2A 4QF2A 2K17A 5DINA 3N9PA 2LGLA 4R2YA 4Q6FA 2Y1MA 2LGVA 5D1LB 2MA6A 2KU3A 2L0BA 5G04B 4B7YC 1WEOA 2E6SA 2MNYA 5TDWA 3LQHA 5B78A 4CA1A 3O36A 3PURA 2YSJA 4LJNA 4S3OC 5LKXA 4GNDA 5B77A 2KWKA
chains in the Genus database with same CATH superfamily
2ECGA 3T6RA 2LGKA 3O35A 2FUIA 5TBNA 2D8SA 1WEVA 2YT5A 3U5NA 2ECVA 1Z60A 4A4CA 1FBVA 2XOCA 5H1VA 2VPDA 2G6QA 3NG2A 4UP0A 2MIQA 1HYIA 3SUBA 3GL6A 2EXUA 1V87A 1X4JA 1JOCA 3O37A 2YU4A 2Y1NA 2JMDA 1WEMA 4XI1A 4FJCA 5FEYA 2PNXA 5B8DA 1CHCA 4OGCA 3RPGC 3ZPVE 3KV6A 2MA5A 2CRRA 4AVXA 4LADB 2CSYA 3MDBC 2E61A 3FANA 3E2DA 3O47A 3ZVZB 3SHBA 3PUQA 3EB5A 3O33A 2OXQC 2C2LA 4I7DA 2YHOA 4I7BA 2KWJA 2KIZA 5C11A 2KWOA 3ZNIA 4IC2A 3HCUA 2JUNA 1BORA 2Y43A 2EGPA 2YQLA 4F1PA 3ASLA 2K4DA 1WESA 2VP7A 4CCGX 3SOXA 2ECTA 2EODA 1WILA 2ECWA 3QZVA 2YYRA 5DKAA 4YBTA 3ZPV1 3HCTA 2M13A 1N87A 2EA6A 1ZBDB 2M85A 4GNEA 5H1TA 4YABA 1WGMA 3U5PA 1Z2QA 1LDJB 1MBMA 2H0DB 4WZ2A 1FP0A 1T1HA 2LRIC 2VJEB 2IDAA 1JM7B 3M62A 4IC3A 5B79A 4PPEA 2RR4A 2IQJA 1VFYA 2CONA 2YREA 2MKEA 1WIMA 4YATA 1DCQA 5LKUA 5JG6A 2CSVA 2F42A 5SVYA 5B76A 4BHWA 5SVIB 4ZUXU 4A0CD 2K16A 2FSAA 5EYAF 2RI7A 3ZTGA 3L11A 2KGGA 2K1JA 2P57A 2KREA 4TKPB 1WEPA 2VNFA 3KQIA 2MNZA 2ZETC 1WEEA 2QICA 1WFKA 3KV5A 1U6GB 2LN0A 2KR4A 2LV9A 2BAYA 1XWHA 3SOUA 3N9MA 4WZ0A 3HTKC 1VYXA 4UP5A 1VD4A 3PHDA 1F62A 2JM3A 3T9KA 2L80A 2L43A 2JMIA 2FUUA 3GV4A 3Q1DA 3LVRE 2ECIA 4ZDTA 3KDEC 4L7XA 3C5KA 3O70A 4L58A 3N9OA 4YAXA 5KH7A 3I2DA 2JMJA 5FB0A 4GB0A 2OWAA 2QJ0A 1WE9A 3H7HA 2L75A 3DWDA 2PUYA 4H9DA 3HCSA 2CRWA 4Z0OA 2KE1A 4MVTA 4YC9A 3LQJA 3FAOA 2CKLB 1WEUA 4YADA 2E6RA 3U5OA 2F6NA 2L5UA 2H0DA 4N3WA 2VJEA 2VPGA 1JM7A 1WEQA 2G45A 2UZGA 3N9LA 4R8PK 4N4FA 4AP4A 2EGMA 4WZ3B 4AUQB 3ZVYA 2DJAA 2FFWA 3O7AA 4GNGA 2YSMA 4BBQA 4LKAA 5LCWB 5SVIA 4A49A 4GNFA 5J3XA 5TRBA 2FD4A 2JRJA 5KH3A 3C6WA 5FERA 2M1RA 4QF3A 2DSMA 3RPGB 2KWNA 1X4IA 4YBSA 4O62A 3JUEA 2YQMA 4P5OB 2VJFB 4YBMA 5LKZA 4UI9B 2KKYA 3MHHA 1LDKC 2AN6A 5C13A 5I3LA 2NAAA 5H1UA 5K3QA 2KFTA 5G0FA 3DDTA 1K2FA 3LJUX 1E4UA 2LXPC 1WEWA 4LLBA 2LAUA 3RTRB 3DQVR 4X3GA 4PTBA 1DVPA 3LQIA 2LXHC 