3KQIA

Crystal structure of phf2 phd domain complexed with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'GSMATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 2
publication title Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kqiA00
1VFYA 2L5UA 2ECVA 2H0DA 3RPGC 3O33A 2MA6A 2MT5A 2FSAA 3M99A 3EB6A 2VPGA 5G05B 2YT5A 2VP7A 5KH9A 3L1ZB 2KR4A 5FEYA 2VNFA 2YURA 4WZ2A 1VD4A 2M3HA 4YBSA 4P5OB 1LDKC 3N9PA 4QF2A 4W4UA 5B77A 2XB1A 2G43A 1CHCA 1WFKA 4FO9A 1N87A 1WE9A 2D8SA 4UI9B 1E4UA 4MVTA 2KYUA 4GB0A 2M85A 2CKLA 4A4CA 2YHOA 1IYMA 5D1LB 3HCTA 2YQLA 3SOWA 2HYED 5B78A 3N9QA 4B7YC 3ZVYA 2BAYA 4A49A 4TKPB 2PUYA 2VJFA 2JMJA 3VK6A 3ZPV1 2G45A 2EGPA 4AP4A 5B76A 2LGVA 5H1UA 2MD7B 2YHNA 2VJEB 5H1TA 3MHSA 4X3GA 2KWNA 5FB0A 3N9LA 4IC2A 4L58A 2MD8C 1Z6UA 4PPEA 2ECIA 4NN2A 5TDRA 3IHPA 2LV9A 2QIZA 1JM7B 1WEPA 2KIZA 1Z60A 3SHBA 4WZ3B 2KWJA 2L0BA 3U5NA 2YSMA 2C2VS 1T1HA 3DPLR 1WGMA 4GNFA 2K17A 3V43A 4YATA 4GNGA 1F62A 3HCUA 5LKTA 5LKUA 4LLBA 2CSYA 4L7XA 1WENA 2ECGA 3N9MA 4FJCA 4FK5A 2E6SA 1WEOA 2CT2A 1VYXA 2YQMA 1X4JA 5H1VA 2LGLA 2KGIA 2M1RA 1ZBDB 2C2LA 3PHDA 2RI7A 3HCSA 1WEVA 2YREA 1WIMA 2MIQA 5DKAA 2ECNA 2KWKA 4MSXA 1MM2A 4PTBA 2MUMA 1U6GB 4I7CA 5FB1A 5B75A 4LKAA 3T6RA 3DQVR 4F52B 4LK9A 2F42A 2FUUA 1WEWA 5LKXA 2LRIC 2VPEA 3U5OA 1JM7A 4AUQB 1XWHA 4I7BA 2LXPC 4QF3A 4AVXA 5AITA 2Y1NA 5LKZA 5KH7A 3C6WA 2YW8A 1BORA 1FP0A 2EA6A 4YBTA 5EYAF 3LQJA 1WEMA 2YU4A 5TRBA 3RPGB 3M63A 4Q6FA 4V3KC 5DINA 5D1KB 2VPDA 4UP5A 4A4BA 3ZNIA 4XI1A 3PUQA 1HYJA 2L80A 2DX8A 3O36A 2KWOA 4R2YA 1G25A 2IDAA 4BBQA 2F6JA 2LN0A 1DVPA 3O37A 1X4IA 4ZQLA 4I7DA 4N3WA 4LJNA 2YYRA 4R7EA 4S3OB 1K2FA 4A0CD 5J3XA 5TDWA 3O70A 1WILA 4C9ZA 2LQ6A 3C5KA 3SOUA 4GNDA 1Z2QA 3LQIA 1V87A 3T7LA 2ECWA 2JMIA 2VPBA 3U5MA 2I50A 3L11A 1WEQA 2KU3A 4UP0A 5JG6A 4LADB 1WEEA 2KFTA 5AIUA 3SOXA 4YBMA 1HYIA 5LCWB 5B79A 3L1XA 2YSJA 4WA6A 2XEUA 4YC9A 4BHWA 5G04B 2KREA 2L43A 4O64A 3RTRB 4AYCB 3GL6A 1WESA 3EB5A 4V3LC 2FUIA 3ZVZB 3KNVA 2G6QA 3KQIA 2AN6A 2VJEA 4CA1A 3ZYQA 2LGKA 2LGGA 4CCGX 3ZPVE 1MM3A 3O7AA 2KGGA 2QICA 5I3LA 2PNXA 2ECTA 2H0DB 3PURA 2YUCA 1RMDA 4S3OC 2K16A 3GV4A 3U5PA 4IC3A 3O35A 3N9OA 3O34A 5H9MA 3N9NA 1JOCA 4WZ0A 3M62A 3LRQA 2F6NA 2LXHC 2MNYA 2EODA 5KH3A 3HTKC 4GNEA 4FIPA 4YABA 5TABA 2MNZA 2ZETC 2LDRA 5C13A 4R8PK 2JRJA 1WEUA 2ECJA 5G0FA 2CKLB 2M6MA 2L75A 3I2DA 2OXQC 1X4UA 3MHHA 2RSDA 3KV5A 3NG2A 5C11A 5D1MB 4N4FA 1LDJB 4YADA 3FL2A 3ZTGA 5TBNA 4B86C 2JMDA 2VJFB 4ZDTA 5FERA 2KE1A 5B8DA 2NAAA 4AYCA 2MA5A 2CSZA 3LQHA 2Y43A 1FBVA 2HDPA 4YAXA 2QJ0A 2E6RA 2K4DA 3ASLA 3QZVA 2K1JA 2UZGA 4ZUXU 3KV6A 2Y1MA
