2VNFA

Molecular basis of histone h3k4me3 recognition by ing4
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords INHIBITOR OF GROWTH PROTEIN 4
publication title Molecular Basis of Histone H3K4Me3 Recognition by Ing4
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 50
sequence length 50
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vnfA00
4L7XA 1WEEA 3ZYQA 2M6MA 5B76A 3HCUA 3N9NA 2YQLA 1VFYA 3O36A 4A0CD 3RTRB 2KGGA 2EGPA 1X4UA 2F42A 2M3HA 2XB1A 5H1UA 5H1TA 2LN0A 2C2VS 4WZ2A 2IDAA 3VK6A 5G05B 1RMDA 4O64A 4WZ0A 4I7CA 5D1KB 2VNFA 4L58A 2RI7A 2VPEA 3L1ZB 4YADA 5TBNA 2KWNA 4ZQLA 1XWHA 3SOXA 5TDRA 3T6RA 2LGVA 4FO9A 4YC9A 2YT5A 4PTBA 2K4DA 2YUCA 2CSYA 4GB0A 2AN6A 2VPBA 2YHNA 2JMJA 3RPGB 5LKXA 3M63A 2JMDA 1V87A 2VPDA 3DPLR 2MD7B 4X3GA 2MT5A 1ZBDB 2RSDA 2Y1NA 4QF2A 2KR4A 2C2LA 2KWKA 3ASLA 2L75A 1JM7B 2MNZA 4YBMA 2KWJA 1WEUA 2H0DB 4FIPA 2VJFB 1FP0A 2OXQC 2KGIA 1WEOA 3SHBA 5AITA 2EA6A 2L80A 2E6RA 5FB0A 5H9MA 5J3XA 4FJCA 1CHCA 3T7LA 3U5OA 5LKZA 2YQMA 4NN2A 2UZGA 5TABA 4UP5A 4YATA 1T1HA 2YU4A 5JG6A 4V3LC 5AIUA 4MVTA 2LGLA 2VPGA 3MHSA 2YSMA 5FERA 4WZ3B 1WIMA 3N9MA 5KH9A 4AP4A 2CKLB 4TKPB 5C13A 1U6GB 1WENA 1WEQA 2LDRA 2MD8C 4GNEA 3FL2A 2M1RA 2ECNA 1JM7A 4YAXA 2KE1A 1WGMA 2K1JA 1N87A 3IHPA 2L5UA 2VJEB 3U5NA 3O34A 3N9LA 3O7AA 1Z60A 2QJ0A 3SOUA 2ECWA 2YSJA 2G45A 4FK5A 2HYED 4CCGX 2YYRA 4A4CA 5LCWB 4V3KC 2G43A 3M62A 1WEMA 2I50A 3KV6A 4R7EA 4GNDA 5C11A 2ECIA 1WEPA 2NAAA 5B79A 1FBVA 2CT2A 1BORA 2YURA 1VYXA 1HYJA 4QF3A 3GL6A 3EB5A 3QZVA 4AYCB 2QIZA 4N4FA 3LRQA 4WA6A 3GV4A 4LKAA 3PHDA 1HYIA 2JRJA 1MM2A 2MIQA 4GNFA 2DX8A 1WEVA 3U5MA 2KFTA 5B75A 4UP0A 3MHHA 2ECGA 3O33A 2PNXA 2MNYA 4YABA 3O70A 3L1XA 4XI1A 4I7DA 4CA1A 3U5PA 3I2DA 5KH3A 4B86C 3RPGC 4F52B 4R2YA 2KREA 1G25A 4ZDTA 3ZVYA 2Y43A 3L11A 4P5OB 1K2FA 2ECTA 4LLBA 1WILA 3ZPV1 3HTKC 4N3WA 2LXPC 2FUUA 2CSZA 4IC2A 5B77A 2M85A 5FB1A 2K16A 1VD4A 2LRIC 1WESA 3EB6A 5DKAA 4AYCA 2LV9A 4Q6FA 2KYUA 5LKUA 2MA6A 3NG2A 3N9QA 2G6QA 1MM3A 2L0BA 1WFKA 4YBSA 2XEUA 5I3LA 1DVPA 2JMIA 4AVXA 2K17A 3ZNIA 5DINA 4UI9B 4A49A 1IYMA 4S3OC 2MA5A 4A4BA 2ECJA 4W4UA 2H0DA 