2VNFA

Molecular basis of histone h3k4me3 recognition by ing4
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis of Histone H3K4Me3 Recognition by Ing4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords INHIBITOR OF GROWTH PROTEIN 4
total genus 7
structure length 50
sequence length 50
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vnfA00
5LKZA 5TABA 4BHWA 4LKAA 4YBSA 4CA1A 1HYJA 1WIMA 1MM3A 5B75A 5FB0A 2UZGA 2VPBA 2YSJA 2M3HA 5B77A 1HYIA 2NAAA 3T6RA 3SOWA 3VK6A 2MA5A 2K4DA 4AUQB 3KV6A 2KFTA 1G25A 4V3LC 5LKUA 3GL6A 2KE1A 3ZNIA 3N9QA 1WILA 2XB1A 4I7BA 3M99A 3DPLR 3EB6A 4ZDTA 4W4UA 3PURA 5B8DA 1WEEA 4V3KC 1LDKC 3ZYQA 2ECIA 2VPDA 4B7YC 1CHCA 2YUCA 2YHNA 3RTRB 2PUYA 2MNZA 2YYRA 3O37A 4UP5A 4IC3A 5DKAA 3LQIA 4F52B 4R2YA 5TRBA 1WEQA 3L1XA 2G45A 2YW8A 4FIPA 2Y43A 5AITA 5D1MB 5AIUA 5FEYA 1WEVA 3L11A 1WEOA 2CSYA 2EGPA 3KQIA 5G0FA 4XI1A 2L75A 5C11A 3M62A 2ECNA 5LKXA 5D1LB 1WE9A 4UI9B 2VPEA 2F6JA 1F62A 1T1HA 3RPGB 1X4IA 2C2VS 5H1UA 4R7EA 1WEUA 2L80A 1X4JA 4YAXA 2JMJA 4YBMA 2M85A 2JRJA 3HCSA 4LK9A 2KREA 4LLBA 1WEMA 4GNGA 5G04B 2JMDA 1U6GB 2BAYA 2FUUA 2KGGA 4MSXA 2H0DB 4YATA 2VJFB 3L1ZB 4YBTA 3HCTA 4A4CA 2H0DA 2VNFA 4PPEA 2KYUA 1K2FA 2YQMA 2VJFA 3PHDA 4R8PK 5B78A 2OXQC 2ECWA 2MD7B 2MT5A 2CKLB 3N9NA 3IHPA 3KV5A 5KH7A 2AN6A 2KWOA 5LKTA 2KR4A 2MA6A 2RSDA 5TBNA 3MHSA 4GNEA 2YURA 4TKPB 2DX8A 2K17A 2FUIA 2MNYA 2KIZA 2XEUA 2LGKA 2YHOA 2MIQA 4WA6A 1XWHA 4LJNA 1VFYA 1WENA 3U5OA 5KH3A 3KNVA 2D8SA 2M1RA 3N9PA 3ZPV1 5H1TA 2M6MA 1JOCA 1VD4A 2K1JA 4IC2A 2LGGA 5JG6A 4MVTA 4C9ZA 1WESA 2VJEA 5DINA 4LADB 3SHBA 2L0BA 4WZ0A 3RPGC 2Y1NA 5I3LA 2KU3A 2IDAA 2LDRA 1Z6UA 5D1KB 2CKLA 2EA6A 2QIZA 1FBVA 4ZQLA 2CT2A 2KWJA 3NG2A 4P5OB 5J3XA 4NN2A 1WEWA 2I50A 2LXHC 3SOUA 1ZBDB 2KGIA 2L5UA 3DQVR 1BORA 5TDWA 4BBQA 2G43A 1N87A 2YU4A 3U5MA 3O36A 2YQLA 3O7AA 2FSAA 4A4BA 1LDJB 5B76A 3O34A 1FP0A 4GNDA 2MD8C 4GNFA 2JMIA 4N3WA 2LN0A 2F42A 3HTKC 3N9OA 2E6SA 2F6NA 3N9MA 4GB0A 1X4UA 2QJ0A 1V87A 2YSMA 4L58A 3O33A 2LV9A 2L43A 3EB5A 4WZ3B 4S3OB 4QF3A 5LCWB 3O35A 4L7XA 5EYAF 3ZPVE 5KH9A 3C6WA 2ECGA 2LGLA 3O70A 2Y1MA 1WFKA 1Z60A 3N9LA 3FL2A 3U5PA 4I7CA 4YADA 1MM2A 5B79A 1RMDA 3PUQA 2HDPA 4CCGX 2KWKA 2C2LA 1WGMA 3LQHA 2LRIC 2G6QA 2LGVA 1Z2QA 2LXPC 5C13A 3V43A 2ECTA 1DVPA 3SOXA 3M63A 5H1VA 2ECJA 3I2DA 4A0CD 1E4UA 4WZ2A 3T7LA 4Q6FA 1WEPA 4AVXA 2YREA 3ZTGA 4AP4A 3LQJA 3QZVA 4PTBA 4N4FA 2RI7A 3MHHA 2VPGA 4B86C 2YT5A 3GV4A 2K16A 4O64A 2MUMA 2HYED 2EODA 4FJCA 4YC9A 4QF2A 1IYMA 3U5NA 2ZETC 2LQ6A 2PNXA 4FK5A 4UP0A 3ZVZB 4A49A 3C5KA 4I7DA 4X3GA 5H9MA 2ECVA 5FB1A 3LRQA 4AYCB 4FO9A 4YABA 2E6RA 4S3OC 4AYCA 4ZUXU 3ZVYA 2QICA 2VJEB 2VP7A 2KWNA 1JM7B 3ASLA 5TDRA 5FERA 5G05B 2CSZA 1JM7A 3HCUA 1VYXA