3N9QA 1X4UA 5KH9A 3L1ZB 2DX8A 3V43A 5H9MA 2YVRA 4I7CA 1IYMA 2XOYA 2YHNA 2ECJA 5LKTA 5B75A 2RSDA 3EB6A 2LDRA 5TABA 3M99A 2CKLA 3MHSA 3M63A 3FL2A 2B0OE 3M7KA 1RMDA 2YUCA 3IHPA 4V3LC 4NN2A 4FO9A 3FJUB 5AITA 3N9NA 2L7PA 2HYED 1HYJA 2XEUA 4S3OB 5SVXA 4AYCA 5D1KB 4W4UA 2M6MA 4O64A 4WA6A 4ZQLA 2F6JA 2MUMA 3VK6A 4F52B 2YURA 3T7LA 4MSXA 2KGIA 3LRQA 2VJFA 1WENA 5G05B 2C2VS 2I50A 2MT5A 2MD7B 2XP0A 3SOWA 5AIUA 3L1XA 2XB1A 2D8UA 2KYUA 2G43A 2LQ6A 4V3KC 2QIZA 2HDPA 4R7EA 4A4BA 4FIPA 4AYCB 3FM8C 4FK5A 2CT2A 5FB1A 4B86C 2LGGA 3U5MA 3FEHA 4QQ4A 2YW8A 3DPLR 4LK9A 5D1MB 5TDRA 2KKXA 1MM3A 2VPBA 2MD8C 3LDYA 3ZYQA 2M3HA 1Z6UA 1G25A 2CSZA 3KNVA 4C9ZA 2ECNA 3O34A 2VPEA 1MM2A 3PLWA 4QF2A 2K17A 5DINA 3N9PA 4Z0RA 2LGLA 4R2YA 4Q6FA 3LVQE 2Y1MA 2LGVA 5D1LB 2MA6A 2KU3A 2L0BA 5G04B 4B7YC 1WEOA 2E6SA 2MNYA 5TDWA 3LQHA 5B78A 4CA1A 3O36A 3PURA 2XOZA 2YSJA 4LJNA 4S3OC 5LKXA 4GNDA 4OGEA 5B77A 2KWKA
chains in the Genus database with same CATH topology
2ECGA 3T6RA 2LGKA 3O35A 2FUIA 5TBNA 2D8SA 1WEVA 2YT5A 3U5NA 2ECVA 1Z60A 4A4CA 1FBVA 5H1VA 2VPDA 2G6QA 3NG2A 4UP0A 2MIQA 1HYIA 3GL6A 1V87A 1X4JA 1JOCA 3O37A 2YU4A 2Y1NA 2JMDA 1WEMA 4XI1A 4FJCA 5FEYA 2PNXA 5B8DA 1CHCA 3RPGC 3ZPVE 3KV6A 2MA5A 4AVXA 4LADB 2CSYA 3ZVZB 3SHBA 3PUQA 3EB5A 3O33A 2OXQC 2C2LA 4I7DA 2YHOA 4I7BA 2KWJA 2KIZA 5C11A 2KWOA 3ZNIA 4IC2A 3HCUA 1BORA 2Y43A 2EGPA 2YQLA 3ASLA 2K4DA 1WESA 2VP7A 4CCGX 3SOXA 2ECTA 2EODA 1WILA 2ECWA 3QZVA 2YYRA 5DKAA 4YBTA 3ZPV1 3HCTA 1N87A 2EA6A 1ZBDB 2M85A 4GNEA 5H1TA 4YABA 1WGMA 3U5PA 1Z2QA 1LDJB 2H0DB 4WZ2A 1FP0A 1T1HA 2LRIC 2VJEB 2IDAA 1JM7B 3M62A 4IC3A 5B79A 4PPEA 1VFYA 2YREA 1WIMA 4YATA 5LKUA 5JG6A 2F42A 5B76A 4BHWA 4ZUXU 4A0CD 2K16A 2FSAA 5EYAF 2RI7A 3ZTGA 3L11A 2KGGA 2K1JA 2KREA 4TKPB 1WEPA 2VNFA 3KQIA 2MNZA 2ZETC 1WEEA 2QICA 1WFKA 3KV5A 1U6GB 2LN0A 2KR4A 2LV9A 2BAYA 1XWHA 3SOUA 3N9MA 4WZ0A 3HTKC 1VYXA 4UP5A 1VD4A 3PHDA 1F62A 2L80A 2L43A 2JMIA 2FUUA 3GV4A 2ECIA 4ZDTA 4L7XA 3C5KA 3O70A 4L58A 3N9OA 4YAXA 5KH7A 3I2DA 2JMJA 5FB0A 4GB0A 2QJ0A 1WE9A 2L75A 2PUYA 3HCSA 2KE1A 4MVTA 4YC9A 3LQJA 2CKLB 1WEUA 4YADA 