3KQIA

Crystal structure of phf2 phd domain complexed with h3k4me3 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GSMATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords PHD finger protein 2
publication title Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kqiA00
1F62A 4A4CA 2QIZA 2G45A 3HCUA 2YHNA 2VNFA 2L0BA 2M1RA 4N3WA 5H1VA 5LKUA 2VJFA 1HYJA 2MNZA 4MVTA 2E6RA 2ECWA 3HCSA 2M6MA 2FSAA 3O33A 4O64A 2MUMA 4QF3A 5KH9A 5DINA 5I3LA 3PUQA 1VD4A 4YBSA 3ZTGA 3N9LA 4WZ3B 2L5UA 2F6NA 4C9ZA 1DVPA 1RMDA 3LQHA 2ECVA 4YBMA 3LQIA 4S3OC 2KWKA 4MSXA 2DX8A 2MA6A 4YABA 4L7XA 2MIQA 2CSYA 5G04B 4AYCB 4S3OB 1K2FA 5B76A 1WEMA 2PUYA 4V3LC 5TBNA 1LDKC 3L11A 2M85A 3ZPVE 5TDRA 3LRQA 5FB0A 2XB1A 3QZVA 1JOCA 2KR4A 3PHDA 4FO9A 3ZVZB 1WEWA 2ECJA 4F52B 3N9QA 5DKAA 3PURA 5H9MA 1WILA 2UZGA 4ZQLA 5C11A 2YT5A 5H1TA 2CSZA 4A0CD 2K16A 2LDRA 2LGLA 2ZETC 3EB6A 2OXQC 4FK5A 5B78A 1E4UA 5FB1A 3O37A 4X3GA 4R2YA 2ECTA 5G05B 2VPBA 2YHOA 3GV4A 4UI9B 2YU4A 1VFYA 3SOWA 1N87A 2G43A 5LKZA 2Y1NA 3DPLR 4GNGA 3RPGB 1ZBDB 2YW8A 3GL6A 2QICA 2C2VS 2L80A 1T1HA 2ECIA 4R8PK 2MA5A 3IHPA 1WEEA 1WEVA 4FJCA 2RI7A 3FL2A 3MHSA 4A4BA 2YQMA 1WIMA 2VJEB 3ZPV1 3EB5A 1HYIA 4GNEA 3U5OA 3U5PA 5FEYA 4YC9A 3ASLA 4GNFA 3ZNIA 4B86C 1FP0A 4WZ2A 3NG2A 2AN6A 4YATA 5KH3A 2VPEA 5B77A 2LXHC 4BHWA 2NAAA 2CT2A 3O35A 1WEUA 2BAYA 4PTBA 2MD8C 2JMJA 2RSDA 4Q6FA 2L75A 4QF2A 2EGPA 3V43A 2G6QA 1U6GB 4I7DA 1MM3A 3O70A 2H0DB 2YSMA 3M62A 2KGIA 2QJ0A 3KV5A 1BORA 2MNYA 1LDJB 2MD7B 2YREA 2YQLA 3O36A 2HYED 1CHCA 1G25A 5LCWB 2YYRA 4N4FA 4CA1A 4L58A 2CKLB 2L43A 3T7LA 4LLBA 3U5MA 2F42A 1VYXA 2D8SA 4PPEA 1Z2QA 3KNVA 2VJFB 4GB0A 3HCTA 3VK6A 1IYMA 2K17A 3SOUA 2F6JA 3KQIA 2M3HA 4V3KC 5JG6A 5LKTA 2PNXA 4WZ0A 3U5NA 2MT5A 5J3XA 2ECNA 2E6SA 1X4JA 2EODA 4I7BA 2YSJA 5H1UA 3RTRB 2KYUA 1Z6UA 4P5OB 3O34A 4UP0A 3T6RA 1FBVA 2HDPA 4AVXA 3HTKC 2FUUA 3RPGC 4B7YC 1WESA 2VP7A 3N9PA 4IC3A 1MM2A 3ZYQA 5C13A 4BBQA 2LRIC 1WE9A 2JRJA 4AYCA 3M63A 3N9OA 5G0FA 2VPGA 3LQJA 1WENA 2VPDA 2LN0A 2FUIA 2K4DA 5TRBA 2YURA 2Y1MA 1JM7A 2ECGA 3L1ZB 1V87A 1XWHA 2KREA 2XEUA 2KE1A 4FIPA 3KV6A 3O7AA 1WEPA 2LGVA 4A49A 4W4UA 2KWOA 4GNDA 5TDWA 2Y43A 4LJNA 2K1JA 2IDAA 5AITA 2LV9A 4IC2A 1WEOA 4UP5A 4R7EA 1WEQA 4YBTA 5D1MB 2LGKA 5B8DA 5B79A 1X4IA 4ZDTA 4YAXA 3MHHA 4YADA 2KU3A 4ZUXU 5FERA 2VJEA 1X4UA 1Z60A 2KWJA 3N9NA 1JM7B 2C2LA 5TABA 1WGMA 2LQ6A 2LXPC 4CCGX 3C6WA 2LGGA 1WFKA 3I2DA 4AP4A 3N9MA 4TKPB 5D1KB 4NN2A 4LK9A 2I50A 2KWNA 3SHBA 2H0DA 2YUCA 3DQVR 2JMIA 4LADB 5B75A 4AUQB 5LKXA 4XI1A 3C5KA 4I7CA 4WA6A 4LKAA 3SOXA 3L1XA 5AIUA 2KGGA 3M99A 5KH7A 5EYAF 2EA6A 5D1LB 2KIZA 3ZVYA 2JMDA 2CKLA 2KFTA