chains in the Genus database with same CATH superfamily
2FFWA 5LKZA 5TABA 4BHWA 4H9DA 4LKAA 4YBSA 4CA1A 1HYJA 1WIMA 2E61A 2LAUA 1MM3A 5B75A 5FB0A 2UZGA 2VPBA 2YSJA 2M3HA 5B77A 1HYIA 2NAAA 3T6RA 3SOWA 3VK6A 2MA5A 2K4DA 4AUQB 3KV6A 2KFTA 1G25A 4V3LC 5LKUA 3GL6A 2KE1A 3ZNIA 3N9QA 4Z0OA 1WILA 2XB1A 4I7BA 3M99A 3DPLR 3EB6A 4OGCA 2XOYA 4ZDTA 4W4UA 3PURA 5B8DA 3LJUX 4QQ4A 1WEEA 4V3KC 1LDKC 3ZYQA 2ECIA 2VPDA 4B7YC 1CHCA 2YUCA 2YHNA 3RTRB 4F1PA 2EXUA 2PUYA 2MNZA 2YYRA 3O37A 4UP5A 4IC3A 4OGEA 5DKAA 3LQIA 3SUBA 4F52B 4R2YA 5TRBA 1WEQA 3FJUB 3L1XA 2G45A 2YW8A 4FIPA 2Y43A 5AITA 5D1MB 5AIUA 3KDEC 5FEYA 1WEVA 3L11A 1WEOA 3H7HA 2CSYA 2EGPA 3KQIA 5G0FA 5SVXA 4XI1A 2CONA 2L75A 5C11A 3M62A 2ECNA 5LKXA 5D1LB 1WE9A 4UI9B 2VPEA 2F6JA 2XOZA 1F62A 1T1HA 3RPGB 1X4IA 2C2VS 5H1UA 4R7EA 3FEHA 1WEUA 2L80A 1X4JA 4YAXA 2JMJA 4YBMA 2M85A 2JRJA 3HCSA 4LK9A 2KREA 4LLBA 1WEMA 4GNGA 5G04B 2BAYA 1U6GB 2FUUA 2JMDA 2KGGA 4MSXA 2H0DB 2P57A 4YATA 2VJFB 3L1ZB 4YBTA 3HCTA 4A4CA 2H0DA 2VNFA 4PPEA 2KYUA 1K2FA 2YQMA 2VJFA 3PHDA 4R8PK 5B78A 2OXQC 2ECWA 2MD7B 2MT5A 2D8UA 2CKLB 2MKEA 3N9NA 3IHPA 3KV5A 5KH7A 2AN6A 2KWOA 5LKTA 2KR4A 2MA6A 2RSDA 5TBNA 3MHSA 4GNEA 2YURA 2KKXA 1MBMA 4TKPB 2DX8A 2K17A 2FUIA 2MNYA 2KIZA 2XEUA 2LGKA 2YHOA 2MIQA 4WA6A 1XWHA 4LJNA 1VFYA 1WENA 3U5OA 5KH3A 3KNVA 2D8SA 2M1RA 3N9PA 2L7PA 3ZPV1 5H1TA 2M6MA 2XP0A 1DCQA 1JOCA 1VD4A 2K1JA 4IC2A 2LGGA 5JG6A 4MVTA 4C9ZA 2YVRA 1WESA 2VJEA 5DINA 4LADB 3SHBA 2L0BA 4WZ0A 3RPGC 2Y1NA 5I3LA 2KU3A 2IDAA 2LDRA 1Z6UA 3E2DA 3LDYA 5D1KB 2XOCA 2CKLA 2EA6A 2QIZA 1FBVA 4ZQLA 2CT2A 2KWJA 3DWDA 3NG2A 4P5OB 5J3XA 3O47A 4NN2A 2JM3A 1WEWA 3FM8C 2CRRA 2CRWA 2CSVA 2I50A 2LXHC 3SOUA 1ZBDB 2KGIA 2L5UA 3DQVR 1BORA 3FAOA 5TDWA 4BBQA 2EGMA 2G43A 1N87A 2YU4A 3U5MA 3O36A 2YQLA 3O7AA 2FSAA 4A4BA 1LDJB 5B76A 3O34A 1FP0A 4GNDA 4O62A 3DDTA 4GNFA 2MD8C 2JMIA 4N3WA 2LN0A 2F42A 3HTKC 2M13A 3N9OA 2E6SA 2F6NA 3N9MA 4GB0A 1X4UA 4Z0RA 2QJ0A 1V87A 2YSMA 4L58A 3O33A 2LV9A 2L43A 2RR4A 3EB5A 3LVQE 4WZ3B 4S3OB 4QF3A 5LCWB 3O35A 4L7XA 5EYAF 3ZPVE 5KH9A 3C6WA 2ECGA 2LGLA 3T9KA 2DSMA 3O70A 2Y1MA 1WFKA 3JUEA 