2E6RA 3U5OA 2F6NA 2L5UA 2H0DA 4N3WA 2VJEA 2VPGA 1JM7A 1WEQA 2G45A 2UZGA 3N9LA 4R8PK 4N4FA 4AP4A 4WZ3B 4AUQB 3ZVYA 3O7AA 4GNGA 2YSMA 4BBQA 4LKAA 5LCWB 4A49A 4GNFA 5J3XA 5TRBA 2JRJA 5KH3A 3C6WA 5FERA 2M1RA 4QF3A 3RPGB 2KWNA 1X4IA 4YBSA 2YQMA 4P5OB 2VJFB 4YBMA 5LKZA 4UI9B 3MHHA 1LDKC 2AN6A 5C13A 5I3LA 2NAAA 5H1UA 2KFTA 5G0FA 1K2FA 1E4UA 2LXPC 1WEWA 4LLBA 3RTRB 3DQVR 4X3GA 4PTBA 1DVPA 3LQIA 2LXHC 3N9QA 1X4UA 5KH9A 3L1ZB 2DX8A 3V43A 5H9MA 4I7CA 1IYMA 2YHNA 2ECJA 5LKTA 5B75A 2RSDA 3EB6A 2LDRA 5TABA 3M99A 2CKLA 3MHSA 3M63A 3FL2A 1RMDA 2YUCA 3IHPA 4V3LC 4NN2A 4FO9A 5AITA 3N9NA 2HYED 1HYJA 2XEUA 4S3OB 4AYCA 5D1KB 4W4UA 2M6MA 4O64A 4WA6A 4ZQLA 2F6JA 2MUMA 3VK6A 4F52B 2YURA 3T7LA 4MSXA 2KGIA 3LRQA 2VJFA 1WENA 5G05B 2C2VS 2I50A 2MT5A 2MD7B 3SOWA 5AIUA 3L1XA 2XB1A 2KYUA 2G43A 2LQ6A 4V3KC 2QIZA 2HDPA 4R7EA 4A4BA 4FIPA 4AYCB 4FK5A 2CT2A 5FB1A 4B86C 2LGGA 3U5MA 2YW8A 3DPLR 4LK9A 5D1MB 5TDRA 1MM3A 2VPBA 2MD8C 3ZYQA 2M3HA 1Z6UA 1G25A 2CSZA 3KNVA 4C9ZA 2ECNA 3O34A 2VPEA 1MM2A 4QF2A 2K17A 5DINA 3N9PA 2LGLA 4R2YA 4Q6FA 2Y1MA 2LGVA 5D1LB 2MA6A 2KU3A 2L0BA 5G04B 4B7YC 1WEOA 2E6SA 2MNYA 5TDWA 3LQHA 5B78A 4CA1A 3O36A 3PURA 2YSJA 4LJNA 4S3OC 5LKXA 4GNDA 5B77A 2KWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECG A;  3T6R A;  2LGK A;  3O35 A;  2FUI A;  5TBN A;  2D8S A;  1WEV A;  2YT5 A;  3U5N A;  2ECV A;  1Z60 A;  4A4C A;  1FBV A;  5H1V A;  2VPD A;  2G6Q A;  3NG2 A;  4UP0 A;  2MIQ A;  1HYI A;  3GL6 A;  1V87 A;  1X4J A;  1JOC A;  3O37 A;  2YU4 A;  2Y1N A;  2JMD A;  1WEM A;  4XI1 A;  4FJC A;  5FEY A;  2PNX A;  5B8D A;  1CHC A;  3RPG C;  3ZPV E;  3KV6 A;  2MA5 A;  4AVX A;  4LAD B;  2CSY A;  3ZVZ B;  3SHB A;  3PUQ A;  3EB5 A;  3O33 A;  2OXQ C;  2C2L A;  4I7D A;  2YHO A;  4I7B A;  2KWJ A;  2KIZ A;  5C11 A;  2KWO A;  3ZNI A;  4IC2 A;  3HCU A;  1BOR A;  2Y43 A;  2EGP A;  2YQL A;  3ASL A;  2K4D A;  1WES A;  2VP7 A;  4CCG X;  3SOX A;  2ECT A;  2EOD A;  1WIL A;  2ECW A;  3QZV A;  2YYR A;  5DKA A;  4YBT A;  3ZPV 1;  3HCT A;  1N87 A;  2EA6 A;  1ZBD B;  2M85 A;  4GNE A;  5H1T A;  4YAB A;  1WGM A;  