3KQIA

Crystal structure of phf2 phd domain complexed with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GSMATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords PHD finger protein 2
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kqiA00
1ZBDB 3EB6A 2HDPA 2VPDA 4I7BA 3SOXA 5D1MB 1X4IA 2D8SA 1HYJA 2MD7B 3NG2A 2DX8A 5AITA 1FBVA 2KREA 4A4BA 3M63A 4O64A 2YSJA 5H1VA 3FL2A 5G05B 1IYMA 1LDKC 2VJEA 5H1TA 4A0CD 4FJCA 1JM7A 3VK6A 1DVPA 2JMJA 3V43A 2LGVA 2KGIA 3N9QA 4V3KC 5LKXA 2Y1MA 4GNFA 4I7CA 4YC9A 3I2DA 3RTRB 2MNYA 2M3HA 4IC3A 2MD8C 5B8DA 3T6RA 2ECJA 2G43A 2K4DA 4R8PK 2LDRA 2LQ6A 3SOUA 2FUUA 5D1LB 4PPEA 2G6QA 1K2FA 4LKAA 2F6NA 2MA5A 4ZDTA 4GNEA 2RI7A 3N9LA 3LRQA 3DPLR 2QIZA 1WEVA 5C11A 5B77A 2KE1A 3KV6A 4YADA 5TABA 4Q6FA 1JM7B 3L11A 2ECIA 1BORA 1VYXA 2YUCA 5G0FA 2ZETC 2FSAA 5B79A 2G45A 4I7DA 1WEUA 2F42A 3KQIA 2AN6A 5D1KB 1VFYA 4UI9B 2VNFA 2QJ0A 4PTBA 4QF2A 2NAAA 2BAYA 4V3LC 4WA6A 5C13A 3IHPA 2VJFA 1WEOA 2KFTA 2ECVA 3O36A 1WEMA 2E6SA 4WZ3B 1VD4A 1WFKA 3C6WA 3O7AA 2EA6A 2CT2A 3U5OA 2L0BA 2VPBA 2YYRA 3M99A 3HTKC 5KH3A 2Y1NA 3O70A 2ECTA 1X4UA 5LKUA 2YURA 4GB0A 3O35A 2KYUA 4IC2A 4YBMA 2LGLA 2XB1A 1MM3A 1E4UA 2PNXA 2CSYA 5B75A 2VJFB 5KH7A 4N4FA 2VP7A 1WEPA 5FB0A 4R7EA 4A4CA 2L80A 1JOCA 2E6RA 5FEYA 3QZVA 5AIUA 2F6JA 4N3WA 4LK9A 5G04B 1CHCA 1N87A 4W4UA 1WEQA 2MNZA 2M1RA 2Y43A 1HYIA 3ZNIA 5JG6A 5TRBA 3ZPVE 5H9MA 2YREA 4LADB 2L75A 2KR4A 3ZTGA 3N9PA 3U5NA 3PUQA 3KV5A 2YT5A 2ECNA 3MHHA 3PURA 3ZPV1 2MT5A 2CSZA 3O37A 4MSXA 4F52B 2H0DA 5J3XA 3RPGB 2I50A 2M85A 3LQHA 3O34A 1X4JA 2MIQA 3N9MA 2JMDA 2ECWA 4YBTA 3O33A 2EGPA 4YBSA 4LLBA 4UP5A 1XWHA 3T7LA 2YW8A 2VJEB 2M6MA 4CCGX 1F62A 1WESA 5EYAF 3KNVA 5DKAA 3GV4A 4FIPA 5B78A 4A49A 1WEEA 3N9NA 2K1JA 1RMDA 4YAXA 3PHDA 2YSMA 3ZVZB 4P5OB 2FUIA 3ASLA 2C2VS 2YHNA 4AYCB 1WENA 2L43A 5TDRA 1WILA 1WIMA 4L7XA 3HCUA 2UZGA 1Z6UA 4YABA 1LDJB 5FERA 4S3OC 2LN0A 1MM2A 3M62A 1FP0A 4ZUXU 2YHOA 2KU3A 2QICA 3C5KA 4XI1A 1WGMA 4GNGA 3U5PA 4R2YA 2CKLA 3SHBA 5I3LA 2EODA 2KWJA 4ZQLA 1G25A 4AUQB 1Z2QA 4B7YC 2PUYA 5DINA 2LXHC 2RSDA 2MA6A 2MUMA 4AP4A 5LCWB 4BHWA 2JMIA 2L5UA 4WZ0A 4NN2A 2LGGA 5FB1A 5LKZA 3U5MA 2CKLB 1V87A 2LGKA 4QF3A 3SOWA 2LXPC 2KWKA 4CA1A 2K17A 2KWOA 5TDWA 2LV9A 5B76A 2YQLA 3MHSA 3L1XA 1Z60A 3EB5A 2HYED 2OXQC 4X3GA 3LQJA 4LJNA 3ZVYA 3HCTA 2VPEA 4YATA 4AYCA 2VPGA 4C9ZA 1T1HA 4WZ2A 2KIZA 4MVTA 1WEWA 2YU4A 4AVXA 2KWNA 5TBNA 2IDAA 5LKTA 4S3OB 1U6GB 3N9OA 3RPGC 1WE9A 3L1ZB 4GNDA 3HCSA 5H1UA 2ECGA 2JRJA 3GL6A 2C2LA 3DQVR 4UP0A 3LQIA 5KH9A 4FK5A 2YQMA 4B86C 2KGGA 4TKPB 2K16A 4L58A 2LRIC 2XEUA 2H0DB 4FO9A 3ZYQA 4BBQA