5SVYA 1Z60A 3N9LA 3FL2A 3M7KA 3U5PA 4I7CA 4YADA 1MM2A 5B79A 2DJAA 1RMDA 3PUQA 2HDPA 4CCGX 2KWKA 2C2LA 1WGMA 2IQJA 3LQHA 2LRIC 2KKYA 2G6QA 2LGVA 1Z2QA 2LXPC 5C13A 3V43A 2JUNA 2ECTA 1DVPA 3SOXA 3M63A 5H1VA 2FD4A 2ECJA 3I2DA 3PLWA 4A0CD 1E4UA 4WZ2A 3T7LA 4Q6FA 1WEPA 5SVIB 4AVXA 2YREA 3MDBC 3ZTGA 4AP4A 3LQJA 3LVRE 5SVIA 3QZVA 4PTBA 4N4FA 2RI7A 3MHHA 2VPGA 4B86C 2YT5A 5K3QA 3GV4A 2K16A 4O64A 2MUMA 2HYED 2EODA 4FJCA 4YC9A 4QF2A 1IYMA 3U5NA 2ZETC 2LQ6A 2PNXA 2OWAA 4FK5A 4UP0A 3ZVZB 4A49A 3C5KA 4I7DA 4X3GA 5H9MA 2ECVA 5FB1A 3LRQA 4AYCB 4FO9A 4YABA 2E6RA 4S3OC 4AYCA 4ZUXU 3ZVYA 3Q1DA 2QICA 2VJEB 2VP7A 2KWNA 1JM7B 3ASLA 5TDRA 3FANA 5FERA 5G05B 2CSZA 1JM7A 3HCUA 1VYXA 2B0OE
chains in the Genus database with same CATH topology
5LKZA 5TABA 4BHWA 4LKAA 4YBSA 4CA1A 1HYJA 1WIMA 1MM3A 5B75A 5FB0A 2UZGA 2VPBA 2YSJA 2M3HA 5B77A 1HYIA 2NAAA 3T6RA 3SOWA 3VK6A 2MA5A 2K4DA 4AUQB 3KV6A 2KFTA 1G25A 4V3LC 5LKUA 3GL6A 2KE1A 3ZNIA 3N9QA 1WILA 2XB1A 4I7BA 3M99A 3DPLR 3EB6A 4ZDTA 4W4UA 3PURA 5B8DA 1WEEA 4V3KC 1LDKC 3ZYQA 2ECIA 2VPDA 4B7YC 1CHCA 2YUCA 2YHNA 3RTRB 2PUYA 2MNZA 2YYRA 3O37A 4UP5A 4IC3A 5DKAA 3LQIA 4F52B 4R2YA 5TRBA 1WEQA 3L1XA 2G45A 2YW8A 4FIPA 2Y43A 5AITA 5D1MB 5AIUA 5FEYA 1WEVA 3L11A 1WEOA 2CSYA 2EGPA 3KQIA 5G0FA 4XI1A 2L75A 5C11A 3M62A 2ECNA 5LKXA 5D1LB 1WE9A 4UI9B 2VPEA 2F6JA 1F62A 1T1HA 3RPGB 1X4IA 2C2VS 5H1UA 4R7EA 1WEUA 2L80A 1X4JA 4YAXA 2JMJA 4YBMA 2M85A 2JRJA 3HCSA 4LK9A 2KREA 4LLBA 1WEMA 4GNGA 5G04B 2JMDA 1U6GB 2BAYA 2FUUA 2KGGA 4MSXA 2H0DB 4YATA 2VJFB 3L1ZB 4YBTA 3HCTA 4A4CA 2H0DA 2VNFA 4PPEA 2KYUA 1K2FA 2YQMA 2VJFA 3PHDA 4R8PK 5B78A 2OXQC 2ECWA 2MD7B 2MT5A 2CKLB 3N9NA 3IHPA 3KV5A 5KH7A 2AN6A 2KWOA 5LKTA 2KR4A 2MA6A 2RSDA 5TBNA 3MHSA 4GNEA 2YURA 4TKPB 2DX8A 2K17A 2FUIA 2MNYA 2KIZA 2XEUA 2LGKA 2YHOA 2MIQA 4WA6A 1XWHA 4LJNA 1VFYA 1WENA 3U5OA 5KH3A 3KNVA 2D8SA 2M1RA 3N9PA 3ZPV1 5H1TA 2M6MA 1JOCA 1VD4A 2K1JA 4IC2A 2LGGA 5JG6A 4MVTA 4C9ZA 1WESA 2VJEA 5DINA 4LADB 3SHBA 2L0BA 4WZ0A 3RPGC 2Y1NA 5I3LA 2KU3A 2IDAA 2LDRA 1Z6UA 5D1KB 2CKLA 2EA6A 2QIZA 1FBVA 4ZQLA 2CT2A 2KWJA 3NG2A 4P5OB 5J3XA 4NN2A 1WEWA 2I50A 2LXHC 3SOUA 1ZBDB 2KGIA 2L5UA 3DQVR 1BORA 5TDWA 4BBQA 2G43A 1N87A 2YU4A 3U5MA 3O36A 2YQLA 3O7AA 2FSAA 4A4BA 1LDJB 5B76A 3O34A 1FP0A 4GNDA 2MD8C 4GNFA 2JMIA 4N3WA 2LN0A 2F42A 3HTKC 3N9OA 2E6SA 2F6NA 3N9MA 4GB0A 1X4UA 2QJ0A 1V87A 2YSMA 4L58A 3O33A 2LV9A 2L43A 3EB5A 4WZ3B 