chains in the Genus database with same CATH superfamily
1VFYA 2DSMA 2L5UA 2ECVA 1MBMA 2H0DA 3RPGC 3O33A 2MA6A 2MT5A 2FSAA 3M99A 3EB6A 2VPGA 4O62A 5G05B 2YT5A 2VP7A 5KH9A 3L1ZB 2KR4A 5FEYA 2VNFA 2YURA 4WZ2A 3O47A 1VD4A 2M3HA 4YBSA 4P5OB 1LDKC 3N9PA 4QF2A 4W4UA 5B77A 2XB1A 2G43A 4H9DA 1CHCA 1WFKA 3FM8C 4FO9A 3DWDA 1N87A 1WE9A 2D8SA 4UI9B 1E4UA 4MVTA 2KYUA 4GB0A 2M85A 2CKLA 4A4CA 2YHOA 1IYMA 5D1LB 3HCTA 2YQLA 3SOWA 2HYED 5B78A 3N9QA 4B7YC 3ZVYA 2BAYA 4A49A 4TKPB 2PUYA 2LAUA 3H7HA 2VJFA 5SVYA 2JMJA 3VK6A 3ZPV1 2G45A 2EGPA 4AP4A 5B76A 3LVQE 2LGVA 5H1UA 2MD7B 2YHNA 2CONA 2VJEB 5H1TA 3MHSA 2MKEA 3Q1DA 4X3GA 2KWNA 5FB0A 3N9LA 4IC2A 4L58A 2XOZA 2MD8C 1Z6UA 4PPEA 2ECIA 4NN2A 5TDRA 3IHPA 2LV9A 2QIZA 1JM7B 1WEPA 2KIZA 1Z60A 3SHBA 4WZ3B 2JUNA 2KWJA 2L0BA 3U5NA 2YSMA 2C2VS 1T1HA 3DPLR 1WGMA 4GNFA 2CSVA 2K17A 3V43A 4YATA 4GNGA 1F62A 3HCUA 5LKTA 5LKUA 4LLBA 2CSYA 4L7XA 3MDBC 4QQ4A 1WENA 2ECGA 3N9MA 4FJCA 4FK5A 1DCQA 2E6SA 2OWAA 1WEOA 2CT2A 3LDYA 1VYXA 2JM3A 2YQMA 1X4JA 5H1VA 2LGLA 5SVXA 2KGIA 2M1RA 1ZBDB 2C2LA 3PHDA 2RI7A 4Z0RA 3HCSA 1WEVA 2YREA 1WIMA 2DJAA 2KKYA 2MIQA 5DKAA 2ECNA 2KWKA 3FJUB 4MSXA 1MM2A 2XP0A 4PTBA 3JUEA 2MUMA 1U6GB 3LJUX 4I7CA 4OGCA 5FB1A 5B75A 4LKAA 3T6RA 2D8UA 3DQVR 4F52B 4LK9A 2F42A 2FUUA 1WEWA 5LKXA 2E61A 2LRIC 2VPEA 2RR4A 3U5OA 1JM7A 4AUQB 1XWHA 4I7BA 2LXPC 4QF3A 4AVXA 2M13A 5AITA 2Y1NA 5LKZA 5KH7A 3C6WA 2YW8A 1BORA 1FP0A 3SUBA 2EA6A 4YBTA 5EYAF 3LQJA 4OGEA 1WEMA 2YU4A 5TRBA 3RPGB 3M63A 2EGMA 4Q6FA 4V3KC 5D1KB 5DINA 5SVIB 2VPDA 4UP5A 4A4BA 3ZNIA 4XI1A 3PUQA 2KKXA 1HYJA 2L80A 2DX8A 3O36A 2KWOA 2XOCA 4R2YA 1G25A 2IDAA 4BBQA 2F6JA 2LN0A 1DVPA 3O37A 2IQJA 1X4IA 2FD4A 3E2DA 4ZQLA 2L7PA 4I7DA 4N3WA 4LJNA 2YYRA 4R7EA 4S3OB 1K2FA 4A0CD 5J3XA 5TDWA 3O70A 1WILA 4C9ZA 2LQ6A 3C5KA 3SOUA 4GNDA 2P57A 1Z2QA 3LQIA 1V87A 3T7LA 2ECWA 2JMIA 2VPBA 3U5MA 2I50A 3L11A 1WEQA 2KU3A 4UP0A 5JG6A 4LADB 1WEEA 2KFTA 5AIUA 3SOXA 4YBMA 3FANA 1HYIA 5LCWB 5B79A 3L1XA 2YSJA 4WA6A 2XEUA 4YC9A 4BHWA 5G04B 3M7KA 2KREA 2L43A 4O64A 3RTRB 4AYCB 3GL6A 1WESA 3EB5A 3PLWA 4V3LC 5K3QA 2CRWA 2FUIA 3ZVZB 3KNVA 2G6QA 3KQIA 2AN6A 2VJEA 4CA1A 3ZYQA 2LGKA 3LVRE 2LGGA 4CCGX 2CRRA 3ZPVE 1MM3A 3O7AA 