3KQIA

Crystal structure of phf2 phd domain complexed with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GSMATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords PHD finger protein 2
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kqiA00
2YSJA 1WEEA 5AIUA 2HYED 3RPGB 2MT5A 2E6SA 4YABA 2K1JA 1K2FA 4PPEA 5B77A 4YATA 4YBMA 4R8PK 2MA6A 4WZ3B 2JMIA 1X4IA 4WZ0A 3ZYQA 5J3XA 2ZETC 3N9LA 3ZNIA 4B86C 5FEYA 1VD4A 3O35A 2CSYA 4BBQA 4GNGA 2YQLA 3HCUA 4UP0A 3VK6A 1MM3A 5I3LA 5C13A 1LDKC 1DVPA 2VJEB 4AP4A 4A4BA 4Q6FA 5LKUA 2L80A 3M99A 1IYMA 2ECGA 2ECNA 3L1XA 4A49A 3HCSA 5B79A 4YAXA 2EODA 3LRQA 2VJEA 3HCTA 5D1LB 2LQ6A 4YBSA 3KV6A 5H1UA 5LKTA 1FP0A 2K4DA 3N9MA 2L5UA 4I7BA 3HTKC 3O37A 5AITA 2PUYA 3FL2A 3C6WA 2F6NA 5G04B 5B8DA 2LGKA 2KE1A 4V3KC 2ECTA 2YU4A 4YBTA 4TKPB 3U5MA 1V87A 2LDRA 4MSXA 1WEUA 1LDJB 4AYCA 2VPEA 2RSDA 3IHPA 2KREA 2M1RA 1ZBDB 4CCGX 3O70A 4FIPA 2MNYA 2JRJA 2DX8A 3KV5A 3KQIA 4NN2A 2L75A 2LGVA 2MNZA 4GNDA 5LKZA 4GNEA 2EGPA 2NAAA 4AYCB 2KWJA 5TABA 2CSZA 1WFKA 1HYIA 4P5OB 2C2LA 2YURA 2ECVA 3GV4A 1F62A 5H9MA 5FB0A 2YYRA 5B78A 4QF3A 2BAYA 4IC2A 4LLBA 5KH7A 2KYUA 2M6MA 3L1ZB 2CT2A 3PURA 1WENA 3N9NA 4L58A 3MHSA 1JOCA 4GB0A 2KWOA 2YHNA 2E6RA 3N9PA 2KIZA 2IDAA 2G45A 1WILA 4A0CD 1JM7B 2KWKA 1CHCA 1U6GB 2JMJA 3NG2A 3U5NA 5H1TA 4PTBA 3LQHA 3ZVYA 3GL6A 4FJCA 1WIMA 4FK5A 2PNXA 3C5KA 3T6RA 4X3GA 3ZPVE 2Y43A 4QF2A 3ZVZB 2FUUA 3LQIA 5TRBA 2I50A 4S3OC 1WEWA 5G0FA 4FO9A 1VFYA 1Z6UA 2LV9A 3M63A 5FERA 2MIQA 1G25A 1MM2A 3O34A 4CA1A 4L7XA 2K16A 1VYXA 5EYAF 5FB1A 4AVXA 4ZDTA 2ECWA 3RPGC 2FUIA 1WESA 3LQJA 3MHHA 5TBNA 2JMDA 2Y1MA 4XI1A 3SOWA 2XEUA 4BHWA 2F42A 4YADA 5LCWB 2CKLB 1RMDA 2MA5A 5JG6A 3QZVA 2VPBA 2H0DA 2L43A 3U5PA 2VJFA 2LXHC 4S3OB 2VP7A 3DPLR 2G6QA 1XWHA 2VPDA 3O36A 4UP5A 2YW8A 4WA6A 1Z2QA 2MD8C 4AUQB 5D1MB 1N87A 3DQVR 4ZUXU 1FBVA 2LRIC 2YHOA 4I7DA 2H0DB 2KGIA 2RI7A 3EB5A 1T1HA 3SHBA 1WEOA 3KNVA 1WEQA 2HDPA 4WZ2A 2YREA 1E4UA 2YSMA 2L0BA 4O64A 2YQMA 1WEVA 5H1VA 2ECIA 2KR4A 1HYJA 3SOUA 3ASLA 4I7CA 1WGMA 3O33A 2YUCA 3ZTGA 1WEPA 5LKXA 3T7LA 4GNFA 2M85A 1BORA 2MD7B 2LGGA 4MVTA 2G43A 2EA6A 5G05B 3V43A 2LGLA 4LK9A 4R7EA 2YT5A 2Y1NA 4LKAA 1Z60A 5TDWA 4A4CA 2C2VS 4B7YC 5D1KB 5C11A 4UI9B 2K17A 2KFTA 3EB6A 2OXQC 1WEMA 4R2YA 1JM7A 3N9QA 3N9OA 3M62A 2LXPC 3O7AA 4V3LC 3U5OA 2KGGA 2MUMA 2KU3A 2QIZA 2QICA 1WE9A 4LJNA 3RTRB 5DKAA 2VPGA 5DINA 4LADB 1X4UA 4C9ZA 2CKLA 2QJ0A 3L11A 5TDRA 3SOXA 5B76A 4F52B 2VJFB 2AN6A 2ECJA 2UZGA 4IC3A 3PHDA 2KWNA 1X4JA 4N4FA 3ZPV1 2F6JA 2VNFA 2LN0A 4N3WA 5KH9A 2M3HA 4ZQLA 5KH3A 2FSAA 2D8SA 2XB1A 5B75A 3PUQA 4W4UA 3I2DA 4YC9A