3U5P A;  1Z2Q A;  1LDJ B;  2H0D B;  4WZ2 A;  1FP0 A;  1T1H A;  2LRI C;  2VJE B;  2IDA A;  1JM7 B;  3M62 A;  4IC3 A;  5B79 A;  4PPE A;  1VFY A;  2YRE A;  1WIM A;  4YAT A;  5LKU A;  5JG6 A;  2F42 A;  5B76 A;  4BHW A;  4ZUX U;  4A0C D;  2K16 A;  2FSA A;  5EYA F;  2RI7 A;  3ZTG A;  3L11 A;  2KGG A;  2K1J A;  2KRE A;  4TKP B;  1WEP A;  2VNF A;  3KQI A;  2MNZ A;  2ZET C;  1WEE A;  2QIC A;  1WFK A;  3KV5 A;  1U6G B;  2LN0 A;  2KR4 A;  2LV9 A;  2BAY A;  1XWH A;  3SOU A;  3N9M A;  4WZ0 A;  3HTK C;  1VYX A;  4UP5 A;  1VD4 A;  3PHD A;  1F62 A;  2L80 A;  2L43 A;  2JMI A;  2FUU A;  3GV4 A;  2ECI A;  4ZDT A;  4L7X A;  3C5K A;  3O70 A;  4L58 A;  3N9O A;  4YAX A;  5KH7 A;  3I2D A;  2JMJ A;  5FB0 A;  4GB0 A;  2QJ0 A;  1WE9 A;  2L75 A;  2PUY A;  3HCS A;  2KE1 A;  4MVT A;  4YC9 A;  3LQJ A;  2CKL B;  1WEU A;  4YAD A;  2E6R A;  3U5O A;  2F6N A;  2L5U A;  2H0D A;  4N3W A;  2VJE A;  2VPG A;  1JM7 A;  1WEQ A;  2G45 A;  2UZG A;  3N9L A;  4R8P K;  4N4F A;  4AP4 A;  4WZ3 B;  4AUQ B;  3ZVY A;  3O7A A;  4GNG A;  2YSM A;  4BBQ A;  4LKA A;  5LCW B;  4A49 A;  4GNF A;  5J3X A;  5TRB A;  2JRJ A;  5KH3 A;  3C6W A;  5FER A;  2M1R A;  4QF3 A;  3RPG B;  2KWN A;  1X4I A;  4YBS A;  2YQM A;  4P5O B;  2VJF B;  4YBM A;  5LKZ A;  4UI9 B;  3MHH A;  1LDK C;  2AN6 A;  5C13 A;  5I3L A;  2NAA A;  5H1U A;  2KFT A;  5G0F A;  1K2F A;  1E4U A;  2LXP C;  1WEW A;  4LLB A;  3RTR B;  3DQV R;  4X3G A;  4PTB A;  1DVP A;  3LQI A;  2LXH C;  3N9Q A;  1X4U A;  5KH9 A;  3L1Z B;  2DX8 A;  3V43 A;  5H9M A;  4I7C A;  1IYM A;  2YHN A;  2ECJ A;  5LKT A;  5B75 A;  2RSD A;  3EB6 A;  2LDR A;  5TAB A;  3M99 A;  2CKL A;  3MHS A;  3M63 A;  3FL2 A;  1RMD A;  2YUC A;  3IHP A;  4V3L C;  4NN2 A;  4FO9 A;  5AIT A;  3N9N A;  2HYE D;  1HYJ A;  2XEU A;  4S3O B;  4AYC A;  5D1K B;  4W4U A;  2M6M A;  4O64 A;  4WA6 A;  4ZQL A;  2F6J A;  2MUM A;  3VK6 A;  4F52 B;  2YUR A;  3T7L A;  4MSX A;  2KGI A;  3LRQ A;  2VJF A;  1WEN A;  5G05 B;  2C2V S;  2I50 A;  2MT5 A;  2MD7 B;  3SOW A;  5AIU A;  3L1X A;  2XB1 A;  2KYU A;  2G43 A;  2LQ6 A;  4V3K C;  2QIZ A;  