chains in the Genus database with same CATH superfamily
1ZBDB 3EB6A 2HDPA 4H9DA 2VPDA 4I7BA 3SOXA 3FANA 5D1MB 2B0OE 1X4IA 2D8SA 1HYJA 2MD7B 2CSVA 3NG2A 2DX8A 5AITA 4QQ4A 1FBVA 2KREA 4A4BA 3M63A 4O64A 2YSJA 5H1VA 2E61A 3FL2A 5G05B 1IYMA 1LDKC 2VJEA 5H1TA 4A0CD 4FJCA 1JM7A 3VK6A 5SVXA 2CRWA 1DVPA 2JMJA 3SUBA 3V43A 2LGVA 5SVYA 2KGIA 3N9QA 4V3KC 5LKXA 2Y1MA 4GNFA 4I7CA 4YC9A 3I2DA 3RTRB 2MNYA 2M3HA 4IC3A 3LVRE 2XP0A 2MD8C 3O47A 3T6RA 5B8DA 2ECJA 2G43A 2K4DA 4R8PK 2LDRA 2LQ6A 3SOUA 2FUUA 5D1LB 4PPEA 2G6QA 1K2FA 3LVQE 4LKAA 2F6NA 2MA5A 4ZDTA 2IQJA 2RR4A 4GNEA 2RI7A 3N9LA 3LRQA 5SVIB 3DPLR 2QIZA 1WEVA 3MDBC 5C11A 5B77A 2KE1A 3KV6A 4YADA 2XOYA 1MBMA 5TABA 4Q6FA 1JM7B 3L11A 2ECIA 2L7PA 1BORA 1VYXA 2LAUA 2YUCA 5G0FA 2ZETC 2FSAA 5B79A 2G45A 4I7DA 1WEUA 2F42A 3KQIA 2AN6A 5D1KB 1VFYA 4UI9B 2VNFA 2QJ0A 4PTBA 4QF2A 2NAAA 2BAYA 4V3LC 4WA6A 5C13A 3IHPA 2VJFA 1WEOA 2KFTA 3PLWA 2MKEA 2ECVA 3O36A 1WEMA 2E6SA 4WZ3B 3LDYA 2FD4A 1VD4A 1WFKA 3C6WA 3O7AA 2EA6A 2CT2A 2DSMA 2XOZA 3U5OA 2L0BA 2VPBA 2YYRA 3E2DA 4OGEA 3M99A 4Z0OA 3HTKC 5KH3A 2Y1NA 3O70A 2ECTA 2OWAA 1X4UA 3FAOA 5LKUA 2YURA 2EXUA 4GB0A 3O35A 2KYUA 4IC2A 4YBMA 2LGLA 2XB1A 1MM3A 1E4UA 2JUNA 2P57A 2PNXA 2CSYA 5B75A 2VJFB 5KH7A 4N4FA 2VP7A 4Z0RA 1WEPA 5FB0A 4R7EA 4A4CA 2L80A 1JOCA 2E6RA 5FEYA 3QZVA 3FJUB 5AIUA 2F6JA 4N3WA 4LK9A 3H7HA 5G04B 4F1PA 1CHCA 1N87A 4W4UA 1WEQA 2MNZA 2M1RA 2Y43A 1HYIA 3ZNIA 5JG6A 5TRBA 2CRRA 3KDEC 3ZPVE 5H9MA 2YREA 4LADB 2L75A 2KR4A 3ZTGA 3N9PA 3U5NA 3PUQA 3KV5A 2YT5A 2ECNA 3MHHA 3PURA 3ZPV1 2MT5A 2CSZA 3DDTA 3O37A 4MSXA 4F52B 2H0DA 5J3XA 3RPGB 2I50A 2M85A 3LQHA 3O34A 1X4JA 2MIQA 3N9MA 2JMDA 2ECWA 4YBTA 3O33A 2EGPA 4YBSA 4LLBA 4UP5A 1XWHA 3T7LA 2YW8A 2VJEB 2M6MA 4CCGX 1F62A 1WESA 5EYAF 3KNVA 5DKAA 3GV4A 4FIPA 5B78A 4A49A 1WEEA 3N9NA 2K1JA 1RMDA 3LJUX 4YAXA 3PHDA 2KKXA 2YSMA 3ZVZB 4P5OB 2FUIA 3ASLA 2C2VS 2YHNA 4AYCB 1WENA 2L43A 5TDRA 1WILA 1WIMA 4L7XA 3HCUA 2UZGA 1Z6UA 4YABA 1LDJB 5FERA 2KKYA 4S3OC 3M7KA 2XOCA 2LN0A 1MM2A 3M62A 1FP0A 4ZUXU 2YHOA 2KU3A 2QICA 3C5KA 4XI1A 1WGMA 4GNGA 3T9KA 3U5PA 4R2YA 2CKLA 5SVIA 3SHBA 5I3LA 2EODA 2KWJA 4ZQLA 1G25A 4AUQB 1Z2QA 4B7YC 1DCQA 2PUYA 5DINA 2LXHC 3FEHA 