chains in the Genus database with same CATH superfamily
2YSJA 1WEEA 5AIUA 2HYED 3RPGB 2MT5A 2E6SA 4YABA 2K1JA 1K2FA 4PPEA 5B77A 3LVRE 4YATA 4YBMA 4R8PK 2MA6A 4WZ3B 3FM8C 2JMIA 1X4IA 2L7PA 2DSMA 4WZ0A 3ZYQA 5J3XA 2ZETC 3LJUX 3N9LA 3ZNIA 4B86C 5FEYA 1VD4A 3SUBA 3O35A 2CSYA 4BBQA 4GNGA 2YQLA 3HCUA 3FANA 4UP0A 3VK6A 1MM3A 5I3LA 5C13A 1LDKC 1DVPA 2XOZA 5SVXA 3E2DA 2E61A 2VJEB 4AP4A 4A4BA 4Q6FA 5LKUA 2L80A 3M99A 1IYMA 2ECGA 2ECNA 3L1XA 4A49A 3HCSA 5B79A 4YAXA 2EODA 3LRQA 2VJEA 3HCTA 2DJAA 5D1LB 2LQ6A 4YBSA 3KV6A 2CONA 5H1UA 5LKTA 1FP0A 2OWAA 2K4DA 3N9MA 2L5UA 4I7BA 3HTKC 2LAUA 3O37A 5AITA 2PUYA 3DWDA 3FL2A 3C6WA 4Z0OA 2F6NA 5K3QA 2RR4A 5G04B 5B8DA 2XOCA 2B0OE 2LGKA 2KE1A 4V3KC 2ECTA 2YU4A 4YBTA 4TKPB 3U5MA 1V87A 2LDRA 4MSXA 1WEUA 1LDJB 4AYCA 2VPEA 2RSDA 3IHPA 2KREA 2M1RA 1ZBDB 4CCGX 3O47A 3O70A 4FIPA 2MNYA 2JRJA 2DX8A 3KV5A 3KQIA 4NN2A 2L75A 2LGVA 2MNZA 4OGEA 4GNDA 5LKZA 3MDBC 4GNEA 2EGPA 2NAAA 3JUEA 4AYCB 2KWJA 5TABA 2CSZA 1WFKA 1HYIA 4P5OB 2C2LA 2YVRA 2YURA 2ECVA 3GV4A 1F62A 5H9MA 5FB0A 2YYRA 4Z0RA 2XOYA 5B78A 4QF3A 2BAYA 4IC2A 4LLBA 5KH7A 2KYUA 2M6MA 3H7HA 3L1ZB 2CT2A 3PURA 1WENA 3N9NA 4H9DA 4L58A 3MHSA 1JOCA 4GB0A 2KWOA 2YHNA 2E6RA 3N9PA 2KIZA 2IDAA 2G45A 1WILA 4A0CD 1JM7B 2KWKA 3KDEC 1CHCA 3LVQE 1U6GB 2EGMA 3FAOA 2JMJA 3NG2A 3U5NA 5H1TA 4PTBA 3LQHA 3ZVYA 3GL6A 4FJCA 1WIMA 4FK5A 2PNXA 3C5KA 3PLWA 3T6RA 4QQ4A 4X3GA 3ZPVE 2Y43A 4QF2A 3ZVZB 2FUUA 3LQIA 5TRBA 2I50A 4S3OC 1WEWA 5G0FA 4FO9A 1VFYA 1Z6UA 2LV9A 3M63A 5FERA 2MIQA 1G25A 2CSVA 1MM2A 2FD4A 3O34A 4CA1A 4L7XA 2K16A 1VYXA 5EYAF 2CRWA 5FB1A 4ZDTA 4AVXA 2ECWA 2FFWA 3RPGC 2FUIA 1WESA 3LQJA 3MHHA 5TBNA 1MBMA 2JMDA 2Y1MA 4XI1A 3SOWA 2XEUA 4BHWA 2F42A 4YADA 3T9KA 2KKXA 5LCWB 2CKLB 1RMDA 2MA5A 5JG6A 3QZVA 2VPBA 2H0DA 2L43A 3U5PA 2VJFA 2LXHC 4S3OB 2VP7A 3DPLR 2G6QA 1XWHA 2VPDA 3O36A 4UP5A 2YW8A 2JUNA 4WA6A 1Z2QA 2MD8C 4AUQB 4O62A 5D1MB 1N87A 3DQVR 4ZUXU 3DDTA 1FBVA 2LRIC 2YHOA 4I7DA 2H0DB 2KGIA 2RI7A 3Q1DA 3EB5A 1T1HA 3SHBA 1WEOA 3KNVA 1WEQA 2HDPA 4WZ2A 2YREA 1E4UA 2YSMA 2M13A 2L0BA 4O64A 2YQMA 1WEVA 4OGCA 5H1VA 2CRRA 2ECIA 2KR4A 2KKYA 1HYJA 3SOUA 3ASLA 4I7CA 1WGMA 3O33A 2YUCA 3ZTGA 1WEPA 2EXUA 5LKXA 3T7LA 