2HDP A;  4R7E A;  4A4B A;  4FIP A;  4AYC B;  4FK5 A;  2CT2 A;  5FB1 A;  4B86 C;  2LGG A;  3U5M A;  2YW8 A;  3DPL R;  4LK9 A;  5D1M B;  5TDR A;  1MM3 A;  2VPB A;  2MD8 C;  3ZYQ A;  2M3H A;  1Z6U A;  1G25 A;  2CSZ A;  3KNV A;  4C9Z A;  2ECN A;  3O34 A;  2VPE A;  1MM2 A;  4QF2 A;  2K17 A;  5DIN A;  3N9P A;  2LGL A;  4R2Y A;  4Q6F A;  2Y1M A;  2LGV A;  5D1L B;  2MA6 A;  2KU3 A;  2L0B A;  5G04 B;  4B7Y C;  1WEO A;  2E6S A;  2MNY A;  5TDW A;  3LQH A;  5B78 A;  4CA1 A;  3O36 A;  3PUR A;  2YSJ A;  4LJN A;  4S3O C;  5LKX A;  4GND A;  5B77 A;  2KWK A; 
#chains in the Genus database with same CATH topology
 2ECG A;  3T6R A;  2LGK A;  3O35 A;  2FUI A;  5TBN A;  2D8S A;  1WEV A;  2YT5 A;  3U5N A;  2ECV A;  1Z60 A;  4A4C A;  1FBV A;  2XOC A;  5H1V A;  2VPD A;  2G6Q A;  3NG2 A;  4UP0 A;  2MIQ A;  1HYI A;  3SUB A;  3GL6 A;  2EXU A;  1V87 A;  1X4J A;  1JOC A;  3O37 A;  2YU4 A;  2Y1N A;  2JMD A;  1WEM A;  4XI1 A;  4FJC A;  5FEY A;  2PNX A;  5B8D A;  1CHC A;  4OGC A;  3RPG C;  3ZPV E;  3KV6 A;  2MA5 A;  2CRR A;  4AVX A;  4LAD B;  2CSY A;  3MDB C;  2E61 A;  3FAN A;  3E2D A;  3O47 A;  3ZVZ B;  3SHB A;  3PUQ A;  3EB5 A;  3O33 A;  2OXQ C;  2C2L A;  4I7D A;  2YHO A;  4I7B A;  2KWJ A;  2KIZ A;  5C11 A;  2KWO A;  3ZNI A;  4IC2 A;  3HCU A;  2JUN A;  1BOR A;  2Y43 A;  2EGP A;  2YQL A;  4F1P A;  3ASL A;  2K4D A;  1WES A;  2VP7 A;  4CCG X;  3SOX A;  2ECT A;  2EOD A;  1WIL A;  2ECW A;  3QZV A;  2YYR A;  5DKA A;  4YBT A;  3ZPV 1;  3HCT A;  2M13 A;  1N87 A;  2EA6 A;  1ZBD B;  2M85 A;  4GNE A;  5H1T A;  4YAB A;  1WGM A;  3U5P A;  1Z2Q A;  1LDJ B;  1MBM A;  2H0D B;  4WZ2 A;  1FP0 A;  1T1H A;  2LRI C;  2VJE B;  2IDA A;  1JM7 B;  3M62 A;  4IC3 A;  5B79 A;  4PPE A;  2RR4 A;  2IQJ A;  1VFY A;  2CON A;  2YRE A;  2MKE A;  1WIM A;  4YAT A;  1DCQ A;  5LKU A;  5JG6 A;  2CSV A;  2F42 A;  5SVY A;  5B76 A;  4BHW A;  5SVI B;  4ZUX U;  4A0C D;  2K16 A;  2FSA A;  5EYA F;  2RI7 A;  3ZTG A;  3L11 A;  2KGG A;  2K1J A;  2P57 A;  2KRE A;  4TKP B;  1WEP A;  2VNF A;  3KQI A;  2MNZ A;  2ZET C;  1WEE A;  2QIC A;  1WFK A;  