2CONA 2RSDA 3JUEA 2MA6A 2MUMA 4AP4A 5LCWB 4BHWA 2D8UA 2M13A 2JMIA 2L5UA 4WZ0A 4NN2A 2LGGA 5FB1A 5LKZA 3U5MA 2CKLB 1V87A 2LGKA 4QF3A 3SOWA 2LXPC 2KWKA 4CA1A 2K17A 2KWOA 5TDWA 2LV9A 5B76A 2YQLA 3MHSA 3L1XA 1Z60A 2JM3A 3EB5A 2HYED 2OXQC 4X3GA 3LQJA 4LJNA 3ZVYA 3HCTA 2VPEA 4YATA 4AYCA 2VPGA 4C9ZA 1T1HA 2YVRA 4WZ2A 3DWDA 3Q1DA 2KIZA 4MVTA 1WEWA 2YU4A 4AVXA 2KWNA 5TBNA 2IDAA 5LKTA 4S3OB 1U6GB 5K3QA 3N9OA 3RPGC 1WE9A 3L1ZB 4OGCA 3FM8C 4O62A 4GNDA 3HCSA 5H1UA 2DJAA 2ECGA 2FFWA 2EGMA 2JRJA 3GL6A 2C2LA 3DQVR 4UP0A 3LQIA 5KH9A 4FK5A 2YQMA 4B86C 2KGGA 4TKPB 2K16A 4L58A 2LRIC 2XEUA 2H0DB 4FO9A 3ZYQA 4BBQA
chains in the Genus database with same CATH topology
1ZBDB 3EB6A 2HDPA 2VPDA 4I7BA 3SOXA 5D1MB 1X4IA 2D8SA 1HYJA 2MD7B 3NG2A 2DX8A 5AITA 1FBVA 2KREA 4A4BA 3M63A 4O64A 2YSJA 5H1VA 3FL2A 5G05B 1IYMA 1LDKC 2VJEA 5H1TA 4A0CD 4FJCA 1JM7A 3VK6A 1DVPA 2JMJA 3V43A 2LGVA 2KGIA 3N9QA 4V3KC 5LKXA 2Y1MA 4GNFA 4I7CA 4YC9A 3I2DA 3RTRB 2MNYA 2M3HA 4IC3A 2MD8C 5B8DA 3T6RA 2ECJA 2G43A 2K4DA 4R8PK 2LDRA 2LQ6A 3SOUA 2FUUA 5D1LB 4PPEA 2G6QA 1K2FA 4LKAA 2F6NA 2MA5A 4ZDTA 4GNEA 2RI7A 3N9LA 3LRQA 3DPLR 2QIZA 1WEVA 5C11A 5B77A 2KE1A 3KV6A 4YADA 5TABA 4Q6FA 1JM7B 3L11A 2ECIA 1BORA 1VYXA 2YUCA 5G0FA 2ZETC 2FSAA 5B79A 2G45A 4I7DA 1WEUA 2F42A 3KQIA 2AN6A 5D1KB 1VFYA 4UI9B 2VNFA 2QJ0A 4PTBA 4QF2A 2NAAA 2BAYA 4V3LC 4WA6A 5C13A 3IHPA 2VJFA 1WEOA 2KFTA 2ECVA 3O36A 1WEMA 2E6SA 4WZ3B 1VD4A 1WFKA 3C6WA 3O7AA 2EA6A 2CT2A 3U5OA 2L0BA 2VPBA 2YYRA 3M99A 3HTKC 5KH3A 2Y1NA 3O70A 2ECTA 1X4UA 5LKUA 2YURA 4GB0A 3O35A 2KYUA 4IC2A 4YBMA 2LGLA 2XB1A 1MM3A 1E4UA 2PNXA 2CSYA 5B75A 2VJFB 5KH7A 4N4FA 2VP7A 1WEPA 5FB0A 4R7EA 4A4CA 2L80A 1JOCA 2E6RA 5FEYA 3QZVA 5AIUA 2F6JA 4N3WA 4LK9A 5G04B 1CHCA 1N87A 4W4UA 1WEQA 2MNZA 2M1RA 2Y43A 1HYIA 3ZNIA 5JG6A 5TRBA 3ZPVE 5H9MA 2YREA 4LADB 2L75A 2KR4A 3ZTGA 3N9PA 3U5NA 3PUQA 3KV5A 2YT5A 2ECNA 3MHHA 3PURA 3ZPV1 2MT5A 2CSZA 3O37A 4MSXA 4F52B 2H0DA 5J3XA 3RPGB 2I50A 2M85A 3LQHA 3O34A 1X4JA 2MIQA 3N9MA 2JMDA 2ECWA 4YBTA 3O33A 2EGPA 4YBSA 4LLBA 4UP5A 1XWHA 3T7LA 2YW8A 2VJEB 2M6MA 4CCGX 1F62A 1WESA 5EYAF 3KNVA 5DKAA 3GV4A 4FIPA 5B78A 4A49A 1WEEA 3N9NA 2K1JA 1RMDA 4YAXA 3PHDA 2YSMA 3ZVZB 4P5OB 2FUIA 3ASLA 2C2VS 2YHNA 4AYCB 1WENA 2L43A 5TDRA 1WILA 1WIMA 4L7XA 3HCUA 2UZGA 1Z6UA 4YABA 1LDJB 5FERA 4S3OC 2LN0A 1MM2A 3M62A 1FP0A 4ZUXU 2YHOA 2KU3A 2QICA 3C5KA 4XI1A 1WGMA 4GNGA 3U5PA 