4GNFA 2D8UA 2M85A 1BORA 2MD7B 2LGGA 4MVTA 2G43A 2EA6A 5G05B 3V43A 2LGLA 4LK9A 4R7EA 2YT5A 2JM3A 2Y1NA 4LKAA 5SVIB 2IQJA 1Z60A 5TDWA 4A4CA 2C2VS 4B7YC 5D1KB 5SVYA 5C11A 4UI9B 2XP0A 2K17A 2KFTA 2P57A 3EB6A 3M7KA 2OXQC 1WEMA 4R2YA 1JM7A 3N9QA 3N9OA 3M62A 2LXPC 3O7AA 4V3LC 3U5OA 2KGGA 3FEHA 2MUMA 2KU3A 2QIZA 2QICA 1WE9A 4LJNA 3RTRB 5DKAA 2VPGA 4F1PA 5DINA 4LADB 1DCQA 1X4UA 3FJUB 2QJ0A 2CKLA 3L11A 3SOXA 5TDRA 4C9ZA 5B76A 4F52B 2VJFB 2AN6A 2ECJA 2UZGA 4IC3A 3PHDA 2KWNA 1X4JA 4N4FA 3ZPV1 2F6JA 2VNFA 2LN0A 4N3WA 5KH9A 5SVIA 2MKEA 3LDYA 2M3HA 4ZQLA 5KH3A 2FSAA 2D8SA 2XB1A 5B75A 3PUQA 4W4UA 3I2DA 4YC9A
chains in the Genus database with same CATH topology
2YSJA 1WEEA 5AIUA 2HYED 3RPGB 2MT5A 2E6SA 4YABA 2K1JA 1K2FA 4PPEA 5B77A 4YATA 4YBMA 4R8PK 2MA6A 4WZ3B 2JMIA 1X4IA 4WZ0A 3ZYQA 5J3XA 2ZETC 3N9LA 3ZNIA 4B86C 5FEYA 1VD4A 3O35A 2CSYA 4BBQA 4GNGA 2YQLA 3HCUA 4UP0A 3VK6A 1MM3A 5I3LA 5C13A 1LDKC 1DVPA 2VJEB 4AP4A 4A4BA 4Q6FA 5LKUA 2L80A 3M99A 1IYMA 2ECGA 2ECNA 3L1XA 4A49A 3HCSA 5B79A 4YAXA 2EODA 3LRQA 2VJEA 3HCTA 5D1LB 2LQ6A 4YBSA 3KV6A 5H1UA 5LKTA 1FP0A 2K4DA 3N9MA 2L5UA 4I7BA 3HTKC 3O37A 5AITA 2PUYA 3FL2A 3C6WA 2F6NA 5G04B 5B8DA 2LGKA 2KE1A 4V3KC 2ECTA 2YU4A 4YBTA 4TKPB 3U5MA 1V87A 2LDRA 4MSXA 1WEUA 1LDJB 4AYCA 2VPEA 2RSDA 3IHPA 2KREA 2M1RA 1ZBDB 4CCGX 3O70A 4FIPA 2MNYA 2JRJA 2DX8A 3KV5A 3KQIA 4NN2A 2L75A 2LGVA 2MNZA 4GNDA 5LKZA 4GNEA 2EGPA 2NAAA 4AYCB 2KWJA 5TABA 2CSZA 1WFKA 1HYIA 4P5OB 2C2LA 2YURA 2ECVA 3GV4A 1F62A 5H9MA 5FB0A 2YYRA 5B78A 4QF3A 2BAYA 4IC2A 4LLBA 5KH7A 2KYUA 2M6MA 3L1ZB 2CT2A 3PURA 1WENA 3N9NA 4L58A 3MHSA 1JOCA 4GB0A 2KWOA 2YHNA 2E6RA 3N9PA 2KIZA 2IDAA 2G45A 1WILA 4A0CD 1JM7B 2KWKA 1CHCA 1U6GB 2JMJA 3NG2A 3U5NA 5H1TA 4PTBA 3LQHA 3ZVYA 3GL6A 4FJCA 1WIMA 4FK5A 2PNXA 3C5KA 3T6RA 4X3GA 3ZPVE 2Y43A 4QF2A 3ZVZB 2FUUA 3LQIA 5TRBA 2I50A 4S3OC 1WEWA 5G0FA 4FO9A 1VFYA 1Z6UA 2LV9A 3M63A 5FERA 2MIQA 1G25A 1MM2A 3O34A 4CA1A 4L7XA 2K16A 1VYXA 5EYAF 5FB1A 4AVXA 4ZDTA 2ECWA 3RPGC 2FUIA 1WESA 3LQJA 3MHHA 5TBNA 2JMDA 2Y1MA 4XI1A 3SOWA 2XEUA 4BHWA 2F42A 4YADA 5LCWB 2CKLB 1RMDA 2MA5A 5JG6A 3QZVA 2VPBA 2H0DA 2L43A 3U5PA 2VJFA 2LXHC 4S3OB 2VP7A 3DPLR 2G6QA 1XWHA 2VPDA 3O36A 4UP5A 2YW8A 4WA6A 1Z2QA 2MD8C 4AUQB 5D1MB 1N87A 3DQVR 4ZUXU 1FBVA 2LRIC 2YHOA 4I7DA 2H0DB 2KGIA 2RI7A 3EB5A 1T1HA 3SHBA 1WEOA 3KNVA 1WEQA 2HDPA 4WZ2A 2YREA 1E4UA 2YSMA 2L0BA 4O64A 2YQMA 1WEVA 