chains in the Genus database with same CATH superfamily
1F62A 4A4CA 2QIZA 2G45A 3HCUA 2YHNA 2VNFA 2L0BA 2M1RA 4N3WA 5H1VA 5LKUA 2VJFA 1HYJA 2MNZA 4MVTA 2E6RA 2ECWA 3HCSA 2M6MA 2FSAA 3O33A 4O64A 2MUMA 4QF3A 3M7KA 5KH9A 5DINA 5I3LA 3PUQA 1VD4A 4YBSA 3ZTGA 3N9LA 4WZ3B 3O47A 2L5UA 2F6NA 4C9ZA 1DVPA 2XOYA 1RMDA 2KKXA 3LQHA 2ECVA 4YBMA 3LQIA 4S3OC 2IQJA 2KWKA 4MSXA 2JM3A 2DX8A 2MA6A 4YABA 4L7XA 2MIQA 2CSYA 5G04B 4AYCB 4S3OB 1K2FA 3FAOA 1WEMA 5B76A 2PUYA 4V3LC 5TBNA 1LDKC 3L11A 4H9DA 2M85A 3ZPVE 5TDRA 3E2DA 2CRRA 3LRQA 5FB0A 2XB1A 3LDYA 3QZVA 1JOCA 2KR4A 3PHDA 4FO9A 3ZVZB 1WEWA 2ECJA 4F52B 3N9QA 5DKAA 3PURA 4Z0OA 1WILA 5H9MA 2UZGA 4ZQLA 5C11A 2YT5A 5H1TA 2CSZA 4OGEA 4A0CD 2K16A 2LDRA 2LGLA 2D8UA 2ZETC 3EB6A 2OXQC 2YVRA 2FD4A 4FK5A 5B78A 1E4UA 5FB1A 3O37A 4X3GA 4R2YA 2ECTA 5G05B 2VPBA 2YHOA 3GV4A 3LVQE 4UI9B 2YU4A 1VFYA 3SOWA 1N87A 2G43A 5LKZA 2Y1NA 3DPLR 4GNGA 3RPGB 1ZBDB 2YW8A 3GL6A 2QICA 2C2VS 2L80A 1T1HA 1DCQA 2ECIA 4R8PK 2MA5A 3IHPA 3H7HA 1WEEA 1WEVA 4FJCA 2RI7A 3FL2A 3MHSA 3LJUX 4A4BA 2YQMA 2E61A 1WIMA 2VJEB 3ZPV1 3EB5A 1HYIA 4GNEA 3U5OA 3U5PA 5FEYA 4YC9A 3ASLA 4O62A 4GNFA 3ZNIA 2JUNA 5SVXA 2RR4A 4B86C 1FP0A 4WZ2A 3NG2A 2AN6A 4YATA 3PLWA 2VPEA 5KH3A 5B77A 2LXHC 5SVIA 2L7PA 4BHWA 2NAAA 2CT2A 3O35A 1WEUA 2BAYA 4PTBA 2LAUA 2JMJA 2RSDA 2MD8C 4Q6FA 3FJUB 2L75A 4QF2A 2EGPA 3V43A 2G6QA 1U6GB 4I7DA 1MM3A 3O70A 2MKEA 2H0DB 2YSMA 3M62A 2KGIA 2QJ0A 3KV5A 1BORA 2MNYA 2M13A 1LDJB 2MD7B 2YREA 2EGMA 2YQLA 3O36A 2HYED 1CHCA 1G25A 5LCWB 2YYRA 4N4FA 4CA1A 4L58A 2CKLB 2L43A 3FM8C 4LLBA 3T7LA 3U5MA 2F42A 1VYXA 2D8SA 4PPEA 1Z2QA 3KNVA 3T9KA 2XOCA 2VJFB 4GB0A 3HCTA 3VK6A 2KKYA 1IYMA 2K17A 2XOZA 3SOUA 2F6JA 3KQIA 2M3HA 4V3KC 4Z0RA 5JG6A 5LKTA 2PNXA 4WZ0A 2DSMA 3U5NA 2MT5A 5J3XA 2ECNA 2E6SA 1X4JA 2EODA 4I7BA 2YSJA 1MBMA 5H1UA 3RTRB 2KYUA 1Z6UA 4P5OB 3O34A 4UP0A 3T6RA 1FBVA 2HDPA 4AVXA 5SVIB 3HTKC 2FUUA 3Q1DA 3RPGC 4F1PA 2CRWA 4B7YC 1WESA 2VP7A 3N9PA 4IC3A 1MM2A 3ZYQA 5C13A 4BBQA 2LRIC 1WE9A 2JRJA 4AYCA 3M63A 3N9OA 5G0FA 2VPGA 3LQJA 2DJAA 1WENA 2VPDA 3SUBA 2LN0A 2FUIA 2K4DA 5TRBA 2YURA 2Y1MA 1JM7A 2ECGA 3L1ZB 1V87A 1XWHA 2KREA 3DWDA 2CONA 2XEUA 2KE1A 3JUEA 