2KGGA 2QICA 5I3LA 2PNXA 2ECTA 2H0DB 5SVIA 3PURA 2YUCA 1RMDA 4S3OC 2K16A 3GV4A 3U5PA 4IC3A 3O35A 3N9OA 3O34A 5H9MA 3T9KA 3N9NA 1JOCA 4F1PA 4WZ0A 3M62A 3LRQA 3DDTA 2YVRA 2F6NA 2B0OE 2LXHC 2MNYA 2EODA 5KH3A 3HTKC 4GNEA 4Z0OA 4FIPA 4YABA 5TABA 2XOYA 2MNZA 2ZETC 2LDRA 5C13A 4R8PK 2JRJA 1WEUA 2ECJA 5G0FA 2CKLB 2M6MA 2L75A 3I2DA 2OXQC 1X4UA 3MHHA 2RSDA 3KV5A 3FEHA 3FAOA 3NG2A 5C11A 5D1MB 4N4FA 1LDJB 4YADA 3FL2A 3ZTGA 5TBNA 4B86C 2JMDA 2VJFB 4ZDTA 5FERA 2FFWA 2KE1A 5B8DA 2NAAA 4AYCA 2MA5A 2CSZA 3LQHA 2Y43A 1FBVA 2EXUA 3KDEC 2HDPA 4YAXA 2QJ0A 2E6RA 2K4DA 3ASLA 3QZVA 2K1JA 2UZGA 4ZUXU 3KV6A 2Y1MA
chains in the Genus database with same CATH topology
1VFYA 2L5UA 2ECVA 2H0DA 3RPGC 3O33A 2MA6A 2MT5A 2FSAA 3M99A 3EB6A 2VPGA 5G05B 2YT5A 2VP7A 5KH9A 3L1ZB 2KR4A 5FEYA 2VNFA 2YURA 4WZ2A 1VD4A 2M3HA 4YBSA 4P5OB 1LDKC 3N9PA 4QF2A 4W4UA 5B77A 2XB1A 2G43A 1CHCA 1WFKA 4FO9A 1N87A 1WE9A 2D8SA 4UI9B 1E4UA 4MVTA 2KYUA 4GB0A 2M85A 2CKLA 4A4CA 2YHOA 1IYMA 5D1LB 3HCTA 2YQLA 3SOWA 2HYED 5B78A 3N9QA 4B7YC 3ZVYA 2BAYA 4A49A 4TKPB 2PUYA 2VJFA 2JMJA 3VK6A 3ZPV1 2G45A 2EGPA 4AP4A 5B76A 2LGVA 5H1UA 2MD7B 2YHNA 2VJEB 5H1TA 3MHSA 4X3GA 2KWNA 5FB0A 3N9LA 4IC2A 4L58A 2MD8C 1Z6UA 4PPEA 2ECIA 4NN2A 5TDRA 3IHPA 2LV9A 2QIZA 1JM7B 1WEPA 2KIZA 1Z60A 3SHBA 4WZ3B 2KWJA 2L0BA 3U5NA 2YSMA 2C2VS 1T1HA 3DPLR 1WGMA 4GNFA 2K17A 3V43A 4YATA 4GNGA 1F62A 3HCUA 5LKTA 5LKUA 4LLBA 2CSYA 4L7XA 1WENA 2ECGA 3N9MA 4FJCA 4FK5A 2E6SA 1WEOA 2CT2A 1VYXA 2YQMA 1X4JA 5H1VA 2LGLA 2KGIA 2M1RA 1ZBDB 2C2LA 3PHDA 2RI7A 3HCSA 1WEVA 2YREA 1WIMA 2MIQA 5DKAA 2ECNA 2KWKA 4MSXA 1MM2A 4PTBA 2MUMA 1U6GB 4I7CA 5FB1A 5B75A 4LKAA 3T6RA 3DQVR 4F52B 4LK9A 2F42A 2FUUA 1WEWA 5LKXA 2LRIC 2VPEA 3U5OA 1JM7A 4AUQB 1XWHA 4I7BA 2LXPC 4QF3A 4AVXA 5AITA 2Y1NA 5LKZA 5KH7A 3C6WA 2YW8A 1BORA 1FP0A 2EA6A 4YBTA 5EYAF 3LQJA 1WEMA 2YU4A 5TRBA 3RPGB 3M63A 4Q6FA 4V3KC 5DINA 5D1KB 2VPDA 4UP5A 4A4BA 3ZNIA 4XI1A 3PUQA 1HYJA 2L80A 2DX8A 3O36A 2KWOA 4R2YA 1G25A 2IDAA 4BBQA 2F6JA 2LN0A 1DVPA 3O37A 1X4IA 4ZQLA 4I7DA 4N3WA 4LJNA 2YYRA 4R7EA 4S3OB 1K2FA 4A0CD 5J3XA 5TDWA 3O70A 1WILA 4C9ZA 2LQ6A 3C5KA 3SOUA 4GNDA 1Z2QA 3LQIA 1V87A 3T7LA 2ECWA 2JMIA 2VPBA 3U5MA 2I50A 3L11A 1WEQA 2KU3A 4UP0A 5JG6A 4LADB 1WEEA 2KFTA 5AIUA 3SOXA 4YBMA 1HYIA 5LCWB 5B79A 3L1XA 2YSJA 4WA6A 2XEUA 4YC9A 4BHWA 5G04B 2KREA 2L43A 4O64A 3RTRB 4AYCB 3GL6A 1WESA 3EB5A 4V3LC 2FUIA 3ZVZB 3KNVA 