4S3OB 4QF3A 5LCWB 3O35A 4L7XA 5EYAF 3ZPVE 5KH9A 3C6WA 2ECGA 2LGLA 3O70A 2Y1MA 1WFKA 1Z60A 3N9LA 3FL2A 3U5PA 4I7CA 4YADA 1MM2A 5B79A 1RMDA 3PUQA 2HDPA 4CCGX 2KWKA 2C2LA 1WGMA 3LQHA 2LRIC 2G6QA 2LGVA 1Z2QA 2LXPC 5C13A 3V43A 2ECTA 1DVPA 3SOXA 3M63A 5H1VA 2ECJA 3I2DA 4A0CD 1E4UA 4WZ2A 3T7LA 4Q6FA 1WEPA 4AVXA 2YREA 3ZTGA 4AP4A 3LQJA 3QZVA 4PTBA 4N4FA 2RI7A 3MHHA 2VPGA 4B86C 2YT5A 3GV4A 2K16A 4O64A 2MUMA 2HYED 2EODA 4FJCA 4YC9A 4QF2A 1IYMA 3U5NA 2ZETC 2LQ6A 2PNXA 4FK5A 4UP0A 3ZVZB 4A49A 3C5KA 4I7DA 4X3GA 5H9MA 2ECVA 5FB1A 3LRQA 4AYCB 4FO9A 4YABA 2E6RA 4S3OC 4AYCA 4ZUXU 3ZVYA 2QICA 2VJEB 2VP7A 2KWNA 1JM7B 3ASLA 5TDRA 5FERA 5G05B 2CSZA 1JM7A 3HCUA 1VYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKZ A;  5TAB A;  4BHW A;  4LKA A;  4YBS A;  4CA1 A;  1HYJ A;  1WIM A;  1MM3 A;  5B75 A;  5FB0 A;  2UZG A;  2VPB A;  2YSJ A;  2M3H A;  5B77 A;  1HYI A;  2NAA A;  3T6R A;  3SOW A;  3VK6 A;  2MA5 A;  2K4D A;  4AUQ B;  3KV6 A;  2KFT A;  1G25 A;  4V3L C;  5LKU A;  3GL6 A;  2KE1 A;  3ZNI A;  3N9Q A;  1WIL A;  2XB1 A;  4I7B A;  3M99 A;  3DPL R;  3EB6 A;  4ZDT A;  4W4U A;  3PUR A;  5B8D A;  1WEE A;  4V3K C;  1LDK C;  3ZYQ A;  2ECI A;  2VPD A;  4B7Y C;  1CHC A;  2YUC A;  2YHN A;  3RTR B;  2PUY A;  2MNZ A;  2YYR A;  3O37 A;  4UP5 A;  4IC3 A;  5DKA A;  3LQI A;  4F52 B;  4R2Y A;  5TRB A;  1WEQ A;  3L1X A;  2G45 A;  2YW8 A;  4FIP A;  2Y43 A;  5AIT A;  5D1M B;  5AIU A;  5FEY A;  1WEV A;  3L11 A;  1WEO A;  2CSY A;  2EGP A;  3KQI A;  5G0F A;  4XI1 A;  2L75 A;  5C11 A;  3M62 A;  2ECN A;  5LKX A;  5D1L B;  1WE9 A;  4UI9 B;  2VPE A;  2F6J A;  1F62 A;  1T1H A;  3RPG B;  1X4I A;  2C2V S;  5H1U A;  4R7E A;  1WEU A;  2L80 A;  1X4J A;  4YAX A;  2JMJ A;  4YBM A;  2M85 A;  2JRJ A;  3HCS A;  4LK9 A;  2KRE A;  4LLB A;  1WEM A;  4GNG A;  5G04 B;  2JMD A;  1U6G B;  2BAY A;  2FUU A;  2KGG A;  4MSX A;  2H0D B;  4YAT A;  2VJF B;  3L1Z B;  4YBT A;  3HCT A;  4A4C A;  2H0D A;  2VNF A;  4PPE A;  2KYU A;  1K2F A;  2YQM A;  2VJF A;  3PHD A;  4R8P K;  5B78 A;  2OXQ C;  2ECW A;  2MD7 B;  2MT5 A;  2CKL B;  3N9N A;  3IHP A;  3KV5 A;  5KH7 A;  2AN6 A;  2KWO A;  5LKT A;  2KR4 A;  2MA6 A;  2RSD A;  5TBN A;  3MHS A;  4GNE A;  2YUR A;  4TKP B;  2DX8 A;  2K17 A;  2FUI A;  2MNY A;  2KIZ A;  2XEU A;  2LGK A;  2YHO A;  2MIQ A;  4WA6 A;  1XWH A;  4LJN A;  1VFY A;  1WEN A;  3U5O A;  5KH3 A;  3KNV A;  2D8S A;  2M1R A;  