4FIPA 3KV6A 3O7AA 1WEPA 2LGVA 4A49A 4W4UA 2KWOA 4GNDA 5TDWA 2Y43A 4LJNA 2K1JA 2IDAA 2P57A 5AITA 2LV9A 4IC2A 1WEOA 4UP5A 4R7EA 1WEQA 4YBTA 5D1MB 2LGKA 3MDBC 5B8DA 5B79A 1X4IA 4ZDTA 4YAXA 3MHHA 4YADA 2CSVA 2KU3A 4ZUXU 3FEHA 5FERA 2VJEA 1X4UA 5SVYA 3DDTA 1Z60A 2KWJA 3N9NA 1JM7B 3LVRE 2C2LA 5TABA 1WGMA 2LQ6A 2LXPC 4OGCA 3FANA 3KDEC 2XP0A 4CCGX 2B0OE 3C6WA 2LGGA 1WFKA 2EXUA 3I2DA 4AP4A 3N9MA 4TKPB 5D1KB 4NN2A 4LK9A 2I50A 2KWNA 4QQ4A 3SHBA 2H0DA 2YUCA 3DQVR 2JMIA 4LADB 5B75A 4AUQB 5LKXA 5K3QA 2OWAA 4XI1A 3C5KA 2FFWA 4I7CA 4WA6A 4LKAA 3SOXA 3L1XA 5AIUA 2KGGA 3M99A 5KH7A 5EYAF 2EA6A 5D1LB 2KIZA 3ZVYA 2JMDA 2CKLA 2KFTA
chains in the Genus database with same CATH topology
1F62A 4A4CA 2QIZA 2G45A 3HCUA 2YHNA 2VNFA 2L0BA 2M1RA 4N3WA 5H1VA 5LKUA 2VJFA 1HYJA 2MNZA 4MVTA 2E6RA 2ECWA 3HCSA 2M6MA 2FSAA 3O33A 4O64A 2MUMA 4QF3A 5KH9A 5DINA 5I3LA 3PUQA 1VD4A 4YBSA 3ZTGA 3N9LA 4WZ3B 2L5UA 2F6NA 4C9ZA 1DVPA 1RMDA 3LQHA 2ECVA 4YBMA 3LQIA 4S3OC 2KWKA 4MSXA 2DX8A 2MA6A 4YABA 4L7XA 2MIQA 2CSYA 5G04B 4AYCB 4S3OB 1K2FA 5B76A 1WEMA 2PUYA 4V3LC 5TBNA 1LDKC 3L11A 2M85A 3ZPVE 5TDRA 3LRQA 5FB0A 2XB1A 3QZVA 1JOCA 2KR4A 3PHDA 4FO9A 3ZVZB 1WEWA 2ECJA 4F52B 3N9QA 5DKAA 3PURA 5H9MA 1WILA 2UZGA 4ZQLA 5C11A 2YT5A 5H1TA 2CSZA 4A0CD 2K16A 2LDRA 2LGLA 2ZETC 3EB6A 2OXQC 4FK5A 5B78A 1E4UA 5FB1A 3O37A 4X3GA 4R2YA 2ECTA 5G05B 2VPBA 2YHOA 3GV4A 4UI9B 2YU4A 1VFYA 3SOWA 1N87A 2G43A 5LKZA 2Y1NA 3DPLR 4GNGA 3RPGB 1ZBDB 2YW8A 3GL6A 2QICA 2C2VS 2L80A 1T1HA 2ECIA 4R8PK 2MA5A 3IHPA 1WEEA 1WEVA 4FJCA 2RI7A 3FL2A 3MHSA 4A4BA 2YQMA 1WIMA 2VJEB 3ZPV1 3EB5A 1HYIA 4GNEA 3U5OA 3U5PA 5FEYA 4YC9A 3ASLA 4GNFA 3ZNIA 4B86C 1FP0A 4WZ2A 3NG2A 2AN6A 4YATA 5KH3A 2VPEA 5B77A 2LXHC 4BHWA 2NAAA 2CT2A 3O35A 1WEUA 2BAYA 4PTBA 2MD8C 2JMJA 2RSDA 4Q6FA 2L75A 4QF2A 2EGPA 3V43A 2G6QA 1U6GB 4I7DA 1MM3A 3O70A 2H0DB 2YSMA 3M62A 2KGIA 2QJ0A 3KV5A 1BORA 2MNYA 1LDJB 2MD7B 2YREA 2YQLA 3O36A 2HYED 1CHCA 1G25A 5LCWB 2YYRA 4N4FA 4CA1A 4L58A 2CKLB 2L43A 3T7LA 4LLBA 3U5MA 2F42A 1VYXA 2D8SA 4PPEA 1Z2QA 3KNVA 2VJFB 4GB0A 3HCTA 3VK6A 1IYMA 2K17A 3SOUA 2F6JA 3KQIA 2M3HA 4V3KC 5JG6A 5LKTA 2PNXA 4WZ0A 3U5NA 2MT5A 5J3XA 2ECNA 2E6SA 1X4JA 2EODA 4I7BA 2YSJA 5H1UA 3RTRB 2KYUA 1Z6UA 4P5OB 3O34A 4UP0A 3T6RA 1FBVA 2HDPA 4AVXA 3HTKC 2FUUA 3RPGC 4B7YC 1WESA 2VP7A 3N9PA 4IC3A 1MM2A 3ZYQA 5C13A 4BBQA 2LRIC 1WE9A 2JRJA 4AYCA 3M63A 3N9OA 5G0FA 2VPGA 3LQJA 1WENA 