3KV5 A;  1U6G B;  2LN0 A;  2KR4 A;  2LV9 A;  2BAY A;  1XWH A;  3SOU A;  3N9M A;  4WZ0 A;  3HTK C;  1VYX A;  4UP5 A;  1VD4 A;  3PHD A;  1F62 A;  2JM3 A;  3T9K A;  2L80 A;  2L43 A;  2JMI A;  2FUU A;  3GV4 A;  3Q1D A;  3LVR E;  2ECI A;  4ZDT A;  3KDE C;  4L7X A;  3C5K A;  3O70 A;  4L58 A;  3N9O A;  4YAX A;  5KH7 A;  3I2D A;  2JMJ A;  5FB0 A;  4GB0 A;  2OWA A;  2QJ0 A;  1WE9 A;  3H7H A;  2L75 A;  3DWD A;  2PUY A;  4H9D A;  3HCS A;  2CRW A;  4Z0O A;  2KE1 A;  4MVT A;  4YC9 A;  3LQJ A;  3FAO A;  2CKL B;  1WEU A;  4YAD A;  2E6R A;  3U5O A;  2F6N A;  2L5U A;  2H0D A;  4N3W A;  2VJE A;  2VPG A;  1JM7 A;  1WEQ A;  2G45 A;  2UZG A;  3N9L A;  4R8P K;  4N4F A;  4AP4 A;  2EGM A;  4WZ3 B;  4AUQ B;  3ZVY A;  2DJA A;  2FFW A;  3O7A A;  4GNG A;  2YSM A;  4BBQ A;  4LKA A;  5LCW B;  5SVI A;  4A49 A;  4GNF A;  5J3X A;  5TRB A;  2FD4 A;  2JRJ A;  5KH3 A;  3C6W A;  5FER A;  2M1R A;  4QF3 A;  2DSM A;  3RPG B;  2KWN A;  1X4I A;  4YBS A;  4O62 A;  3JUE A;  2YQM A;  4P5O B;  2VJF B;  4YBM A;  5LKZ A;  4UI9 B;  2KKY A;  3MHH A;  1LDK C;  2AN6 A;  5C13 A;  5I3L A;  2NAA A;  5H1U A;  5K3Q A;  2KFT A;  5G0F A;  3DDT A;  1K2F A;  3LJU X;  1E4U A;  2LXP C;  1WEW A;  4LLB A;  2LAU A;  3RTR B;  3DQV R;  4X3G A;  4PTB A;  1DVP A;  3LQI A;  2LXH C;  3N9Q A;  1X4U A;  5KH9 A;  3L1Z B;  2DX8 A;  3V43 A;  5H9M A;  2YVR A;  4I7C A;  1IYM A;  2XOY A;  2YHN A;  2ECJ A;  5LKT A;  5B75 A;  2RSD A;  3EB6 A;  2LDR A;  5TAB A;  3M99 A;  2CKL A;  3MHS A;  3M63 A;  3FL2 A;  2B0O E;  3M7K A;  1RMD A;  2YUC A;  3IHP A;  4V3L C;  4NN2 A;  4FO9 A;  3FJU B;  5AIT A;  3N9N A;  2L7P A;  2HYE D;  1HYJ A;  2XEU A;  4S3O B;  5SVX A;  4AYC A;  5D1K B;  4W4U A;  2M6M A;  4O64 A;  4WA6 A;  4ZQL A;  2F6J A;  2MUM A;  3VK6 A;  4F52 B;  2YUR A;  3T7L A;  4MSX A;  2KGI A;  3LRQ A;  2VJF A;  1WEN A;  5G05 B;  2C2V S;  2I50 A;  2MT5 A;  2MD7 B;  2XP0 A;  3SOW A;  5AIU A;  3L1X A;  2XB1 A;  2D8U A;  2KYU A;  2G43 A;  2LQ6 A;  4V3K C;  2QIZ A;  2HDP A;  4R7E A;  4A4B A;  4FIP A;  4AYC B;  3FM8 C;  4FK5 A;  2CT2 A;  5FB1 A;  4B86 