5H1VA 2ECIA 2KR4A 1HYJA 3SOUA 3ASLA 4I7CA 1WGMA 3O33A 2YUCA 3ZTGA 1WEPA 5LKXA 3T7LA 4GNFA 2M85A 1BORA 2MD7B 2LGGA 4MVTA 2G43A 2EA6A 5G05B 3V43A 2LGLA 4LK9A 4R7EA 2YT5A 2Y1NA 4LKAA 1Z60A 5TDWA 4A4CA 2C2VS 4B7YC 5D1KB 5C11A 4UI9B 2K17A 2KFTA 3EB6A 2OXQC 1WEMA 4R2YA 1JM7A 3N9QA 3N9OA 3M62A 2LXPC 3O7AA 4V3LC 3U5OA 2KGGA 2MUMA 2KU3A 2QIZA 2QICA 1WE9A 4LJNA 3RTRB 5DKAA 2VPGA 5DINA 4LADB 1X4UA 4C9ZA 2CKLA 2QJ0A 3L11A 5TDRA 3SOXA 5B76A 4F52B 2VJFB 2AN6A 2ECJA 2UZGA 4IC3A 3PHDA 2KWNA 1X4JA 4N4FA 3ZPV1 2F6JA 2VNFA 2LN0A 4N3WA 5KH9A 2M3HA 4ZQLA 5KH3A 2FSAA 2D8SA 2XB1A 5B75A 3PUQA 4W4UA 3I2DA 4YC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSJ A;  1WEE A;  5AIU A;  2HYE D;  3RPG B;  2MT5 A;  2E6S A;  4YAB A;  2K1J A;  1K2F A;  4PPE A;  5B77 A;  4YAT A;  4YBM A;  4R8P K;  2MA6 A;  4WZ3 B;  2JMI A;  1X4I A;  4WZ0 A;  3ZYQ A;  5J3X A;  2ZET C;  3N9L A;  3ZNI A;  4B86 C;  5FEY A;  1VD4 A;  3O35 A;  2CSY A;  4BBQ A;  4GNG A;  2YQL A;  3HCU A;  4UP0 A;  3VK6 A;  1MM3 A;  5I3L A;  5C13 A;  1LDK C;  1DVP A;  2VJE B;  4AP4 A;  4A4B A;  4Q6F A;  5LKU A;  2L80 A;  3M99 A;  1IYM A;  2ECG A;  2ECN A;  3L1X A;  4A49 A;  3HCS A;  5B79 A;  4YAX A;  2EOD A;  3LRQ A;  2VJE A;  3HCT A;  5D1L B;  2LQ6 A;  4YBS A;  3KV6 A;  5H1U A;  5LKT A;  1FP0 A;  2K4D A;  3N9M A;  2L5U A;  4I7B A;  3HTK C;  3O37 A;  5AIT A;  2PUY A;  3FL2 A;  3C6W A;  2F6N A;  5G04 B;  5B8D A;  2LGK A;  2KE1 A;  4V3K C;  2ECT A;  2YU4 A;  4YBT A;  4TKP B;  3U5M A;  1V87 A;  2LDR A;  4MSX A;  1WEU A;  1LDJ B;  4AYC A;  2VPE A;  2RSD A;  3IHP A;  2KRE A;  2M1R A;  1ZBD B;  4CCG X;  3O70 A;  4FIP A;  2MNY A;  2JRJ A;  2DX8 A;  3KV5 A;  3KQI A;  4NN2 A;  2L75 A;  2LGV A;  2MNZ A;  4GND A;  5LKZ A;  4GNE A;  2EGP A;  2NAA A;  4AYC B;  2KWJ A;  5TAB A;  2CSZ A;  1WFK A;  1HYI A;  4P5O B;  2C2L A;  2YUR A;  2ECV A;  3GV4 A;  1F62 A;  5H9M A;  5FB0 A;  2YYR A;  5B78 A;  4QF3 A;  2BAY A;  4IC2 A;  4LLB A;  5KH7 A;  2KYU A;  2M6M A;  3L1Z B;  2CT2 A;  3PUR A;  1WEN A;  3N9N A;  4L58 A;  3MHS A;  1JOC A;  4GB0 A;  2KWO A;  2YHN A;  2E6R A;  3N9P A;  2KIZ A;  2IDA A;  2G45 A;  1WIL A;  4A0C D;  1JM7 B;  2KWK A;  1CHC A;  1U6G B;  2JMJ A;  3NG2 A;  3U5N A;  5H1T A;  4PTB A;  3LQH A;  3ZVY A;  3GL6 A;  4FJC A;  1WIM A;  4FK5 A;  2PNX A;  3C5K A;  3T6R A;  4X3G A;  3ZPV E;  2Y43 A;  4QF2 A;  3ZVZ B;  2FUU A;  3LQI