3N9P A;  3ZPV 1;  5H1T A;  2M6M A;  1JOC A;  1VD4 A;  2K1J A;  4IC2 A;  2LGG A;  5JG6 A;  4MVT A;  4C9Z A;  1WES A;  2VJE A;  5DIN A;  4LAD B;  3SHB A;  2L0B A;  4WZ0 A;  3RPG C;  2Y1N A;  5I3L A;  2KU3 A;  2IDA A;  2LDR A;  1Z6U A;  5D1K B;  2CKL A;  2EA6 A;  2QIZ A;  1FBV A;  4ZQL A;  2CT2 A;  2KWJ A;  3NG2 A;  4P5O B;  5J3X A;  4NN2 A;  1WEW A;  2I50 A;  2LXH C;  3SOU A;  1ZBD B;  2KGI A;  2L5U A;  3DQV R;  1BOR A;  5TDW A;  4BBQ A;  2G43 A;  1N87 A;  2YU4 A;  3U5M A;  3O36 A;  2YQL A;  3O7A A;  2FSA A;  4A4B A;  1LDJ B;  5B76 A;  3O34 A;  1FP0 A;  4GND A;  2MD8 C;  4GNF A;  2JMI A;  4N3W A;  2LN0 A;  2F42 A;  3HTK C;  3N9O A;  2E6S A;  2F6N A;  3N9M A;  4GB0 A;  1X4U A;  2QJ0 A;  1V87 A;  2YSM A;  4L58 A;  3O33 A;  2LV9 A;  2L43 A;  3EB5 A;  4WZ3 B;  4S3O B;  4QF3 A;  5LCW B;  3O35 A;  4L7X A;  5EYA F;  3ZPV E;  5KH9 A;  3C6W A;  2ECG A;  2LGL A;  3O70 A;  2Y1M A;  1WFK A;  1Z60 A;  3N9L A;  3FL2 A;  3U5P A;  4I7C A;  4YAD A;  1MM2 A;  5B79 A;  1RMD A;  3PUQ A;  2HDP A;  4CCG X;  2KWK A;  2C2L A;  1WGM A;  3LQH A;  2LRI C;  2G6Q A;  2LGV A;  1Z2Q A;  2LXP C;  5C13 A;  3V43 A;  2ECT A;  1DVP A;  3SOX A;  3M63 A;  5H1V A;  2ECJ A;  3I2D A;  4A0C D;  1E4U A;  4WZ2 A;  3T7L A;  4Q6F A;  1WEP A;  4AVX A;  2YRE A;  3ZTG A;  4AP4 A;  3LQJ A;  3QZV A;  4PTB A;  4N4F A;  2RI7 A;  3MHH A;  2VPG A;  4B86 C;  2YT5 A;  3GV4 A;  2K16 A;  4O64 A;  2MUM A;  2HYE D;  2EOD A;  4FJC A;  4YC9 A;  4QF2 A;  1IYM A;  3U5N A;  2ZET C;  2LQ6 A;  2PNX A;  4FK5 A;  4UP0 A;  3ZVZ B;  4A49 A;  3C5K A;  4I7D A;  4X3G A;  5H9M A;  2ECV A;  5FB1 A;  3LRQ A;  4AYC B;  4FO9 A;  4YAB A;  2E6R A;  4S3O C;  4AYC A;  4ZUX U;  3ZVY A;  2QIC A;  2VJE B;  2VP7 A;  2KWN A;  1JM7 B;  3ASL A;  5TDR A;  5FER A;  5G05 B;  2CSZ A;  1JM7 A;  3HCU A;  1VYX A; 
#chains in the Genus database with same CATH topology
 2FFW A;  5LKZ A;  5TAB A;  4BHW A;  4H9D A;  4LKA A;  4YBS A;  4CA1 A;  1HYJ A;  1WIM A;  2E61 A;  2LAU A;  1MM3 A;  5B75 A;  5FB0 A;  2UZG A;  2VPB A;  2YSJ A;  2M3H A;  5B77 A;  1HYI A;  2NAA A;  3T6R A;  3SOW A;  3VK6 A;  2MA5 A;  2K4D A;  4AUQ B;  3KV6 A;  2KFT A;  1G25 A;  4V3L C;  5LKU A;  3GL6 A;  2KE1 A;  3ZNI A;  3N9Q A;  4Z0O A;  1WIL A;  2XB1 A;  4I7B A;  3M99 A;  3DPL R;  3EB6 A;  4OGC A;  2XOY A;  4ZDT A;  4W4U A;  3PUR A;  5B8D A;  3LJU X;  4QQ4 A;  1WEE A;  4V3K C;  1LDK C;  