4R2YA 2CKLA 3SHBA 5I3LA 2EODA 2KWJA 4ZQLA 1G25A 4AUQB 1Z2QA 4B7YC 2PUYA 5DINA 2LXHC 2RSDA 2MA6A 2MUMA 4AP4A 5LCWB 4BHWA 2JMIA 2L5UA 4WZ0A 4NN2A 2LGGA 5FB1A 5LKZA 3U5MA 2CKLB 1V87A 2LGKA 4QF3A 3SOWA 2LXPC 2KWKA 4CA1A 2K17A 2KWOA 5TDWA 2LV9A 5B76A 2YQLA 3MHSA 3L1XA 1Z60A 3EB5A 2HYED 2OXQC 4X3GA 3LQJA 4LJNA 3ZVYA 3HCTA 2VPEA 4YATA 4AYCA 2VPGA 4C9ZA 1T1HA 4WZ2A 2KIZA 4MVTA 1WEWA 2YU4A 4AVXA 2KWNA 5TBNA 2IDAA 5LKTA 4S3OB 1U6GB 3N9OA 3RPGC 1WE9A 3L1ZB 4GNDA 3HCSA 5H1UA 2ECGA 2JRJA 3GL6A 2C2LA 3DQVR 4UP0A 3LQIA 5KH9A 4FK5A 2YQMA 4B86C 2KGGA 4TKPB 2K16A 4L58A 2LRIC 2XEUA 2H0DB 4FO9A 3ZYQA 4BBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBD B;  3EB6 A;  2HDP A;  2VPD A;  4I7B A;  3SOX A;  5D1M B;  1X4I A;  2D8S A;  1HYJ A;  2MD7 B;  3NG2 A;  2DX8 A;  5AIT A;  1FBV A;  2KRE A;  4A4B A;  3M63 A;  4O64 A;  2YSJ A;  5H1V A;  3FL2 A;  5G05 B;  1IYM A;  1LDK C;  2VJE A;  5H1T A;  4A0C D;  4FJC A;  1JM7 A;  3VK6 A;  1DVP A;  2JMJ A;  3V43 A;  2LGV A;  2KGI A;  3N9Q A;  4V3K C;  5LKX A;  2Y1M A;  4GNF A;  4I7C A;  4YC9 A;  3I2D A;  3RTR B;  2MNY A;  2M3H A;  4IC3 A;  2MD8 C;  5B8D A;  3T6R A;  2ECJ A;  2G43 A;  2K4D A;  4R8P K;  2LDR A;  2LQ6 A;  3SOU A;  2FUU A;  5D1L B;  4PPE A;  2G6Q A;  1K2F A;  4LKA A;  2F6N A;  2MA5 A;  4ZDT A;  4GNE A;  2RI7 A;  3N9L A;  3LRQ A;  3DPL R;  2QIZ A;  1WEV A;  5C11 A;  5B77 A;  2KE1 A;  3KV6 A;  4YAD A;  5TAB A;  4Q6F A;  1JM7 B;  3L11 A;  2ECI A;  1BOR A;  1VYX A;  2YUC A;  5G0F A;  2ZET C;  2FSA A;  5B79 A;  2G45 A;  4I7D A;  1WEU A;  2F42 A;  3KQI A;  2AN6 A;  5D1K B;  1VFY A;  4UI9 B;  2VNF A;  2QJ0 A;  4PTB A;  4QF2 A;  2NAA A;  2BAY A;  4V3L C;  4WA6 A;  5C13 A;  3IHP A;  2VJF A;  1WEO A;  2KFT A;  2ECV A;  3O36 A;  1WEM A;  2E6S A;  4WZ3 B;  1VD4 A;  1WFK A;  3C6W A;  3O7A A;  2EA6 A;  2CT2 A;  3U5O A;  2L0B A;  2VPB A;  2YYR A;  3M99 A;  3HTK C;  5KH3 A;  2Y1N A;  3O70 A;  2ECT A;  1X4U A;  5LKU A;  2YUR A;  4GB0 A;  3O35 A;  2KYU A;  4IC2 A;  4YBM A;  2LGL A;  2XB1 A;  1MM3 A;  1E4U A;  2PNX A;  2CSY A;  5B75 A;  2VJF B;  5KH7 A;  4N4F A;  2VP7 A;  1WEP A;  5FB0 A;  4R7E A;  4A4C A;  2L80 A;  1JOC A;  2E6R A;  5FEY A;  3QZV A;  5AIU A;  2F6J A;  4N3W A;  4LK9 A;  5G04 B;  1CHC A;  1N87 A;  4W4U A;  1WEQ A;  2MNZ A;  2M1R A;  2Y43 A;  1HYI A;  3ZNI A;  5JG6 A;  5TRB A;  3ZPV E;  5H9M A;  2YRE A;  4LAD B;  2L75 