2VPDA 2LN0A 2FUIA 2K4DA 5TRBA 2YURA 2Y1MA 1JM7A 2ECGA 3L1ZB 1V87A 1XWHA 2KREA 2XEUA 2KE1A 4FIPA 3KV6A 3O7AA 1WEPA 2LGVA 4A49A 4W4UA 2KWOA 4GNDA 5TDWA 2Y43A 4LJNA 2K1JA 2IDAA 5AITA 2LV9A 4IC2A 1WEOA 4UP5A 4R7EA 1WEQA 4YBTA 5D1MB 2LGKA 5B8DA 5B79A 1X4IA 4ZDTA 4YAXA 3MHHA 4YADA 2KU3A 4ZUXU 5FERA 2VJEA 1X4UA 1Z60A 2KWJA 3N9NA 1JM7B 2C2LA 5TABA 1WGMA 2LQ6A 2LXPC 4CCGX 3C6WA 2LGGA 1WFKA 3I2DA 4AP4A 3N9MA 4TKPB 5D1KB 4NN2A 4LK9A 2I50A 2KWNA 3SHBA 2H0DA 2YUCA 3DQVR 2JMIA 4LADB 5B75A 4AUQB 5LKXA 4XI1A 3C5KA 4I7CA 4WA6A 4LKAA 3SOXA 3L1XA 5AIUA 2KGGA 3M99A 5KH7A 5EYAF 2EA6A 5D1LB 2KIZA 3ZVYA 2JMDA 2CKLA 2KFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F62 A;  4A4C A;  2QIZ A;  2G45 A;  3HCU A;  2YHN A;  2VNF A;  2L0B A;  2M1R A;  4N3W A;  5H1V A;  5LKU A;  2VJF A;  1HYJ A;  2MNZ A;  4MVT A;  2E6R A;  2ECW A;  3HCS A;  2M6M A;  2FSA A;  3O33 A;  4O64 A;  2MUM A;  4QF3 A;  5KH9 A;  5DIN A;  5I3L A;  3PUQ A;  1VD4 A;  4YBS A;  3ZTG A;  3N9L A;  4WZ3 B;  2L5U A;  2F6N A;  4C9Z A;  1DVP A;  1RMD A;  3LQH A;  2ECV A;  4YBM A;  3LQI A;  4S3O C;  2KWK A;  4MSX A;  2DX8 A;  2MA6 A;  4YAB A;  4L7X A;  2MIQ A;  2CSY A;  5G04 B;  4AYC B;  4S3O B;  1K2F A;  5B76 A;  1WEM A;  2PUY A;  4V3L C;  5TBN A;  1LDK C;  3L11 A;  2M85 A;  3ZPV E;  5TDR A;  3LRQ A;  5FB0 A;  2XB1 A;  3QZV A;  1JOC A;  2KR4 A;  3PHD A;  4FO9 A;  3ZVZ B;  1WEW A;  2ECJ A;  4F52 B;  3N9Q A;  5DKA A;  3PUR A;  5H9M A;  1WIL A;  2UZG A;  4ZQL A;  5C11 A;  2YT5 A;  5H1T A;  2CSZ A;  4A0C D;  2K16 A;  2LDR A;  2LGL A;  2ZET C;  3EB6 A;  2OXQ C;  4FK5 A;  5B78 A;  1E4U A;  5FB1 A;  3O37 A;  4X3G A;  4R2Y A;  2ECT A;  5G05 B;  2VPB A;  2YHO A;  3GV4 A;  4UI9 B;  2YU4 A;  1VFY A;  3SOW A;  1N87 A;  2G43 A;  5LKZ A;  2Y1N A;  3DPL R;  4GNG A;  3RPG B;  1ZBD B;  2YW8 A;  3GL6 A;  2QIC A;  2C2V S;  2L80 A;  1T1H A;  2ECI A;  4R8P K;  2MA5 A;  3IHP A;  1WEE A;  1WEV A;  4FJC A;  2RI7 A;  3FL2 A;  3MHS A;  4A4B A;  2YQM A;  1WIM A;  2VJE B;  3ZPV 1;  3EB5 A;  1HYI A;  4GNE A;  3U5O A;  3U5P A;  5FEY A;  4YC9 A;  3ASL A;  4GNF A;  3ZNI A;  4B86 C;  1FP0 A;  4WZ2 A;  3NG2 A;  2AN6 A;  4YAT A;  5KH3 A;  2VPE A;  5B77 A;  2LXH C;  4BHW A;  2NAA A;  2CT2 A;  3O35 A;  1WEU A;  2BAY A;  4PTB A;  2MD8 C;  2JMJ A;  2RSD A;  4Q6F A;  2L75 A;  4QF2 A;  2EGP A;  3V43 A;  2G6Q A;  1U6G B;  4I7D A;  1MM3 A;  3O70 A;  