3ZYQ A;  2ECI A;  2VPD A;  4B7Y C;  1CHC A;  2YUC A;  2YHN A;  3RTR B;  4F1P A;  2EXU A;  2PUY A;  2MNZ A;  2YYR A;  3O37 A;  4UP5 A;  4IC3 A;  4OGE A;  5DKA A;  3LQI A;  3SUB A;  4F52 B;  4R2Y A;  5TRB A;  1WEQ A;  3FJU B;  3L1X A;  2G45 A;  2YW8 A;  4FIP A;  2Y43 A;  5AIT A;  5D1M B;  5AIU A;  3KDE C;  5FEY A;  1WEV A;  3L11 A;  1WEO A;  3H7H A;  2CSY A;  2EGP A;  3KQI A;  5G0F A;  5SVX A;  4XI1 A;  2CON A;  2L75 A;  5C11 A;  3M62 A;  2ECN A;  5LKX A;  5D1L B;  1WE9 A;  4UI9 B;  2VPE A;  2F6J A;  2XOZ A;  1F62 A;  1T1H A;  3RPG B;  1X4I A;  2C2V S;  5H1U A;  4R7E A;  3FEH A;  1WEU A;  2L80 A;  1X4J A;  4YAX A;  2JMJ A;  4YBM A;  2M85 A;  2JRJ A;  3HCS A;  4LK9 A;  2KRE A;  4LLB A;  1WEM A;  4GNG A;  5G04 B;  2BAY A;  1U6G B;  2FUU A;  2JMD A;  2KGG A;  4MSX A;  2H0D B;  2P57 A;  4YAT A;  2VJF B;  3L1Z B;  4YBT A;  3HCT A;  4A4C A;  2H0D A;  2VNF A;  4PPE A;  2KYU A;  1K2F A;  2YQM A;  2VJF A;  3PHD A;  4R8P K;  5B78 A;  2OXQ C;  2ECW A;  2MD7 B;  2MT5 A;  2D8U A;  2CKL B;  2MKE A;  3N9N A;  3IHP A;  3KV5 A;  5KH7 A;  2AN6 A;  2KWO A;  5LKT A;  2KR4 A;  2MA6 A;  2RSD A;  5TBN A;  3MHS A;  4GNE A;  2YUR A;  2KKX A;  1MBM A;  4TKP B;  2DX8 A;  2K17 A;  2FUI A;  2MNY A;  2KIZ A;  2XEU A;  2LGK A;  2YHO A;  2MIQ A;  4WA6 A;  1XWH A;  4LJN A;  1VFY A;  1WEN A;  3U5O A;  5KH3 A;  3KNV A;  2D8S A;  2M1R A;  3N9P A;  2L7P A;  3ZPV 1;  5H1T A;  2M6M A;  2XP0 A;  1DCQ A;  1JOC A;  1VD4 A;  2K1J A;  4IC2 A;  2LGG A;  5JG6 A;  4MVT A;  4C9Z A;  2YVR A;  1WES A;  2VJE A;  5DIN A;  4LAD B;  3SHB A;  2L0B A;  4WZ0 A;  3RPG C;  2Y1N A;  5I3L A;  2KU3 A;  2IDA A;  2LDR A;  1Z6U A;  3E2D A;  3LDY A;  5D1K B;  2XOC A;  2CKL A;  2EA6 A;  2QIZ A;  1FBV A;  4ZQL A;  2CT2 A;  2KWJ A;  3DWD A;  3NG2 A;  4P5O B;  5J3X A;  3O47 A;  4NN2 A;  2JM3 A;  1WEW A;  3FM8 C;  2CRR A;  2CRW A;  2CSV A;  2I50 A;  2LXH C;  3SOU A;  1ZBD B;  2KGI A;  2L5U A;  3DQV R;  1BOR A;  3FAO A;  5TDW A;  4BBQ A;  2EGM A;  2G43 A;  1N87 A;  2YU4 A;  3U5M A;  3O36 A;  2YQL A;  3O7A A;  2FSA A;  4A4B A;  1LDJ B;  5B76 A;  3O34 A;  1FP0 A;  4GND A;  4O62 A;  3DDT A;  4GNF A;  2MD8 C;  2JMI A;  4N3W A;  2LN0 A;  2F42 A;  3HTK C;  2M13 A;  3N9O A;  2E6S A;  2F6N A;  3N9M A;  4GB0 A;  1X4U A;  4Z0R A;  2QJ0 A;  1V87 A;  2YSM A;  4L58 A;  3O33 A;  2LV9 A;  2L43 A;  2RR4 A;  3EB5 A;  3LVQ E;  4WZ3 B;  4S3O B;  