A;  5TRB A;  2I50 A;  4S3O C;  1WEW A;  5G0F A;  4FO9 A;  1VFY A;  1Z6U A;  2LV9 A;  3M63 A;  5FER A;  2MIQ A;  1G25 A;  1MM2 A;  3O34 A;  4CA1 A;  4L7X A;  2K16 A;  1VYX A;  5EYA F;  5FB1 A;  4AVX A;  4ZDT A;  2ECW A;  3RPG C;  2FUI A;  1WES A;  3LQJ A;  3MHH A;  5TBN A;  2JMD A;  2Y1M A;  4XI1 A;  3SOW A;  2XEU A;  4BHW A;  2F42 A;  4YAD A;  5LCW B;  2CKL B;  1RMD A;  2MA5 A;  5JG6 A;  3QZV A;  2VPB A;  2H0D A;  2L43 A;  3U5P A;  2VJF A;  2LXH C;  4S3O B;  2VP7 A;  3DPL R;  2G6Q A;  1XWH A;  2VPD A;  3O36 A;  4UP5 A;  2YW8 A;  4WA6 A;  1Z2Q A;  2MD8 C;  4AUQ B;  5D1M B;  1N87 A;  3DQV R;  4ZUX U;  1FBV A;  2LRI C;  2YHO A;  4I7D A;  2H0D B;  2KGI A;  2RI7 A;  3EB5 A;  1T1H A;  3SHB A;  1WEO A;  3KNV A;  1WEQ A;  2HDP A;  4WZ2 A;  2YRE A;  1E4U A;  2YSM A;  2L0B A;  4O64 A;  2YQM A;  1WEV A;  5H1V A;  2ECI A;  2KR4 A;  1HYJ A;  3SOU A;  3ASL A;  4I7C A;  1WGM A;  3O33 A;  2YUC A;  3ZTG A;  1WEP A;  5LKX A;  3T7L A;  4GNF A;  2M85 A;  1BOR A;  2MD7 B;  2LGG A;  4MVT A;  2G43 A;  2EA6 A;  5G05 B;  3V43 A;  2LGL A;  4LK9 A;  4R7E A;  2YT5 A;  2Y1N A;  4LKA A;  1Z60 A;  5TDW A;  4A4C A;  2C2V S;  4B7Y C;  5D1K B;  5C11 A;  4UI9 B;  2K17 A;  2KFT A;  3EB6 A;  2OXQ C;  1WEM A;  4R2Y A;  1JM7 A;  3N9Q A;  3N9O A;  3M62 A;  2LXP C;  3O7A A;  4V3L C;  3U5O A;  2KGG A;  2MUM A;  2KU3 A;  2QIZ A;  2QIC A;  1WE9 A;  4LJN A;  3RTR B;  5DKA A;  2VPG A;  5DIN A;  4LAD B;  1X4U A;  4C9Z A;  2CKL A;  2QJ0 A;  3L11 A;  5TDR A;  3SOX A;  5B76 A;  4F52 B;  2VJF B;  2AN6 A;  2ECJ A;  2UZG A;  4IC3 A;  3PHD A;  2KWN A;  1X4J A;  4N4F A;  3ZPV 1;  2F6J A;  2VNF A;  2LN0 A;  4N3W A;  5KH9 A;  2M3H A;  4ZQL A;  5KH3 A;  2FSA A;  2D8S A;  2XB1 A;  5B75 A;  3PUQ A;  4W4U A;  3I2D A;  4YC9 A; 
#chains in the Genus database with same CATH topology
 2YSJ A;  1WEE A;  5AIU A;  2HYE D;  3RPG B;  2MT5 A;  2E6S A;  4YAB A;  2K1J A;  1K2F A;  4PPE A;  5B77 A;  3LVR E;  4YAT A;  4YBM A;  4R8P K;  2MA6 A;  4WZ3 B;  3FM8 C;  2JMI A;  1X4I A;  2L7P A;  2DSM A;  4WZ0 A;  3ZYQ A;  5J3X A;  2ZET C;  3LJU X;  3N9L A;  3ZNI A;  4B86 C;  5FEY A;  1VD4 A;  3SUB A;  3O35 A;  2CSY A;  4BBQ A;  4GNG A;  2YQL A;  3HCU A;  3FAN A;  4UP0 A;  3VK6 A;  1MM3 A;  5I3L A;  5C13 A;  1LDK C;  1DVP A;  2XOZ A;  5SVX A;  3E2D A;  2E61 A;  2VJE B;  4AP4 A;  4A4B A;  4Q6F A;  5LKU A;  2L80 A;  3M99 A;  1IYM