2G6QA 3KQIA 2AN6A 2VJEA 4CA1A 3ZYQA 2LGKA 2LGGA 4CCGX 3ZPVE 1MM3A 3O7AA 2KGGA 2QICA 5I3LA 2PNXA 2ECTA 2H0DB 3PURA 2YUCA 1RMDA 4S3OC 2K16A 3GV4A 3U5PA 4IC3A 3O35A 3N9OA 3O34A 5H9MA 3N9NA 1JOCA 4WZ0A 3M62A 3LRQA 2F6NA 2LXHC 2MNYA 2EODA 5KH3A 3HTKC 4GNEA 4FIPA 4YABA 5TABA 2MNZA 2ZETC 2LDRA 5C13A 4R8PK 2JRJA 1WEUA 2ECJA 5G0FA 2CKLB 2M6MA 2L75A 3I2DA 2OXQC 1X4UA 3MHHA 2RSDA 3KV5A 3NG2A 5C11A 5D1MB 4N4FA 1LDJB 4YADA 3FL2A 3ZTGA 5TBNA 4B86C 2JMDA 2VJFB 4ZDTA 5FERA 2KE1A 5B8DA 2NAAA 4AYCA 2MA5A 2CSZA 3LQHA 2Y43A 1FBVA 2HDPA 4YAXA 2QJ0A 2E6RA 2K4DA 3ASLA 3QZVA 2K1JA 2UZGA 4ZUXU 3KV6A 2Y1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFY A;  2L5U A;  2ECV A;  2H0D A;  3RPG C;  3O33 A;  2MA6 A;  2MT5 A;  2FSA A;  3M99 A;  3EB6 A;  2VPG A;  5G05 B;  2YT5 A;  2VP7 A;  5KH9 A;  3L1Z B;  2KR4 A;  5FEY A;  2VNF A;  2YUR A;  4WZ2 A;  1VD4 A;  2M3H A;  4YBS A;  4P5O B;  1LDK C;  3N9P A;  4QF2 A;  4W4U A;  5B77 A;  2XB1 A;  2G43 A;  1CHC A;  1WFK A;  4FO9 A;  1N87 A;  1WE9 A;  2D8S A;  4UI9 B;  1E4U A;  4MVT A;  2KYU A;  4GB0 A;  2M85 A;  2CKL A;  4A4C A;  2YHO A;  1IYM A;  5D1L B;  3HCT A;  2YQL A;  3SOW A;  2HYE D;  5B78 A;  3N9Q A;  4B7Y C;  3ZVY A;  2BAY A;  4A49 A;  4TKP B;  2PUY A;  2VJF A;  2JMJ A;  3VK6 A;  3ZPV 1;  2G45 A;  2EGP A;  4AP4 A;  5B76 A;  2LGV A;  5H1U A;  2MD7 B;  2YHN A;  2VJE B;  5H1T A;  3MHS A;  4X3G A;  2KWN A;  5FB0 A;  3N9L A;  4IC2 A;  4L58 A;  2MD8 C;  1Z6U A;  4PPE A;  2ECI A;  4NN2 A;  5TDR A;  3IHP A;  2LV9 A;  2QIZ A;  1JM7 B;  1WEP A;  2KIZ A;  1Z60 A;  3SHB A;  4WZ3 B;  2KWJ A;  2L0B A;  3U5N A;  2YSM A;  2C2V S;  1T1H A;  3DPL R;  1WGM A;  4GNF A;  2K17 A;  3V43 A;  4YAT A;  4GNG A;  1F62 A;  3HCU A;  5LKT A;  5LKU A;  4LLB A;  2CSY A;  4L7X A;  1WEN A;  2ECG A;  3N9M A;  4FJC A;  4FK5 A;  2E6S A;  1WEO A;  2CT2 A;  1VYX A;  2YQM A;  1X4J A;  5H1V A;  2LGL A;  2KGI A;  2M1R A;  1ZBD B;  2C2L A;  3PHD A;  2RI7 A;  3HCS A;  1WEV A;  2YRE A;  1WIM A;  2MIQ A;  5DKA A;  2ECN A;  2KWK A;  4MSX A;  1MM2 A;  4PTB A;  2MUM A;  1U6G B;  4I7C A;  5FB1 A;  5B75 A;  4LKA A;  3T6R A;  3DQV R;  4F52 B;  4LK9 A;  2F42 A;  2FUU A;  1WEW A;  5LKX A;  2LRI C;  2VPE A;  3U5O A;  1JM7 A;  4AUQ B;  1XWH A;  4I7B A;  2LXP C;  4QF3 A;  4AVX A;  5AIT A;  2Y1N A;  5LKZ A;  5KH7 A;  3C6W A;  2YW8 A;  1BOR A;  1FP0 A;  2EA6 A;  4YBT A;  5EYA F;  