C;  2LGG A;  3U5M A;  3FEH A;  4QQ4 A;  2YW8 A;  3DPL R;  4LK9 A;  5D1M B;  5TDR A;  2KKX A;  1MM3 A;  2VPB A;  2MD8 C;  3LDY A;  3ZYQ A;  2M3H A;  1Z6U A;  1G25 A;  2CSZ A;  3KNV A;  4C9Z A;  2ECN A;  3O34 A;  2VPE A;  1MM2 A;  3PLW A;  4QF2 A;  2K17 A;  5DIN A;  3N9P A;  4Z0R A;  2LGL A;  4R2Y A;  4Q6F A;  3LVQ E;  2Y1M A;  2LGV A;  5D1L B;  2MA6 A;  2KU3 A;  2L0B A;  5G04 B;  4B7Y C;  1WEO A;  2E6S A;  2MNY A;  5TDW A;  3LQH A;  5B78 A;  4CA1 A;  3O36 A;  3PUR A;  2XOZ A;  2YSJ A;  4LJN A;  4S3O C;  5LKX A;  4GND A;  4OGE A;  5B77 A;  2KWK A; 
#chains in the Genus database with same CATH homology
 2ECG A;  3T6R A;  2LGK A;  3O35 A;  2FUI A;  5TBN A;  2D8S A;  1WEV A;  2YT5 A;  3U5N A;  2ECV A;  1Z60 A;  4A4C A;  1FBV A;  5H1V A;  2VPD A;  2G6Q A;  3NG2 A;  4UP0 A;  2MIQ A;  1HYI A;  3GL6 A;  1V87 A;  1X4J A;  1JOC A;  3O37 A;  2YU4 A;  2Y1N A;  2JMD A;  1WEM A;  4XI1 A;  4FJC A;  5FEY A;  2PNX A;  5B8D A;  1CHC A;  3RPG C;  3ZPV E;  3KV6 A;  2MA5 A;  4AVX A;  4LAD B;  2CSY A;  3ZVZ B;  3SHB A;  3PUQ A;  3EB5 A;  3O33 A;  2OXQ C;  2C2L A;  4I7D A;  2YHO A;  4I7B A;  2KWJ A;  2KIZ A;  5C11 A;  2KWO A;  3ZNI A;  4IC2 A;  3HCU A;  1BOR A;  2Y43 A;  2EGP A;  2YQL A;  3ASL A;  2K4D A;  1WES A;  2VP7 A;  4CCG X;  3SOX A;  2ECT A;  2EOD A;  1WIL A;  2ECW A;  3QZV A;  2YYR A;  5DKA A;  4YBT A;  3ZPV 1;  3HCT A;  1N87 A;  2EA6 A;  1ZBD B;  2M85 A;  4GNE A;  5H1T A;  4YAB A;  1WGM A;  3U5P A;  1Z2Q A;  1LDJ B;  2H0D B;  4WZ2 A;  1FP0 A;  1T1H A;  2LRI C;  2VJE B;  2IDA A;  1JM7 B;  3M62 A;  4IC3 A;  5B79 A;  4PPE A;  1VFY A;  2YRE A;  1WIM A;  4YAT A;  5LKU A;  5JG6 A;  2F42 A;  5B76 A;  4BHW A;  4ZUX U;  4A0C D;  2K16 A;  2FSA A;  5EYA F;  2RI7 A;  3ZTG A;  3L11 A;  2KGG A;  2K1J A;  2KRE A;  4TKP B;  1WEP A;  2VNF A;  3KQI A;  2MNZ A;  2ZET C;  1WEE A;  2QIC A;  1WFK A;  3KV5 A;  1U6G B;  2LN0 A;  2KR4 A;  2LV9 A;  2BAY A;  1XWH A;  3SOU A;  3N9M A;  4WZ0 A;  3HTK C;  1VYX A;  4UP5 A;  1VD4 A;  3PHD A;  1F62 A;  2L80 A;  2L43 A;  2JMI A;  2FUU A;  3GV4 A;  2ECI A;  4ZDT