A;  2ECG A;  2ECN A;  3L1X A;  4A49 A;  3HCS A;  5B79 A;  4YAX A;  2EOD A;  3LRQ A;  2VJE A;  3HCT A;  2DJA A;  5D1L B;  2LQ6 A;  4YBS A;  3KV6 A;  2CON A;  5H1U A;  5LKT A;  1FP0 A;  2OWA A;  2K4D A;  3N9M A;  2L5U A;  4I7B A;  3HTK C;  2LAU A;  3O37 A;  5AIT A;  2PUY A;  3DWD A;  3FL2 A;  3C6W A;  4Z0O A;  2F6N A;  5K3Q A;  2RR4 A;  5G04 B;  5B8D A;  2XOC A;  2B0O E;  2LGK A;  2KE1 A;  4V3K C;  2ECT A;  2YU4 A;  4YBT A;  4TKP B;  3U5M A;  1V87 A;  2LDR A;  4MSX A;  1WEU A;  1LDJ B;  4AYC A;  2VPE A;  2RSD A;  3IHP A;  2KRE A;  2M1R A;  1ZBD B;  4CCG X;  3O47 A;  3O70 A;  4FIP A;  2MNY A;  2JRJ A;  2DX8 A;  3KV5 A;  3KQI A;  4NN2 A;  2L75 A;  2LGV A;  2MNZ A;  4OGE A;  4GND A;  5LKZ A;  3MDB C;  4GNE A;  2EGP A;  2NAA A;  3JUE A;  4AYC B;  2KWJ A;  5TAB A;  2CSZ A;  1WFK A;  1HYI A;  4P5O B;  2C2L A;  2YVR A;  2YUR A;  2ECV A;  3GV4 A;  1F62 A;  5H9M A;  5FB0 A;  2YYR A;  4Z0R A;  2XOY A;  5B78 A;  4QF3 A;  2BAY A;  4IC2 A;  4LLB A;  5KH7 A;  2KYU A;  2M6M A;  3H7H A;  3L1Z B;  2CT2 A;  3PUR A;  1WEN A;  3N9N A;  4H9D A;  4L58 A;  3MHS A;  1JOC A;  4GB0 A;  2KWO A;  2YHN A;  2E6R A;  3N9P A;  2KIZ A;  2IDA A;  2G45 A;  1WIL A;  4A0C D;  1JM7 B;  2KWK A;  3KDE C;  1CHC A;  3LVQ E;  1U6G B;  2EGM A;  3FAO A;  2JMJ A;  3NG2 A;  3U5N A;  5H1T A;  4PTB A;  3LQH A;  3ZVY A;  3GL6 A;  4FJC A;  1WIM A;  4FK5 A;  2PNX A;  3C5K A;  3PLW A;  3T6R A;  4QQ4 A;  4X3G A;  3ZPV E;  2Y43 A;  4QF2 A;  3ZVZ B;  2FUU A;  3LQI A;  5TRB A;  2I50 A;  4S3O C;  1WEW A;  5G0F A;  4FO9 A;  1VFY A;  1Z6U A;  2LV9 A;  3M63 A;  5FER A;  2MIQ A;  1G25 A;  2CSV A;  1MM2 A;  2FD4 A;  3O34 A;  4CA1 A;  4L7X A;  2K16 A;  1VYX A;  5EYA F;  2CRW A;  5FB1 A;  4ZDT A;  4AVX A;  2ECW A;  2FFW A;  3RPG C;  2FUI A;  1WES A;  3LQJ A;  3MHH A;  5TBN A;  1MBM A;  2JMD A;  2Y1M A;  4XI1 A;  3SOW A;  2XEU A;  4BHW A;  2F42 A;  4YAD A;  3T9K A;  2KKX A;  5LCW B;  2CKL B;  1RMD A;  2MA5 A;  5JG6 A;  3QZV A;  2VPB A;  2H0D A;  2L43 A;  3U5P A;  2VJF A;  2LXH C;  4S3O B;  2VP7 A;  3DPL R;  2G6Q A;  1XWH A;  2VPD A;  3O36 A;  4UP5 A;  2YW8 A;  2JUN A;  4WA6 A;  1Z2Q A;  2MD8 C;  4AUQ B;  4O62 A;  5D1M B;  1N87 A;  3DQV R;  4ZUX U;  3DDT A;  1FBV A;  2LRI C;  2YHO A;  4I7D A;  2H0D B;  2KGI A;  2RI7 A;  3Q1D A;  3EB5 A;  1T1H A;  3SHB A;  1WEO A;  3KNV A;  1WEQ A;  2HDP A;  4WZ2 A;  2YRE A;  