4QF3 A;  5LCW B;  3O35 A;  4L7X A;  5EYA F;  3ZPV E;  5KH9 A;  3C6W A;  2ECG A;  2LGL A;  3T9K A;  2DSM A;  3O70 A;  2Y1M A;  1WFK A;  3JUE A;  5SVY A;  1Z60 A;  3N9L A;  3FL2 A;  3M7K A;  3U5P A;  4I7C A;  4YAD A;  1MM2 A;  5B79 A;  2DJA A;  1RMD A;  3PUQ A;  2HDP A;  4CCG X;  2KWK A;  2C2L A;  1WGM A;  2IQJ A;  3LQH A;  2LRI C;  2KKY A;  2G6Q A;  2LGV A;  1Z2Q A;  2LXP C;  5C13 A;  3V43 A;  2JUN A;  2ECT A;  1DVP A;  3SOX A;  3M63 A;  5H1V A;  2FD4 A;  2ECJ A;  3I2D A;  3PLW A;  4A0C D;  1E4U A;  4WZ2 A;  3T7L A;  4Q6F A;  1WEP A;  5SVI B;  4AVX A;  2YRE A;  3MDB C;  3ZTG A;  4AP4 A;  3LQJ A;  3LVR E;  5SVI A;  3QZV A;  4PTB A;  4N4F A;  2RI7 A;  3MHH A;  2VPG A;  4B86 C;  2YT5 A;  5K3Q A;  3GV4 A;  2K16 A;  4O64 A;  2MUM A;  2HYE D;  2EOD A;  4FJC A;  4YC9 A;  4QF2 A;  1IYM A;  3U5N A;  2ZET C;  2LQ6 A;  2PNX A;  2OWA A;  4FK5 A;  4UP0 A;  3ZVZ B;  4A49 A;  3C5K A;  4I7D A;  4X3G A;  5H9M A;  2ECV A;  5FB1 A;  3LRQ A;  4AYC B;  4FO9 A;  4YAB A;  2E6R A;  4S3O C;  4AYC A;  4ZUX U;  3ZVY A;  3Q1D A;  2QIC A;  2VJE B;  2VP7 A;  2KWN A;  1JM7 B;  3ASL A;  5TDR A;  3FAN A;  5FER A;  5G05 B;  2CSZ A;  1JM7 A;  3HCU A;  1VYX A;  2B0O E; 
#chains in the Genus database with same CATH homology
 5LKZ A;  5TAB A;  4BHW A;  4LKA A;  4YBS A;  4CA1 A;  1HYJ A;  1WIM A;  1MM3 A;  5B75 A;  5FB0 A;  2UZG A;  2VPB A;  2YSJ A;  2M3H A;  5B77 A;  1HYI A;  2NAA A;  3T6R A;  3SOW A;  3VK6 A;  2MA5 A;  2K4D A;  4AUQ B;  3KV6 A;  2KFT A;  1G25 A;  4V3L C;  5LKU A;  3GL6 A;  2KE1 A;  3ZNI A;  3N9Q A;  1WIL A;  2XB1 A;  4I7B A;  3M99 A;  3DPL R;  3EB6 A;  4ZDT A;  4W4U A;  3PUR A;  5B8D A;  1WEE A;  4V3K C;  1LDK C;  3ZYQ A;  2ECI A;  2VPD A;  4B7Y C;  1CHC A;  2YUC A;  2YHN A;  3RTR B;  2PUY A;  2MNZ A;  2YYR A;  3O37 A;  4UP5 A;  4IC3 A;  5DKA A;  3LQI A;  4F52 B;  4R2Y A;  5TRB A;  1WEQ A;  3L1X A;  2G45 A;  2YW8 A;  4FIP A;  2Y43 A;  5AIT A;  5D1M B;  5AIU A;  5FEY A;  1WEV A;  3L11 A;  1WEO A;  2CSY A;  2EGP A;  3KQI A;  5G0F A;  4XI1 A;  2L75 A;  5C11 A;  3M62 A;  2ECN A;  5LKX A;  5D1L B;  1WE9 A;  4UI9 B;  2VPE A;  2F6J A;  1F62 A;  1T1H A;  3RPG B;  1X4I A;  2C2V S;  5H1U A;  4R7E A;  1WEU A;  2L80 A;  1X4J A;  4YAX A;  2JMJ A;  4YBM A;  2M85 A;  2JRJ A;  3HCS A;  4LK9 A;  2KRE A;  4LLB A;  1WEM A;  4GNG A;  5G04 B;  2JMD A;  1U6G B;  2BAY A;  2FUU A;  2KGG A;  4MSX A;  2H0D