A;  4L7X A;  3C5K A;  3O70 A;  4L58 A;  3N9O A;  4YAX A;  5KH7 A;  3I2D A;  2JMJ A;  5FB0 A;  4GB0 A;  2QJ0 A;  1WE9 A;  2L75 A;  2PUY A;  3HCS A;  2KE1 A;  4MVT A;  4YC9 A;  3LQJ A;  2CKL B;  1WEU A;  4YAD A;  2E6R A;  3U5O A;  2F6N A;  2L5U A;  2H0D A;  4N3W A;  2VJE A;  2VPG A;  1JM7 A;  1WEQ A;  2G45 A;  2UZG A;  3N9L A;  4R8P K;  4N4F A;  4AP4 A;  4WZ3 B;  4AUQ B;  3ZVY A;  3O7A A;  4GNG A;  2YSM A;  4BBQ A;  4LKA A;  5LCW B;  4A49 A;  4GNF A;  5J3X A;  5TRB A;  2JRJ A;  5KH3 A;  3C6W A;  5FER A;  2M1R A;  4QF3 A;  3RPG B;  2KWN A;  1X4I A;  4YBS A;  2YQM A;  4P5O B;  2VJF B;  4YBM A;  5LKZ A;  4UI9 B;  3MHH A;  1LDK C;  2AN6 A;  5C13 A;  5I3L A;  2NAA A;  5H1U A;  2KFT A;  5G0F A;  1K2F A;  1E4U A;  2LXP C;  1WEW A;  4LLB A;  3RTR B;  3DQV R;  4X3G A;  4PTB A;  1DVP A;  3LQI A;  2LXH C;  3N9Q A;  1X4U A;  5KH9 A;  3L1Z B;  2DX8 A;  3V43 A;  5H9M A;  4I7C A;  1IYM A;  2YHN A;  2ECJ A;  5LKT A;  5B75 A;  2RSD A;  3EB6 A;  2LDR A;  5TAB A;  3M99 A;  2CKL A;  3MHS A;  3M63 A;  3FL2 A;  1RMD A;  2YUC A;  3IHP A;  4V3L C;  4NN2 A;  4FO9 A;  5AIT A;  3N9N A;  2HYE D;  1HYJ A;  2XEU A;  4S3O B;  4AYC A;  5D1K B;  4W4U A;  2M6M A;  4O64 A;  4WA6 A;  4ZQL A;  2F6J A;  2MUM A;  3VK6 A;  4F52 B;  2YUR A;  3T7L A;  4MSX A;  2KGI A;  3LRQ A;  2VJF A;  1WEN A;  5G05 B;  2C2V S;  2I50 A;  2MT5 A;  2MD7 B;  3SOW A;  5AIU A;  3L1X A;  2XB1 A;  2KYU A;  2G43 A;  2LQ6 A;  4V3K C;  2QIZ A;  2HDP A;  4R7E A;  4A4B A;  4FIP A;  4AYC B;  4FK5 A;  2CT2 A;  5FB1 A;  4B86 C;  2LGG A;  3U5M A;  2YW8 A;  3DPL R;  4LK9 A;  5D1M B;  5TDR A;  1MM3 A;  2VPB A;  2MD8 C;  3ZYQ A;  2M3H A;  1Z6U A;  1G25 A;  2CSZ A;  3KNV A;  4C9Z A;  2ECN A;  3O34 A;  2VPE A;  1MM2 A;  4QF2 A;  2K17 A;  5DIN A;  3N9P A;  2LGL A;  4R2Y A;  4Q6F A;  2Y1M A;  2LGV A;  5D1L B;  2MA6 A;  2KU3 A;  2L0B A;  5G04 B;  4B7Y C;  1WEO A;  2E6S A;  2MNY A;  5TDW A;  3LQH A;  5B78 A;  4CA1 A;  3O36 A;  3PUR A;  2YSJ A;  4LJN A;  4S3O C;  5LKX A;  4GND A;  5B77 A;  2KWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...