1E4U A;  2YSM A;  2M13 A;  2L0B A;  4O64 A;  2YQM A;  1WEV A;  4OGC A;  5H1V A;  2CRR A;  2ECI A;  2KR4 A;  2KKY A;  1HYJ A;  3SOU A;  3ASL A;  4I7C A;  1WGM A;  3O33 A;  2YUC A;  3ZTG A;  1WEP A;  2EXU A;  5LKX A;  3T7L A;  4GNF A;  2D8U A;  2M85 A;  1BOR A;  2MD7 B;  2LGG A;  4MVT A;  2G43 A;  2EA6 A;  5G05 B;  3V43 A;  2LGL A;  4LK9 A;  4R7E A;  2YT5 A;  2JM3 A;  2Y1N A;  4LKA A;  5SVI B;  2IQJ A;  1Z60 A;  5TDW A;  4A4C A;  2C2V S;  4B7Y C;  5D1K B;  5SVY A;  5C11 A;  4UI9 B;  2XP0 A;  2K17 A;  2KFT A;  2P57 A;  3EB6 A;  3M7K A;  2OXQ C;  1WEM A;  4R2Y A;  1JM7 A;  3N9Q A;  3N9O A;  3M62 A;  2LXP C;  3O7A A;  4V3L C;  3U5O A;  2KGG A;  3FEH A;  2MUM A;  2KU3 A;  2QIZ A;  2QIC A;  1WE9 A;  4LJN A;  3RTR B;  5DKA A;  2VPG A;  4F1P A;  5DIN A;  4LAD B;  1DCQ A;  1X4U A;  3FJU B;  2QJ0 A;  2CKL A;  3L11 A;  3SOX A;  5TDR A;  4C9Z A;  5B76 A;  4F52 B;  2VJF B;  2AN6 A;  2ECJ A;  2UZG A;  4IC3 A;  3PHD A;  2KWN A;  1X4J A;  4N4F A;  3ZPV 1;  2F6J A;  2VNF A;  2LN0 A;  4N3W A;  5KH9 A;  5SVI A;  2MKE A;  3LDY A;  2M3H A;  4ZQL A;  5KH3 A;  2FSA A;  2D8S A;  2XB1 A;  5B75 A;  3PUQ A;  4W4U A;  3I2D A;  4YC9 A; 
#chains in the Genus database with same CATH homology
 2YSJ A;  1WEE A;  5AIU A;  2HYE D;  3RPG B;  2MT5 A;  2E6S A;  4YAB A;  2K1J A;  1K2F A;  4PPE A;  5B77 A;  4YAT A;  4YBM A;  4R8P K;  2MA6 A;  4WZ3 B;  2JMI A;  1X4I A;  4WZ0 A;  3ZYQ A;  5J3X A;  2ZET C;  3N9L A;  3ZNI A;  4B86 C;  5FEY A;  1VD4 A;  3O35 A;  2CSY A;  4BBQ A;  4GNG A;  2YQL A;  3HCU A;  4UP0 A;  3VK6 A;  1MM3 A;  5I3L A;  5C13 A;  1LDK C;  1DVP A;  2VJE B;  4AP4 A;  4A4B A;  4Q6F A;  5LKU A;  2L80 A;  3M99 A;  1IYM A;  2ECG A;  2ECN A;  3L1X A;  4A49 A;  3HCS A;  5B79 A;  4YAX A;  2EOD A;  3LRQ A;  2VJE A;  3HCT A;  5D1L B;  2LQ6 A;  4YBS A;  3KV6 A;  5H1U A;  5LKT A;  1FP0 A;  2K4D A;  3N9M A;  2L5U A;  4I7B A;  3HTK C;  3O37 A;  5AIT A;  2PUY A;  3FL2 A;  3C6W A;  2F6N A;  5G04 B;  5B8D A;  2LGK A;  2KE1 A;  4V3K C;  2ECT A;  2YU4 A;  4YBT A;  4TKP B;  3U5M A;  1V87 A;  2LDR A;  4MSX A;  1WEU A;  1LDJ B;  4AYC A;  2VPE A;  2RSD A;  3IHP A;  2KRE A;  2M1R A;  1ZBD B;  4CCG X;  3O70 A;  4FIP A;  2MNY A;  2JRJ A;  2DX8 A;  3KV5 A;  3KQI A;  4NN2 A;  2L75 A;  2LGV A;  2MNZ A;  4GND A;  5LKZ A;  4GNE A;  2EGP A;  2NAA A;  4AYC B;  2KWJ A;  5TAB A;  2CSZ A;  1WFK A;  1HYI