2H0D B;  2YSM A;  3M62 A;  2KGI A;  2QJ0 A;  3KV5 A;  1BOR A;  2MNY A;  1LDJ B;  2MD7 B;  2YRE A;  2YQL A;  3O36 A;  2HYE D;  1CHC A;  1G25 A;  5LCW B;  2YYR A;  4N4F A;  4CA1 A;  4L58 A;  2CKL B;  2L43 A;  3T7L A;  4LLB A;  3U5M A;  2F42 A;  1VYX A;  2D8S A;  4PPE A;  1Z2Q A;  3KNV A;  2VJF B;  4GB0 A;  3HCT A;  3VK6 A;  1IYM A;  2K17 A;  3SOU A;  2F6J A;  3KQI A;  2M3H A;  4V3K C;  5JG6 A;  5LKT A;  2PNX A;  4WZ0 A;  3U5N A;  2MT5 A;  5J3X A;  2ECN A;  2E6S A;  1X4J A;  2EOD A;  4I7B A;  2YSJ A;  5H1U A;  3RTR B;  2KYU A;  1Z6U A;  4P5O B;  3O34 A;  4UP0 A;  3T6R A;  1FBV A;  2HDP A;  4AVX A;  3HTK C;  2FUU A;  3RPG C;  4B7Y C;  1WES A;  2VP7 A;  3N9P A;  4IC3 A;  1MM2 A;  3ZYQ A;  5C13 A;  4BBQ A;  2LRI C;  1WE9 A;  2JRJ A;  4AYC A;  3M63 A;  3N9O A;  5G0F A;  2VPG A;  3LQJ A;  1WEN A;  2VPD A;  2LN0 A;  2FUI A;  2K4D A;  5TRB A;  2YUR A;  2Y1M A;  1JM7 A;  2ECG A;  3L1Z B;  1V87 A;  1XWH A;  2KRE A;  2XEU A;  2KE1 A;  4FIP A;  3KV6 A;  3O7A A;  1WEP A;  2LGV A;  4A49 A;  4W4U A;  2KWO A;  4GND A;  5TDW A;  2Y43 A;  4LJN A;  2K1J A;  2IDA A;  5AIT A;  2LV9 A;  4IC2 A;  1WEO A;  4UP5 A;  4R7E A;  1WEQ A;  4YBT A;  5D1M B;  2LGK A;  5B8D A;  5B79 A;  1X4I A;  4ZDT A;  4YAX A;  3MHH A;  4YAD A;  2KU3 A;  4ZUX U;  5FER A;  2VJE A;  1X4U A;  1Z60 A;  2KWJ A;  3N9N A;  1JM7 B;  2C2L A;  5TAB A;  1WGM A;  2LQ6 A;  2LXP C;  4CCG X;  3C6W A;  2LGG A;  1WFK A;  3I2D A;  4AP4 A;  3N9M A;  4TKP B;  5D1K B;  4NN2 A;  4LK9 A;  2I50 A;  2KWN A;  3SHB A;  2H0D A;  2YUC A;  3DQV R;  2JMI A;  4LAD B;  5B75 A;  4AUQ B;  5LKX A;  4XI1 A;  3C5K A;  4I7C A;  4WA6 A;  4LKA A;  3SOX A;  3L1X A;  5AIU A;  2KGG A;  3M99 A;  5KH7 A;  5EYA F;  2EA6 A;  5D1L B;  2KIZ A;  3ZVY A;  2JMD A;  2CKL A;  2KFT A; 
#chains in the Genus database with same CATH topology
 1F62 A;  4A4C A;  2QIZ A;  2G45 A;  3HCU A;  2YHN A;  2VNF A;  2L0B A;  2M1R A;  4N3W A;  5H1V A;  5LKU A;  2VJF A;  1HYJ A;  2MNZ A;  4MVT A;  2E6R A;  2ECW A;  3HCS A;  2M6M A;  2FSA A;  3O33 A;  4O64 A;  2MUM A;  4QF3 A;  3M7K A;  5KH9 A;  5DIN A;  5I3L A;  3PUQ A;  1VD4 A;  4YBS A;  3ZTG A;  3N9L A;  4WZ3 B;  3O47 A;  2L5U A;  2F6N A;  4C9Z A;  1DVP A;  2XOY A;  1RMD A;  2KKX A;  3LQH A;  2ECV A;  4YBM A;  3LQI A;  4S3O C;  2IQJ A;  2KWK A;  4MSX A;  2JM3 A;  2DX8 A;  2MA6 A;  4YAB A;  4L7X A;  2MIQ A;  2CSY A;  