A;  2KR4 A;  3ZTG A;  3N9P A;  3U5N A;  3PUQ A;  3KV5 A;  2YT5 A;  2ECN A;  3MHH A;  3PUR A;  3ZPV 1;  2MT5 A;  2CSZ A;  3O37 A;  4MSX A;  4F52 B;  2H0D A;  5J3X A;  3RPG B;  2I50 A;  2M85 A;  3LQH A;  3O34 A;  1X4J A;  2MIQ A;  3N9M A;  2JMD A;  2ECW A;  4YBT A;  3O33 A;  2EGP A;  4YBS A;  4LLB A;  4UP5 A;  1XWH A;  3T7L A;  2YW8 A;  2VJE B;  2M6M A;  4CCG X;  1F62 A;  1WES A;  5EYA F;  3KNV A;  5DKA A;  3GV4 A;  4FIP A;  5B78 A;  4A49 A;  1WEE A;  3N9N A;  2K1J A;  1RMD A;  4YAX A;  3PHD A;  2YSM A;  3ZVZ B;  4P5O B;  2FUI A;  3ASL A;  2C2V S;  2YHN A;  4AYC B;  1WEN A;  2L43 A;  5TDR A;  1WIL A;  1WIM A;  4L7X A;  3HCU A;  2UZG A;  1Z6U A;  4YAB A;  1LDJ B;  5FER A;  4S3O C;  2LN0 A;  1MM2 A;  3M62 A;  1FP0 A;  4ZUX U;  2YHO A;  2KU3 A;  2QIC A;  3C5K A;  4XI1 A;  1WGM A;  4GNG A;  3U5P A;  4R2Y A;  2CKL A;  3SHB A;  5I3L A;  2EOD A;  2KWJ A;  4ZQL A;  1G25 A;  4AUQ B;  1Z2Q A;  4B7Y C;  2PUY A;  5DIN A;  2LXH C;  2RSD A;  2MA6 A;  2MUM A;  4AP4 A;  5LCW B;  4BHW A;  2JMI A;  2L5U A;  4WZ0 A;  4NN2 A;  2LGG A;  5FB1 A;  5LKZ A;  3U5M A;  2CKL B;  1V87 A;  2LGK A;  4QF3 A;  3SOW A;  2LXP C;  2KWK A;  4CA1 A;  2K17 A;  2KWO A;  5TDW A;  2LV9 A;  5B76 A;  2YQL A;  3MHS A;  3L1X A;  1Z60 A;  3EB5 A;  2HYE D;  2OXQ C;  4X3G A;  3LQJ A;  4LJN A;  3ZVY A;  3HCT A;  2VPE A;  4YAT A;  4AYC A;  2VPG A;  4C9Z A;  1T1H A;  4WZ2 A;  2KIZ A;  4MVT A;  1WEW A;  2YU4 A;  4AVX A;  2KWN A;  5TBN A;  2IDA A;  5LKT A;  4S3O B;  1U6G B;  3N9O A;  3RPG C;  1WE9 A;  3L1Z B;  4GND A;  3HCS A;  5H1U A;  2ECG A;  2JRJ A;  3GL6 A;  2C2L A;  3DQV R;  4UP0 A;  3LQI A;  5KH9 A;  4FK5 A;  2YQM A;  4B86 C;  2KGG A;  4TKP B;  2K16 A;  4L58 A;  2LRI C;  2XEU A;  2H0D B;  4FO9 A;  3ZYQ A;  4BBQ A; 
#chains in the Genus database with same CATH topology
 1ZBD B;  3EB6 A;  2HDP A;  4H9D A;  2VPD A;  4I7B A;  3SOX A;  3FAN A;  5D1M B;  2B0O E;  1X4I A;  2D8S A;  1HYJ A;  2MD7 B;  2CSV A;  3NG2 A;  2DX8 A;  5AIT A;  4QQ4 A;  1FBV A;  2KRE A;  4A4B A;  3M63 A;  4O64 A;  2YSJ A;  5H1V A;  2E61 A;  3FL2 A;  5G05 B;  1IYM A;  1LDK C;  2VJE A;  5H1T A;  4A0C D;  4FJC A;  1JM7 A;  3VK6 A;  5SVX A;  2CRW A;  1DVP A;  2JMJ A;  3SUB A;  3V43 A;  2LGV A;  5SVY A;  2KGI A;  3N9Q A;  4V3K C;  5LKX A;  2Y1M A;  4GNF A;  4I7C A;  4YC9 A;  3I2D A;  3RTR B;  2MNY A;  2M3H A;  4IC3 A;  3LVR E;  2XP0 