B;  4YAT A;  2VJF B;  3L1Z B;  4YBT A;  3HCT A;  4A4C A;  2H0D A;  2VNF A;  4PPE A;  2KYU A;  1K2F A;  2YQM A;  2VJF A;  3PHD A;  4R8P K;  5B78 A;  2OXQ C;  2ECW A;  2MD7 B;  2MT5 A;  2CKL B;  3N9N A;  3IHP A;  3KV5 A;  5KH7 A;  2AN6 A;  2KWO A;  5LKT A;  2KR4 A;  2MA6 A;  2RSD A;  5TBN A;  3MHS A;  4GNE A;  2YUR A;  4TKP B;  2DX8 A;  2K17 A;  2FUI A;  2MNY A;  2KIZ A;  2XEU A;  2LGK A;  2YHO A;  2MIQ A;  4WA6 A;  1XWH A;  4LJN A;  1VFY A;  1WEN A;  3U5O A;  5KH3 A;  3KNV A;  2D8S A;  2M1R A;  3N9P A;  3ZPV 1;  5H1T A;  2M6M A;  1JOC A;  1VD4 A;  2K1J A;  4IC2 A;  2LGG A;  5JG6 A;  4MVT A;  4C9Z A;  1WES A;  2VJE A;  5DIN A;  4LAD B;  3SHB A;  2L0B A;  4WZ0 A;  3RPG C;  2Y1N A;  5I3L A;  2KU3 A;  2IDA A;  2LDR A;  1Z6U A;  5D1K B;  2CKL A;  2EA6 A;  2QIZ A;  1FBV A;  4ZQL A;  2CT2 A;  2KWJ A;  3NG2 A;  4P5O B;  5J3X A;  4NN2 A;  1WEW A;  2I50 A;  2LXH C;  3SOU A;  1ZBD B;  2KGI A;  2L5U A;  3DQV R;  1BOR A;  5TDW A;  4BBQ A;  2G43 A;  1N87 A;  2YU4 A;  3U5M A;  3O36 A;  2YQL A;  3O7A A;  2FSA A;  4A4B A;  1LDJ B;  5B76 A;  3O34 A;  1FP0 A;  4GND A;  2MD8 C;  4GNF A;  2JMI A;  4N3W A;  2LN0 A;  2F42 A;  3HTK C;  3N9O A;  2E6S A;  2F6N A;  3N9M A;  4GB0 A;  1X4U A;  2QJ0 A;  1V87 A;  2YSM A;  4L58 A;  3O33 A;  2LV9 A;  2L43 A;  3EB5 A;  4WZ3 B;  4S3O B;  4QF3 A;  5LCW B;  3O35 A;  4L7X A;  5EYA F;  3ZPV E;  5KH9 A;  3C6W A;  2ECG A;  2LGL A;  3O70 A;  2Y1M A;  1WFK A;  1Z60 A;  3N9L A;  3FL2 A;  3U5P A;  4I7C A;  4YAD A;  1MM2 A;  5B79 A;  1RMD A;  3PUQ A;  2HDP A;  4CCG X;  2KWK A;  2C2L A;  1WGM A;  3LQH A;  2LRI C;  2G6Q A;  2LGV A;  1Z2Q A;  2LXP C;  5C13 A;  3V43 A;  2ECT A;  1DVP A;  3SOX A;  3M63 A;  5H1V A;  2ECJ A;  3I2D A;  4A0C D;  1E4U A;  4WZ2 A;  3T7L A;  4Q6F A;  1WEP A;  4AVX A;  2YRE A;  3ZTG A;  4AP4 A;  3LQJ A;  3QZV A;  4PTB A;  4N4F A;  2RI7 A;  3MHH A;  2VPG A;  4B86 C;  2YT5 A;  3GV4 A;  2K16 A;  4O64 A;  2MUM A;  2HYE D;  2EOD A;  4FJC A;  4YC9 A;  4QF2 A;  1IYM A;  3U5N A;  2ZET C;  2LQ6 A;  2PNX A;  4FK5 A;  4UP0 A;  3ZVZ B;  4A49 A;  3C5K A;  4I7D A;  4X3G A;  5H9M A;  2ECV A;  5FB1 A;  3LRQ A;  4AYC B;  4FO9 A;  4YAB A;  2E6R A;  4S3O C;  4AYC A;  4ZUX U;  3ZVY A;  2QIC A;  2VJE B;  2VP7 A;  2KWN A;  1JM7 B;  3ASL A;  5TDR A;  5FER A;  5G05 B;  2CSZ A;  1JM7 A;  3HCU A;  1VYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...