5G04 B;  4AYC B;  4S3O B;  1K2F A;  3FAO A;  1WEM A;  5B76 A;  2PUY A;  4V3L C;  5TBN A;  1LDK C;  3L11 A;  4H9D A;  2M85 A;  3ZPV E;  5TDR A;  3E2D A;  2CRR A;  3LRQ A;  5FB0 A;  2XB1 A;  3LDY A;  3QZV A;  1JOC A;  2KR4 A;  3PHD A;  4FO9 A;  3ZVZ B;  1WEW A;  2ECJ A;  4F52 B;  3N9Q A;  5DKA A;  3PUR A;  4Z0O A;  1WIL A;  5H9M A;  2UZG A;  4ZQL A;  5C11 A;  2YT5 A;  5H1T A;  2CSZ A;  4OGE A;  4A0C D;  2K16 A;  2LDR A;  2LGL A;  2D8U A;  2ZET C;  3EB6 A;  2OXQ C;  2YVR A;  2FD4 A;  4FK5 A;  5B78 A;  1E4U A;  5FB1 A;  3O37 A;  4X3G A;  4R2Y A;  2ECT A;  5G05 B;  2VPB A;  2YHO A;  3GV4 A;  3LVQ E;  4UI9 B;  2YU4 A;  1VFY A;  3SOW A;  1N87 A;  2G43 A;  5LKZ A;  2Y1N A;  3DPL R;  4GNG A;  3RPG B;  1ZBD B;  2YW8 A;  3GL6 A;  2QIC A;  2C2V S;  2L80 A;  1T1H A;  1DCQ A;  2ECI A;  4R8P K;  2MA5 A;  3IHP A;  3H7H A;  1WEE A;  1WEV A;  4FJC A;  2RI7 A;  3FL2 A;  3MHS A;  3LJU X;  4A4B A;  2YQM A;  2E61 A;  1WIM A;  2VJE B;  3ZPV 1;  3EB5 A;  1HYI A;  4GNE A;  3U5O A;  3U5P A;  5FEY A;  4YC9 A;  3ASL A;  4O62 A;  4GNF A;  3ZNI A;  2JUN A;  5SVX A;  2RR4 A;  4B86 C;  1FP0 A;  4WZ2 A;  3NG2 A;  2AN6 A;  4YAT A;  3PLW A;  2VPE A;  5KH3 A;  5B77 A;  2LXH C;  5SVI A;  2L7P A;  4BHW A;  2NAA A;  2CT2 A;  3O35 A;  1WEU A;  2BAY A;  4PTB A;  2LAU A;  2JMJ A;  2RSD A;  2MD8 C;  4Q6F A;  3FJU B;  2L75 A;  4QF2 A;  2EGP A;  3V43 A;  2G6Q A;  1U6G B;  4I7D A;  1MM3 A;  3O70 A;  2MKE A;  2H0D B;  2YSM A;  3M62 A;  2KGI A;  2QJ0 A;  3KV5 A;  1BOR A;  2MNY A;  2M13 A;  1LDJ B;  2MD7 B;  2YRE A;  2EGM A;  2YQL A;  3O36 A;  2HYE D;  1CHC A;  1G25 A;  5LCW B;  2YYR A;  4N4F A;  4CA1 A;  4L58 A;  2CKL B;  2L43 A;  3FM8 C;  4LLB A;  3T7L A;  3U5M A;  2F42 A;  1VYX A;  2D8S A;  4PPE A;  1Z2Q A;  3KNV A;  3T9K A;  2XOC A;  2VJF B;  4GB0 A;  3HCT A;  3VK6 A;  2KKY A;  1IYM A;  2K17 A;  2XOZ A;  3SOU A;  2F6J A;  3KQI A;  2M3H A;  4V3K C;  4Z0R A;  5JG6 A;  5LKT A;  2PNX A;  4WZ0 A;  2DSM A;  3U5N A;  2MT5 A;  5J3X A;  2ECN A;  2E6S A;  1X4J A;  2EOD A;  4I7B A;  2YSJ A;  1MBM A;  5H1U A;  3RTR B;  2KYU A;  1Z6U A;  4P5O B;  3O34 A;  4UP0 A;  3T6R A;  1FBV A;  2HDP A;  4AVX A;  5SVI B;  3HTK C;  2FUU A;  3Q1D A;  3RPG C;  4F1P A;  2CRW A;  4B7Y C;  1WES A;  2VP7 A;  3N9P A;  4IC3 A;  1MM2 A;  3ZYQ A;  5C13 A;  4BBQ A;  2LRI C;  1WE9 A;  2JRJ A;  4AYC A;  3M63 A;  3N9O A;  5G0F A;  2VPG