3LQJ A;  1WEM A;  2YU4 A;  5TRB A;  3RPG B;  3M63 A;  4Q6F A;  4V3K C;  5DIN A;  5D1K B;  2VPD A;  4UP5 A;  4A4B A;  3ZNI A;  4XI1 A;  3PUQ A;  1HYJ A;  2L80 A;  2DX8 A;  3O36 A;  2KWO A;  4R2Y A;  1G25 A;  2IDA A;  4BBQ A;  2F6J A;  2LN0 A;  1DVP A;  3O37 A;  1X4I A;  4ZQL A;  4I7D A;  4N3W A;  4LJN A;  2YYR A;  4R7E A;  4S3O B;  1K2F A;  4A0C D;  5J3X A;  5TDW A;  3O70 A;  1WIL A;  4C9Z A;  2LQ6 A;  3C5K A;  3SOU A;  4GND A;  1Z2Q A;  3LQI A;  1V87 A;  3T7L A;  2ECW A;  2JMI A;  2VPB A;  3U5M A;  2I50 A;  3L11 A;  1WEQ A;  2KU3 A;  4UP0 A;  5JG6 A;  4LAD B;  1WEE A;  2KFT A;  5AIU A;  3SOX A;  4YBM A;  1HYI A;  5LCW B;  5B79 A;  3L1X A;  2YSJ A;  4WA6 A;  2XEU A;  4YC9 A;  4BHW A;  5G04 B;  2KRE A;  2L43 A;  4O64 A;  3RTR B;  4AYC B;  3GL6 A;  1WES A;  3EB5 A;  4V3L C;  2FUI A;  3ZVZ B;  3KNV A;  2G6Q A;  3KQI A;  2AN6 A;  2VJE A;  4CA1 A;  3ZYQ A;  2LGK A;  2LGG A;  4CCG X;  3ZPV E;  1MM3 A;  3O7A A;  2KGG A;  2QIC A;  5I3L A;  2PNX A;  2ECT A;  2H0D B;  3PUR A;  2YUC A;  1RMD A;  4S3O C;  2K16 A;  3GV4 A;  3U5P A;  4IC3 A;  3O35 A;  3N9O A;  3O34 A;  5H9M A;  3N9N A;  1JOC A;  4WZ0 A;  3M62 A;  3LRQ A;  2F6N A;  2LXH C;  2MNY A;  2EOD A;  5KH3 A;  3HTK C;  4GNE A;  4FIP A;  4YAB A;  5TAB A;  2MNZ A;  2ZET C;  2LDR A;  5C13 A;  4R8P K;  2JRJ A;  1WEU A;  2ECJ A;  5G0F A;  2CKL B;  2M6M A;  2L75 A;  3I2D A;  2OXQ C;  1X4U A;  3MHH A;  2RSD A;  3KV5 A;  3NG2 A;  5C11 A;  5D1M B;  4N4F A;  1LDJ B;  4YAD A;  3FL2 A;  3ZTG A;  5TBN A;  4B86 C;  2JMD A;  2VJF B;  4ZDT A;  5FER A;  2KE1 A;  5B8D A;  2NAA A;  4AYC A;  2MA5 A;  2CSZ A;  3LQH A;  2Y43 A;  1FBV A;  2HDP A;  4YAX A;  2QJ0 A;  2E6R A;  2K4D A;  3ASL A;  3QZV A;  2K1J A;  2UZG A;  4ZUX U;  3KV6 A;  2Y1M A; 
#chains in the Genus database with same CATH topology
 1VFY A;  2DSM A;  2L5U A;  2ECV A;  1MBM A;  2H0D A;  3RPG C;  3O33 A;  2MA6 A;  2MT5 A;  2FSA A;  3M99 A;  3EB6 A;  2VPG A;  4O62 A;  5G05 B;  2YT5 A;  2VP7 A;  5KH9 A;  3L1Z B;  2KR4 A;  5FEY A;  2VNF A;  2YUR A;  4WZ2 A;  3O47 A;  1VD4 A;  2M3H A;  4YBS A;  4P5O B;  1LDK C;  3N9P A;  4QF2 A;  4W4U A;  5B77 A;  2XB1 A;  2G43 A;  4H9D A;  1CHC A;  1WFK A;  3FM8 C;  4FO9 A;  3DWD A;  1N87 A;  1WE9 A;  2D8S A;  4UI9 B;  1E4U A;  4MVT A;  2KYU A;  4GB0 A;  2M85 A;  2CKL A;  4A4C A;  2YHO A;  1IYM A;  5D1L B;  3HCT A;  2YQL A;  3SOW