A;  2MD8 C;  3O47 A;  3T6R A;  5B8D A;  2ECJ A;  2G43 A;  2K4D A;  4R8P K;  2LDR A;  2LQ6 A;  3SOU A;  2FUU A;  5D1L B;  4PPE A;  2G6Q A;  1K2F A;  3LVQ E;  4LKA A;  2F6N A;  2MA5 A;  4ZDT A;  2IQJ A;  2RR4 A;  4GNE A;  2RI7 A;  3N9L A;  3LRQ A;  5SVI B;  3DPL R;  2QIZ A;  1WEV A;  3MDB C;  5C11 A;  5B77 A;  2KE1 A;  3KV6 A;  4YAD A;  2XOY A;  1MBM A;  5TAB A;  4Q6F A;  1JM7 B;  3L11 A;  2ECI A;  2L7P A;  1BOR A;  1VYX A;  2LAU A;  2YUC A;  5G0F A;  2ZET C;  2FSA A;  5B79 A;  2G45 A;  4I7D A;  1WEU A;  2F42 A;  3KQI A;  2AN6 A;  5D1K B;  1VFY A;  4UI9 B;  2VNF A;  2QJ0 A;  4PTB A;  4QF2 A;  2NAA A;  2BAY A;  4V3L C;  4WA6 A;  5C13 A;  3IHP A;  2VJF A;  1WEO A;  2KFT A;  3PLW A;  2MKE A;  2ECV A;  3O36 A;  1WEM A;  2E6S A;  4WZ3 B;  3LDY A;  2FD4 A;  1VD4 A;  1WFK A;  3C6W A;  3O7A A;  2EA6 A;  2CT2 A;  2DSM A;  2XOZ A;  3U5O A;  2L0B A;  2VPB A;  2YYR A;  3E2D A;  4OGE A;  3M99 A;  4Z0O A;  3HTK C;  5KH3 A;  2Y1N A;  3O70 A;  2ECT A;  2OWA A;  1X4U A;  3FAO A;  5LKU A;  2YUR A;  2EXU A;  4GB0 A;  3O35 A;  2KYU A;  4IC2 A;  4YBM A;  2LGL A;  2XB1 A;  1MM3 A;  1E4U A;  2JUN A;  2P57 A;  2PNX A;  2CSY A;  5B75 A;  2VJF B;  5KH7 A;  4N4F A;  2VP7 A;  4Z0R A;  1WEP A;  5FB0 A;  4R7E A;  4A4C A;  2L80 A;  1JOC A;  2E6R A;  5FEY A;  3QZV A;  3FJU B;  5AIU A;  2F6J A;  4N3W A;  4LK9 A;  3H7H A;  5G04 B;  4F1P A;  1CHC A;  1N87 A;  4W4U A;  1WEQ A;  2MNZ A;  2M1R A;  2Y43 A;  1HYI A;  3ZNI A;  5JG6 A;  5TRB A;  2CRR A;  3KDE C;  3ZPV E;  5H9M A;  2YRE A;  4LAD B;  2L75 A;  2KR4 A;  3ZTG A;  3N9P A;  3U5N A;  3PUQ A;  3KV5 A;  2YT5 A;  2ECN A;  3MHH A;  3PUR A;  3ZPV 1;  2MT5 A;  2CSZ A;  3DDT A;  3O37 A;  4MSX A;  4F52 B;  2H0D A;  5J3X A;  3RPG B;  2I50 A;  2M85 A;  3LQH A;  3O34 A;  1X4J A;  2MIQ A;  3N9M A;  2JMD A;  2ECW A;  4YBT A;  3O33 A;  2EGP A;  4YBS A;  4LLB A;  4UP5 A;  1XWH A;  3T7L A;  2YW8 A;  2VJE B;  2M6M A;  4CCG X;  1F62 A;  1WES A;  5EYA F;  3KNV A;  5DKA A;  3GV4 A;  4FIP A;  5B78 A;  4A49 A;  1WEE A;  3N9N A;  2K1J A;  1RMD A;  3LJU X;  4YAX A;  3PHD A;  2KKX A;  2YSM A;  3ZVZ B;  4P5O B;  2FUI A;  3ASL A;  2C2V S;  2YHN A;  4AYC B;  1WEN A;  2L43 A;  5TDR A;  1WIL A;  1WIM A;  4L7X A;  3HCU A;  2UZG A;  1Z6U A;  4YAB A;  1LDJ B;  5FER A;  2KKY A;  4S3O C;  3M7K A;  2XOC A;  2LN0 A;  1MM2 A;  3M62 A;  1FP0 A;  4ZUX U;  2YHO A;  