A;  3LQJ A;  2DJA A;  1WEN A;  2VPD A;  3SUB A;  2LN0 A;  2FUI A;  2K4D A;  5TRB A;  2YUR A;  2Y1M A;  1JM7 A;  2ECG A;  3L1Z B;  1V87 A;  1XWH A;  2KRE A;  3DWD A;  2CON A;  2XEU A;  2KE1 A;  3JUE A;  4FIP A;  3KV6 A;  3O7A A;  1WEP A;  2LGV A;  4A49 A;  4W4U A;  2KWO A;  4GND A;  5TDW A;  2Y43 A;  4LJN A;  2K1J A;  2IDA A;  2P57 A;  5AIT A;  2LV9 A;  4IC2 A;  1WEO A;  4UP5 A;  4R7E A;  1WEQ A;  4YBT A;  5D1M B;  2LGK A;  3MDB C;  5B8D A;  5B79 A;  1X4I A;  4ZDT A;  4YAX A;  3MHH A;  4YAD A;  2CSV A;  2KU3 A;  4ZUX U;  3FEH A;  5FER A;  2VJE A;  1X4U A;  5SVY A;  3DDT A;  1Z60 A;  2KWJ A;  3N9N A;  1JM7 B;  3LVR E;  2C2L A;  5TAB A;  1WGM A;  2LQ6 A;  2LXP C;  4OGC A;  3FAN A;  3KDE C;  2XP0 A;  4CCG X;  2B0O E;  3C6W A;  2LGG A;  1WFK A;  2EXU A;  3I2D A;  4AP4 A;  3N9M A;  4TKP B;  5D1K B;  4NN2 A;  4LK9 A;  2I50 A;  2KWN A;  4QQ4 A;  3SHB A;  2H0D A;  2YUC A;  3DQV R;  2JMI A;  4LAD B;  5B75 A;  4AUQ B;  5LKX A;  5K3Q A;  2OWA A;  4XI1 A;  3C5K A;  2FFW A;  4I7C A;  4WA6 A;  4LKA A;  3SOX A;  3L1X A;  5AIU A;  2KGG A;  3M99 A;  5KH7 A;  5EYA F;  2EA6 A;  5D1L B;  2KIZ A;  3ZVY A;  2JMD A;  2CKL A;  2KFT A; 
#chains in the Genus database with same CATH homology
 1F62 A;  4A4C A;  2QIZ A;  2G45 A;  3HCU A;  2YHN A;  2VNF A;  2L0B A;  2M1R A;  4N3W A;  5H1V A;  5LKU A;  2VJF A;  1HYJ A;  2MNZ A;  4MVT A;  2E6R A;  2ECW A;  3HCS A;  2M6M A;  2FSA A;  3O33 A;  4O64 A;  2MUM A;  4QF3 A;  5KH9 A;  5DIN A;  5I3L A;  3PUQ A;  1VD4 A;  4YBS A;  3ZTG A;  3N9L A;  4WZ3 B;  2L5U A;  2F6N A;  4C9Z A;  1DVP A;  1RMD A;  3LQH A;  2ECV A;  4YBM A;  3LQI A;  4S3O C;  2KWK A;  4MSX A;  2DX8 A;  2MA6 A;  4YAB A;  4L7X A;  2MIQ A;  2CSY A;  5G04 B;  4AYC B;  4S3O B;  1K2F A;  5B76 A;  1WEM A;  2PUY A;  4V3L C;  5TBN A;  1LDK C;  3L11 A;  2M85 A;  3ZPV E;  5TDR A;  3LRQ A;  5FB0 A;  2XB1 A;  3QZV A;  1JOC A;  2KR4 A;  3PHD A;  4FO9 A;  3ZVZ B;  1WEW A;  2ECJ A;  4F52 B;  3N9Q A;  5DKA A;  3PUR A;  5H9M A;  1WIL A;  2UZG A;  4ZQL A;  5C11 A;  2YT5 A;  5H1T A;  2CSZ A;  4A0C D;  2K16 A;  2LDR A;  2LGL A;  2ZET C;  3EB6 A;  2OXQ C;  4FK5 A;  5B78 A;  1E4U A;  5FB1 A;  3O37 A;  4X3G A;  4R2Y A;  2ECT A;  5G05 B;  2VPB A;  2YHO A;  3GV4 A;  4UI9 B;  2YU4 A;  1VFY A;  3SOW A;  1N87 A;  2G43 A;  5LKZ A;  2Y1N A;  3DPL R;  4GNG A;  3RPG B;  1ZBD B;  2YW8 A;  3GL6 A;  2QIC