A;  2HYE D;  5B78 A;  3N9Q A;  4B7Y C;  3ZVY A;  2BAY A;  4A49 A;  4TKP B;  2PUY A;  2LAU A;  3H7H A;  2VJF A;  5SVY A;  2JMJ A;  3VK6 A;  3ZPV 1;  2G45 A;  2EGP A;  4AP4 A;  5B76 A;  3LVQ E;  2LGV A;  5H1U A;  2MD7 B;  2YHN A;  2CON A;  2VJE B;  5H1T A;  3MHS A;  2MKE A;  3Q1D A;  4X3G A;  2KWN A;  5FB0 A;  3N9L A;  4IC2 A;  4L58 A;  2XOZ A;  2MD8 C;  1Z6U A;  4PPE A;  2ECI A;  4NN2 A;  5TDR A;  3IHP A;  2LV9 A;  2QIZ A;  1JM7 B;  1WEP A;  2KIZ A;  1Z60 A;  3SHB A;  4WZ3 B;  2JUN A;  2KWJ A;  2L0B A;  3U5N A;  2YSM A;  2C2V S;  1T1H A;  3DPL R;  1WGM A;  4GNF A;  2CSV A;  2K17 A;  3V43 A;  4YAT A;  4GNG A;  1F62 A;  3HCU A;  5LKT A;  5LKU A;  4LLB A;  2CSY A;  4L7X A;  3MDB C;  4QQ4 A;  1WEN A;  2ECG A;  3N9M A;  4FJC A;  4FK5 A;  1DCQ A;  2E6S A;  2OWA A;  1WEO A;  2CT2 A;  3LDY A;  1VYX A;  2JM3 A;  2YQM A;  1X4J A;  5H1V A;  2LGL A;  5SVX A;  2KGI A;  2M1R A;  1ZBD B;  2C2L A;  3PHD A;  2RI7 A;  4Z0R A;  3HCS A;  1WEV A;  2YRE A;  1WIM A;  2DJA A;  2KKY A;  2MIQ A;  5DKA A;  2ECN A;  2KWK A;  3FJU B;  4MSX A;  1MM2 A;  2XP0 A;  4PTB A;  3JUE A;  2MUM A;  1U6G B;  3LJU X;  4I7C A;  4OGC A;  5FB1 A;  5B75 A;  4LKA A;  3T6R A;  2D8U A;  3DQV R;  4F52 B;  4LK9 A;  2F42 A;  2FUU A;  1WEW A;  5LKX A;  2E61 A;  2LRI C;  2VPE A;  2RR4 A;  3U5O A;  1JM7 A;  4AUQ B;  1XWH A;  4I7B A;  2LXP C;  4QF3 A;  4AVX A;  2M13 A;  5AIT A;  2Y1N A;  5LKZ A;  5KH7 A;  3C6W A;  2YW8 A;  1BOR A;  1FP0 A;  3SUB A;  2EA6 A;  4YBT A;  5EYA F;  3LQJ A;  4OGE A;  1WEM A;  2YU4 A;  5TRB A;  3RPG B;  3M63 A;  2EGM A;  4Q6F A;  4V3K C;  5D1K B;  5DIN A;  5SVI B;  2VPD A;  4UP5 A;  4A4B A;  3ZNI A;  4XI1 A;  3PUQ A;  2KKX A;  1HYJ A;  2L80 A;  2DX8 A;  3O36 A;  2KWO A;  2XOC A;  4R2Y A;  1G25 A;  2IDA A;  4BBQ A;  2F6J A;  2LN0 A;  1DVP A;  3O37 A;  2IQJ A;  1X4I A;  2FD4 A;  3E2D A;  4ZQL A;  2L7P A;  4I7D A;  4N3W A;  4LJN A;  2YYR A;  4R7E A;  4S3O B;  1K2F A;  4A0C D;  5J3X A;  5TDW A;  3O70 A;  1WIL A;  4C9Z A;  2LQ6 A;  3C5K A;  3SOU A;  4GND A;  2P57 A;  1Z2Q A;  3LQI A;  1V87 A;  3T7L A;  2ECW A;  2JMI A;  2VPB A;  3U5M A;  2I50 A;  3L11 A;  1WEQ A;  2KU3 A;  4UP0 A;  5JG6 A;  4LAD B;  1WEE A;  2KFT A;  5AIU A;  3SOX A;  4YBM A;  3FAN A;  1HYI A;  5LCW B;  5B79 A;  3L1X A;  2YSJ A;  4WA6 A;  2XEU A;  4YC9 A;  4BHW A;  5G04 B;  3M7K A;  2KRE A;  2L43 A;  4O64 A;  