A;  4P5O B;  2C2L A;  2YUR A;  2ECV A;  3GV4 A;  1F62 A;  5H9M A;  5FB0 A;  2YYR A;  5B78 A;  4QF3 A;  2BAY A;  4IC2 A;  4LLB A;  5KH7 A;  2KYU A;  2M6M A;  3L1Z B;  2CT2 A;  3PUR A;  1WEN A;  3N9N A;  4L58 A;  3MHS A;  1JOC A;  4GB0 A;  2KWO A;  2YHN A;  2E6R A;  3N9P A;  2KIZ A;  2IDA A;  2G45 A;  1WIL A;  4A0C D;  1JM7 B;  2KWK A;  1CHC A;  1U6G B;  2JMJ A;  3NG2 A;  3U5N A;  5H1T A;  4PTB A;  3LQH A;  3ZVY A;  3GL6 A;  4FJC A;  1WIM A;  4FK5 A;  2PNX A;  3C5K A;  3T6R A;  4X3G A;  3ZPV E;  2Y43 A;  4QF2 A;  3ZVZ B;  2FUU A;  3LQI A;  5TRB A;  2I50 A;  4S3O C;  1WEW A;  5G0F A;  4FO9 A;  1VFY A;  1Z6U A;  2LV9 A;  3M63 A;  5FER A;  2MIQ A;  1G25 A;  1MM2 A;  3O34 A;  4CA1 A;  4L7X A;  2K16 A;  1VYX A;  5EYA F;  5FB1 A;  4AVX A;  4ZDT A;  2ECW A;  3RPG C;  2FUI A;  1WES A;  3LQJ A;  3MHH A;  5TBN A;  2JMD A;  2Y1M A;  4XI1 A;  3SOW A;  2XEU A;  4BHW A;  2F42 A;  4YAD A;  5LCW B;  2CKL B;  1RMD A;  2MA5 A;  5JG6 A;  3QZV A;  2VPB A;  2H0D A;  2L43 A;  3U5P A;  2VJF A;  2LXH C;  4S3O B;  2VP7 A;  3DPL R;  2G6Q A;  1XWH A;  2VPD A;  3O36 A;  4UP5 A;  2YW8 A;  4WA6 A;  1Z2Q A;  2MD8 C;  4AUQ B;  5D1M B;  1N87 A;  3DQV R;  4ZUX U;  1FBV A;  2LRI C;  2YHO A;  4I7D A;  2H0D B;  2KGI A;  2RI7 A;  3EB5 A;  1T1H A;  3SHB A;  1WEO A;  3KNV A;  1WEQ A;  2HDP A;  4WZ2 A;  2YRE A;  1E4U A;  2YSM A;  2L0B A;  4O64 A;  2YQM A;  1WEV A;  5H1V A;  2ECI A;  2KR4 A;  1HYJ A;  3SOU A;  3ASL A;  4I7C A;  1WGM A;  3O33 A;  2YUC A;  3ZTG A;  1WEP A;  5LKX A;  3T7L A;  4GNF A;  2M85 A;  1BOR A;  2MD7 B;  2LGG A;  4MVT A;  2G43 A;  2EA6 A;  5G05 B;  3V43 A;  2LGL A;  4LK9 A;  4R7E A;  2YT5 A;  2Y1N A;  4LKA A;  1Z60 A;  5TDW A;  4A4C A;  2C2V S;  4B7Y C;  5D1K B;  5C11 A;  4UI9 B;  2K17 A;  2KFT A;  3EB6 A;  2OXQ C;  1WEM A;  4R2Y A;  1JM7 A;  3N9Q A;  3N9O A;  3M62 A;  2LXP C;  3O7A A;  4V3L C;  3U5O A;  2KGG A;  2MUM A;  2KU3 A;  2QIZ A;  2QIC A;  1WE9 A;  4LJN A;  3RTR B;  5DKA A;  2VPG A;  5DIN A;  4LAD B;  1X4U A;  4C9Z A;  2CKL A;  2QJ0 A;  3L11 A;  5TDR A;  3SOX A;  5B76 A;  4F52 B;  2VJF B;  2AN6 A;  2ECJ A;  2UZG A;  4IC3 A;  3PHD A;  2KWN A;  1X4J A;  4N4F A;  3ZPV 1;  2F6J A;  2VNF A;  2LN0 A;  4N3W A;  5KH9 A;  2M3H A;  4ZQL A;  5KH3 A;  2FSA A;  2D8S A;  2XB1 A;  5B75 A;  3PUQ A;  4W4U A;  3I2D A;  4YC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...