A;  2C2V S;  2L80 A;  1T1H A;  2ECI A;  4R8P K;  2MA5 A;  3IHP A;  1WEE A;  1WEV A;  4FJC A;  2RI7 A;  3FL2 A;  3MHS A;  4A4B A;  2YQM A;  1WIM A;  2VJE B;  3ZPV 1;  3EB5 A;  1HYI A;  4GNE A;  3U5O A;  3U5P A;  5FEY A;  4YC9 A;  3ASL A;  4GNF A;  3ZNI A;  4B86 C;  1FP0 A;  4WZ2 A;  3NG2 A;  2AN6 A;  4YAT A;  5KH3 A;  2VPE A;  5B77 A;  2LXH C;  4BHW A;  2NAA A;  2CT2 A;  3O35 A;  1WEU A;  2BAY A;  4PTB A;  2MD8 C;  2JMJ A;  2RSD A;  4Q6F A;  2L75 A;  4QF2 A;  2EGP A;  3V43 A;  2G6Q A;  1U6G B;  4I7D A;  1MM3 A;  3O70 A;  2H0D B;  2YSM A;  3M62 A;  2KGI A;  2QJ0 A;  3KV5 A;  1BOR A;  2MNY A;  1LDJ B;  2MD7 B;  2YRE A;  2YQL A;  3O36 A;  2HYE D;  1CHC A;  1G25 A;  5LCW B;  2YYR A;  4N4F A;  4CA1 A;  4L58 A;  2CKL B;  2L43 A;  3T7L A;  4LLB A;  3U5M A;  2F42 A;  1VYX A;  2D8S A;  4PPE A;  1Z2Q A;  3KNV A;  2VJF B;  4GB0 A;  3HCT A;  3VK6 A;  1IYM A;  2K17 A;  3SOU A;  2F6J A;  3KQI A;  2M3H A;  4V3K C;  5JG6 A;  5LKT A;  2PNX A;  4WZ0 A;  3U5N A;  2MT5 A;  5J3X A;  2ECN A;  2E6S A;  1X4J A;  2EOD A;  4I7B A;  2YSJ A;  5H1U A;  3RTR B;  2KYU A;  1Z6U A;  4P5O B;  3O34 A;  4UP0 A;  3T6R A;  1FBV A;  2HDP A;  4AVX A;  3HTK C;  2FUU A;  3RPG C;  4B7Y C;  1WES A;  2VP7 A;  3N9P A;  4IC3 A;  1MM2 A;  3ZYQ A;  5C13 A;  4BBQ A;  2LRI C;  1WE9 A;  2JRJ A;  4AYC A;  3M63 A;  3N9O A;  5G0F A;  2VPG A;  3LQJ A;  1WEN A;  2VPD A;  2LN0 A;  2FUI A;  2K4D A;  5TRB A;  2YUR A;  2Y1M A;  1JM7 A;  2ECG A;  3L1Z B;  1V87 A;  1XWH A;  2KRE A;  2XEU A;  2KE1 A;  4FIP A;  3KV6 A;  3O7A A;  1WEP A;  2LGV A;  4A49 A;  4W4U A;  2KWO A;  4GND A;  5TDW A;  2Y43 A;  4LJN A;  2K1J A;  2IDA A;  5AIT A;  2LV9 A;  4IC2 A;  1WEO A;  4UP5 A;  4R7E A;  1WEQ A;  4YBT A;  5D1M B;  2LGK A;  5B8D A;  5B79 A;  1X4I A;  4ZDT A;  4YAX A;  3MHH A;  4YAD A;  2KU3 A;  4ZUX U;  5FER A;  2VJE A;  1X4U A;  1Z60 A;  2KWJ A;  3N9N A;  1JM7 B;  2C2L A;  5TAB A;  1WGM A;  2LQ6 A;  2LXP C;  4CCG X;  3C6W A;  2LGG A;  1WFK A;  3I2D A;  4AP4 A;  3N9M A;  4TKP B;  5D1K B;  4NN2 A;  4LK9 A;  2I50 A;  2KWN A;  3SHB A;  2H0D A;  2YUC A;  3DQV R;  2JMI A;  4LAD B;  5B75 A;  4AUQ B;  5LKX A;  4XI1 A;  3C5K A;  4I7C A;  4WA6 A;  4LKA A;  3SOX A;  3L1X A;  5AIU A;  2KGG A;  3M99 A;  5KH7 A;  5EYA F;  2EA6 A;  5D1L B;  2KIZ A;  3ZVY A;  2JMD A;  2CKL A;  2KFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...