3RTR B;  4AYC B;  3GL6 A;  1WES A;  3EB5 A;  3PLW A;  4V3L C;  5K3Q A;  2CRW A;  2FUI A;  3ZVZ B;  3KNV A;  2G6Q A;  3KQI A;  2AN6 A;  2VJE A;  4CA1 A;  3ZYQ A;  2LGK A;  3LVR E;  2LGG A;  4CCG X;  2CRR A;  3ZPV E;  1MM3 A;  3O7A A;  2KGG A;  2QIC A;  5I3L A;  2PNX A;  2ECT A;  2H0D B;  5SVI A;  3PUR A;  2YUC A;  1RMD A;  4S3O C;  2K16 A;  3GV4 A;  3U5P A;  4IC3 A;  3O35 A;  3N9O A;  3O34 A;  5H9M A;  3T9K A;  3N9N A;  1JOC A;  4F1P A;  4WZ0 A;  3M62 A;  3LRQ A;  3DDT A;  2YVR A;  2F6N A;  2B0O E;  2LXH C;  2MNY A;  2EOD A;  5KH3 A;  3HTK C;  4GNE A;  4Z0O A;  4FIP A;  4YAB A;  5TAB A;  2XOY A;  2MNZ A;  2ZET C;  2LDR A;  5C13 A;  4R8P K;  2JRJ A;  1WEU A;  2ECJ A;  5G0F A;  2CKL B;  2M6M A;  2L75 A;  3I2D A;  2OXQ C;  1X4U A;  3MHH A;  2RSD A;  3KV5 A;  3FEH A;  3FAO A;  3NG2 A;  5C11 A;  5D1M B;  4N4F A;  1LDJ B;  4YAD A;  3FL2 A;  3ZTG A;  5TBN A;  4B86 C;  2JMD A;  2VJF B;  4ZDT A;  5FER A;  2FFW A;  2KE1 A;  5B8D A;  2NAA A;  4AYC A;  2MA5 A;  2CSZ A;  3LQH A;  2Y43 A;  1FBV A;  2EXU A;  3KDE C;  2HDP A;  4YAX A;  2QJ0 A;  2E6R A;  2K4D A;  3ASL A;  3QZV A;  2K1J A;  2UZG A;  4ZUX U;  3KV6 A;  2Y1M A; 
#chains in the Genus database with same CATH homology
 1VFY A;  2L5U A;  2ECV A;  2H0D A;  3RPG C;  3O33 A;  2MA6 A;  2MT5 A;  2FSA A;  3M99 A;  3EB6 A;  2VPG A;  5G05 B;  2YT5 A;  2VP7 A;  5KH9 A;  3L1Z B;  2KR4 A;  5FEY A;  2VNF A;  2YUR A;  4WZ2 A;  1VD4 A;  2M3H A;  4YBS A;  4P5O B;  1LDK C;  3N9P A;  4QF2 A;  4W4U A;  5B77 A;  2XB1 A;  2G43 A;  1CHC A;  1WFK A;  4FO9 A;  1N87 A;  1WE9 A;  2D8S A;  4UI9 B;  1E4U A;  4MVT A;  2KYU A;  4GB0 A;  2M85 A;  2CKL A;  4A4C A;  2YHO A;  1IYM A;  5D1L B;  3HCT A;  2YQL A;  3SOW A;  2HYE D;  5B78 A;  3N9Q A;  4B7Y C;  3ZVY A;  2BAY A;  4A49 A;  4TKP B;  2PUY A;  2VJF A;  2JMJ A;  3VK6 A;  3ZPV 1;  2G45 A;  2EGP A;  4AP4 A;  5B76 A;  2LGV A;  5H1U A;  2MD7 B;  2YHN A;  2VJE B;  5H1T A;  3MHS A;  4X3G A;  2KWN A;  5FB0 A;  3N9L A;  4IC2 A;  4L58 A;  2MD8 C;  1Z6U A;  4PPE A;  2ECI A;  4NN2 A;  5TDR A;  3IHP A;  2LV9 A;  2QIZ A;  1JM7 B;  1WEP A;  2KIZ A;  1Z60 A;  3SHB A;  4WZ3 B;  2KWJ A;  2L0B A;  3U5N A;  2YSM A;  2C2V S;  1T1H A;  3DPL R;  1WGM A;  4GNF A;  2K17 A;  3V43 A;  4YAT A;  4GNG A;  1F62 A;  3HCU A;  5LKT A;  5LKU A;  4LLB A;  2CSY A;  4L7X A;  1WEN A;  2ECG A;  3N9M A;  4FJC A;  4FK5 A;  