2KU3 A;  2QIC A;  3C5K A;  4XI1 A;  1WGM A;  4GNG A;  3T9K A;  3U5P A;  4R2Y A;  2CKL A;  5SVI A;  3SHB A;  5I3L A;  2EOD A;  2KWJ A;  4ZQL A;  1G25 A;  4AUQ B;  1Z2Q A;  4B7Y C;  1DCQ A;  2PUY A;  5DIN A;  2LXH C;  3FEH A;  2CON A;  2RSD A;  3JUE A;  2MA6 A;  2MUM A;  4AP4 A;  5LCW B;  4BHW A;  2D8U A;  2M13 A;  2JMI A;  2L5U A;  4WZ0 A;  4NN2 A;  2LGG A;  5FB1 A;  5LKZ A;  3U5M A;  2CKL B;  1V87 A;  2LGK A;  4QF3 A;  3SOW A;  2LXP C;  2KWK A;  4CA1 A;  2K17 A;  2KWO A;  5TDW A;  2LV9 A;  5B76 A;  2YQL A;  3MHS A;  3L1X A;  1Z60 A;  2JM3 A;  3EB5 A;  2HYE D;  2OXQ C;  4X3G A;  3LQJ A;  4LJN A;  3ZVY A;  3HCT A;  2VPE A;  4YAT A;  4AYC A;  2VPG A;  4C9Z A;  1T1H A;  2YVR A;  4WZ2 A;  3DWD A;  3Q1D A;  2KIZ A;  4MVT A;  1WEW A;  2YU4 A;  4AVX A;  2KWN A;  5TBN A;  2IDA A;  5LKT A;  4S3O B;  1U6G B;  5K3Q A;  3N9O A;  3RPG C;  1WE9 A;  3L1Z B;  4OGC A;  3FM8 C;  4O62 A;  4GND A;  3HCS A;  5H1U A;  2DJA A;  2ECG A;  2FFW A;  2EGM A;  2JRJ A;  3GL6 A;  2C2L A;  3DQV R;  4UP0 A;  3LQI A;  5KH9 A;  4FK5 A;  2YQM A;  4B86 C;  2KGG A;  4TKP B;  2K16 A;  4L58 A;  2LRI C;  2XEU A;  2H0D B;  4FO9 A;  3ZYQ A;  4BBQ A; 
#chains in the Genus database with same CATH homology
 1ZBD B;  3EB6 A;  2HDP A;  2VPD A;  4I7B A;  3SOX A;  5D1M B;  1X4I A;  2D8S A;  1HYJ A;  2MD7 B;  3NG2 A;  2DX8 A;  5AIT A;  1FBV A;  2KRE A;  4A4B A;  3M63 A;  4O64 A;  2YSJ A;  5H1V A;  3FL2 A;  5G05 B;  1IYM A;  1LDK C;  2VJE A;  5H1T A;  4A0C D;  4FJC A;  1JM7 A;  3VK6 A;  1DVP A;  2JMJ A;  3V43 A;  2LGV A;  2KGI A;  3N9Q A;  4V3K C;  5LKX A;  2Y1M A;  4GNF A;  4I7C A;  4YC9 A;  3I2D A;  3RTR B;  2MNY A;  2M3H A;  4IC3 A;  2MD8 C;  5B8D A;  3T6R A;  2ECJ A;  2G43 A;  2K4D A;  4R8P K;  2LDR A;  2LQ6 A;  3SOU A;  2FUU A;  5D1L B;  4PPE A;  2G6Q A;  1K2F A;  4LKA A;  2F6N A;  2MA5 A;  4ZDT A;  4GNE A;  2RI7 A;  3N9L A;  3LRQ A;  3DPL R;  2QIZ A;  1WEV A;  5C11 A;  5B77 A;  2KE1 A;  3KV6 A;  4YAD A;  5TAB A;  4Q6F A;  1JM7 B;  3L11 A;  2ECI A;  1BOR A;  1VYX A;  2YUC A;  5G0F A;  2ZET C;  2FSA A;  5B79 A;  2G45 A;  4I7D A;  1WEU A;  2F42 A;  3KQI A;  2AN6 A;  5D1K B;  1VFY A;  4UI9 B;  2VNF A;  2QJ0 A;  4PTB A;  4QF2 A;  2NAA A;  2BAY A;  4V3L C;  4WA6 A;  5C13 A;  3IHP A;  2VJF A;  1WEO A;  2KFT A;  2ECV A;  3O36 A;  1WEM A;  2E6S A;  4WZ3 B;  1VD4 A;  1WFK A;  3C6W A;  3O7A A;  2EA6 