2E6S A;  1WEO A;  2CT2 A;  1VYX A;  2YQM A;  1X4J A;  5H1V A;  2LGL A;  2KGI A;  2M1R A;  1ZBD B;  2C2L A;  3PHD A;  2RI7 A;  3HCS A;  1WEV A;  2YRE A;  1WIM A;  2MIQ A;  5DKA A;  2ECN A;  2KWK A;  4MSX A;  1MM2 A;  4PTB A;  2MUM A;  1U6G B;  4I7C A;  5FB1 A;  5B75 A;  4LKA A;  3T6R A;  3DQV R;  4F52 B;  4LK9 A;  2F42 A;  2FUU A;  1WEW A;  5LKX A;  2LRI C;  2VPE A;  3U5O A;  1JM7 A;  4AUQ B;  1XWH A;  4I7B A;  2LXP C;  4QF3 A;  4AVX A;  5AIT A;  2Y1N A;  5LKZ A;  5KH7 A;  3C6W A;  2YW8 A;  1BOR A;  1FP0 A;  2EA6 A;  4YBT A;  5EYA F;  3LQJ A;  1WEM A;  2YU4 A;  5TRB A;  3RPG B;  3M63 A;  4Q6F A;  4V3K C;  5DIN A;  5D1K B;  2VPD A;  4UP5 A;  4A4B A;  3ZNI A;  4XI1 A;  3PUQ A;  1HYJ A;  2L80 A;  2DX8 A;  3O36 A;  2KWO A;  4R2Y A;  1G25 A;  2IDA A;  4BBQ A;  2F6J A;  2LN0 A;  1DVP A;  3O37 A;  1X4I A;  4ZQL A;  4I7D A;  4N3W A;  4LJN A;  2YYR A;  4R7E A;  4S3O B;  1K2F A;  4A0C D;  5J3X A;  5TDW A;  3O70 A;  1WIL A;  4C9Z A;  2LQ6 A;  3C5K A;  3SOU A;  4GND A;  1Z2Q A;  3LQI A;  1V87 A;  3T7L A;  2ECW A;  2JMI A;  2VPB A;  3U5M A;  2I50 A;  3L11 A;  1WEQ A;  2KU3 A;  4UP0 A;  5JG6 A;  4LAD B;  1WEE A;  2KFT A;  5AIU A;  3SOX A;  4YBM A;  1HYI A;  5LCW B;  5B79 A;  3L1X A;  2YSJ A;  4WA6 A;  2XEU A;  4YC9 A;  4BHW A;  5G04 B;  2KRE A;  2L43 A;  4O64 A;  3RTR B;  4AYC B;  3GL6 A;  1WES A;  3EB5 A;  4V3L C;  2FUI A;  3ZVZ B;  3KNV A;  2G6Q A;  3KQI A;  2AN6 A;  2VJE A;  4CA1 A;  3ZYQ A;  2LGK A;  2LGG A;  4CCG X;  3ZPV E;  1MM3 A;  3O7A A;  2KGG A;  2QIC A;  5I3L A;  2PNX A;  2ECT A;  2H0D B;  3PUR A;  2YUC A;  1RMD A;  4S3O C;  2K16 A;  3GV4 A;  3U5P A;  4IC3 A;  3O35 A;  3N9O A;  3O34 A;  5H9M A;  3N9N A;  1JOC A;  4WZ0 A;  3M62 A;  3LRQ A;  2F6N A;  2LXH C;  2MNY A;  2EOD A;  5KH3 A;  3HTK C;  4GNE A;  4FIP A;  4YAB A;  5TAB A;  2MNZ A;  2ZET C;  2LDR A;  5C13 A;  4R8P K;  2JRJ A;  1WEU A;  2ECJ A;  5G0F A;  2CKL B;  2M6M A;  2L75 A;  3I2D A;  2OXQ C;  1X4U A;  3MHH A;  2RSD A;  3KV5 A;  3NG2 A;  5C11 A;  5D1M B;  4N4F A;  1LDJ B;  4YAD A;  3FL2 A;  3ZTG A;  5TBN A;  4B86 C;  2JMD A;  2VJF B;  4ZDT A;  5FER A;  2KE1 A;  5B8D A;  2NAA A;  4AYC A;  2MA5 A;  2CSZ A;  3LQH A;  2Y43 A;  1FBV A;  2HDP A;  4YAX A;  2QJ0 A;  2E6R A;  2K4D A;  3ASL A;  3QZV A;  2K1J A;  2UZG A;  4ZUX U;  3KV6 A;  2Y1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...