A;  2CT2 A;  3U5O A;  2L0B A;  2VPB A;  2YYR A;  3M99 A;  3HTK C;  5KH3 A;  2Y1N A;  3O70 A;  2ECT A;  1X4U A;  5LKU A;  2YUR A;  4GB0 A;  3O35 A;  2KYU A;  4IC2 A;  4YBM A;  2LGL A;  2XB1 A;  1MM3 A;  1E4U A;  2PNX A;  2CSY A;  5B75 A;  2VJF B;  5KH7 A;  4N4F A;  2VP7 A;  1WEP A;  5FB0 A;  4R7E A;  4A4C A;  2L80 A;  1JOC A;  2E6R A;  5FEY A;  3QZV A;  5AIU A;  2F6J A;  4N3W A;  4LK9 A;  5G04 B;  1CHC A;  1N87 A;  4W4U A;  1WEQ A;  2MNZ A;  2M1R A;  2Y43 A;  1HYI A;  3ZNI A;  5JG6 A;  5TRB A;  3ZPV E;  5H9M A;  2YRE A;  4LAD B;  2L75 A;  2KR4 A;  3ZTG A;  3N9P A;  3U5N A;  3PUQ A;  3KV5 A;  2YT5 A;  2ECN A;  3MHH A;  3PUR A;  3ZPV 1;  2MT5 A;  2CSZ A;  3O37 A;  4MSX A;  4F52 B;  2H0D A;  5J3X A;  3RPG B;  2I50 A;  2M85 A;  3LQH A;  3O34 A;  1X4J A;  2MIQ A;  3N9M A;  2JMD A;  2ECW A;  4YBT A;  3O33 A;  2EGP A;  4YBS A;  4LLB A;  4UP5 A;  1XWH A;  3T7L A;  2YW8 A;  2VJE B;  2M6M A;  4CCG X;  1F62 A;  1WES A;  5EYA F;  3KNV A;  5DKA A;  3GV4 A;  4FIP A;  5B78 A;  4A49 A;  1WEE A;  3N9N A;  2K1J A;  1RMD A;  4YAX A;  3PHD A;  2YSM A;  3ZVZ B;  4P5O B;  2FUI A;  3ASL A;  2C2V S;  2YHN A;  4AYC B;  1WEN A;  2L43 A;  5TDR A;  1WIL A;  1WIM A;  4L7X A;  3HCU A;  2UZG A;  1Z6U A;  4YAB A;  1LDJ B;  5FER A;  4S3O C;  2LN0 A;  1MM2 A;  3M62 A;  1FP0 A;  4ZUX U;  2YHO A;  2KU3 A;  2QIC A;  3C5K A;  4XI1 A;  1WGM A;  4GNG A;  3U5P A;  4R2Y A;  2CKL A;  3SHB A;  5I3L A;  2EOD A;  2KWJ A;  4ZQL A;  1G25 A;  4AUQ B;  1Z2Q A;  4B7Y C;  2PUY A;  5DIN A;  2LXH C;  2RSD A;  2MA6 A;  2MUM A;  4AP4 A;  5LCW B;  4BHW A;  2JMI A;  2L5U A;  4WZ0 A;  4NN2 A;  2LGG A;  5FB1 A;  5LKZ A;  3U5M A;  2CKL B;  1V87 A;  2LGK A;  4QF3 A;  3SOW A;  2LXP C;  2KWK A;  4CA1 A;  2K17 A;  2KWO A;  5TDW A;  2LV9 A;  5B76 A;  2YQL A;  3MHS A;  3L1X A;  1Z60 A;  3EB5 A;  2HYE D;  2OXQ C;  4X3G A;  3LQJ A;  4LJN A;  3ZVY A;  3HCT A;  2VPE A;  4YAT A;  4AYC A;  2VPG A;  4C9Z A;  1T1H A;  4WZ2 A;  2KIZ A;  4MVT A;  1WEW A;  2YU4 A;  4AVX A;  2KWN A;  5TBN A;  2IDA A;  5LKT A;  4S3O B;  1U6G B;  3N9O A;  3RPG C;  1WE9 A;  3L1Z B;  4GND A;  3HCS A;  5H1U A;  2ECG A;  2JRJ A;  3GL6 A;  2C2L A;  3DQV R;  4UP0 A;  3LQI A;  5KH9 A;  4FK5 A;  2YQM A;  4B86 C;  2KGG A;  4TKP B;  2K16 A;  4L58 A;  2LRI C;  2XEU A;  2H0D B;  4FO9 A;  3ZYQ A;  4BBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...