2VJFA 2LQ6A 2YHOA 1Z2QA 5B78A 5B8DA 1F62A 2KWOA 3DQVR 5EYAF 3LQJA 2L43A 3C5KA 3LQHA 4BHWA 5G04B 5D1LB 4B7YC 1JOCA 4C9ZA 3LQIA 2EODA 3N9PA 3O35A 3C6WA 4BBQA 2FUIA 4ZUXU 2Y1MA 3O37A 2QICA 3SOWA 4I7BA 2ZETC 3PUQA 3HCSA 3KV5A 2F6JA 2CKLA 2LGKA 4YBTA 1LDJB 1WE9A 2MUMA 1LDKC 3ZPVE 2PUYA 2VJEA 4LJNA 2KU3A 3ZVZB 4LADB 2FSAA 3HCTA 2LXHC 4IC3A 2YREA 2E6SA 1X4JA 3PURA 2F6NA 2VP7A 5FEYA 1WEWA 2BAYA 4LK9A 2LGGA 3KNVA 3ZTGA 5G0FA 4MSXA 4R8PK 5H1VA 5KH7A 3N9OA 2HDPA 4AUQB 1X4IA 3KQIA 5D1MB 2ECVA 5LKTA 1Z6UA 2YW8A 4GNGA 2D8SA 4PPEA 5TRBA 3M99A 1E4UA 2KIZA 4S3OB 5TDWA 3V43A
chains in the Genus database with same CATH superfamily
4L7XA 1WEEA 3ZYQA 2M6MA 5B76A 3HCUA 3N9NA 2YQLA 2XOYA 1VFYA 3O36A 4OGCA 5SVIB 4A0CD 3RTRB 2KGGA 2EGPA 1X4UA 2F42A 2M3HA 2XB1A 5H1UA 5H1TA 2LN0A 2C2VS 4WZ2A 2IDAA 5SVXA 3VK6A 5G05B 1RMDA 4O64A 4WZ0A 4I7CA 2DJAA 3Q1DA 5D1KB 2VNFA 4L58A 2RI7A 2XP0A 2VPEA 3L1ZB 4YADA 5TBNA 3M7KA 2KWNA 4ZQLA 1XWHA 3SOXA 5TDRA 3T6RA 2LGVA 4FO9A 4YC9A 2FFWA 2YT5A 4PTBA 2K4DA 2YUCA 2CSYA 4GB0A 2AN6A 2VPBA 2YHNA 3KDEC 2JMJA 3RPGB 5LKXA 3O47A 3M63A 2JMDA 3DWDA 1V87A 2VPDA 3DPLR 2MD7B 4X3GA 2MT5A 1ZBDB 2RSDA 2Y1NA 4QF2A 2KR4A 2C2LA 2KWKA 3ASLA 2L75A 1JM7B 2MNZA 4YBMA 2KWJA 1WEUA 2H0DB 4FIPA 2P57A 2VJFB 1FP0A 2OXQC 4F1PA 2KGIA 3LVRE 1WEOA 3SHBA 5AITA 2EA6A 3T9KA 2L80A 2E6RA 3MDBC 5FB0A 5H9MA 5J3XA 4FJCA 1CHCA 3T7LA 3U5OA 5LKZA 2YQMA 4NN2A 3PLWA 2UZGA 5TABA 4UP5A 4Z0RA 4YATA 3H7HA 1T1HA 2YU4A 5JG6A 2CSVA 4V3LC 5AIUA 4MVTA 2LGLA 2VPGA 3MHSA 2YSMA 5FERA 4WZ3B 1WIMA 3N9MA 5KH9A 3E2DA 4AP4A 2CKLB 4TKPB 5C13A 1U6GB 1WENA 1WEQA 2LDRA 2YVRA 2MD8C 4GNEA 3FL2A 2M1RA 2ECNA 1JM7A 2D8UA 4YAXA 2KE1A 1WGMA 2K1JA 1N87A 3IHPA 2L5UA 2VJEB 3U5NA 3O34A 3N9LA 3O7AA 1Z60A 2QJ0A 3SOUA 2ECWA 2YSJA 2G45A 4FK5A 2HYED 4CCGX 2M13A 2YYRA 4A4CA 5LCWB 4V3KC 2G43A 3M62A 1WEMA 2I50A 3KV6A 2L7PA 2KKYA 3FANA 4R7EA 4GNDA 5C11A 2ECIA 2CRRA 1WEPA 2NAAA 5B79A 1FBVA 3DDTA 1BORA 2YURA 5SVYA 1VYXA 5SVIA 1HYJA 3LJUX 4QF3A 3GL6A 3EB5A 3QZVA 4AYCB 2QIZA 4N4FA 5K3QA 3LRQA 4WA6A 3GV4A 4LKAA 3PHDA 1HYIA 2JRJA 1MM2A 2MIQA 4GNFA 2DX8A 1WEVA 3U5MA 2KFTA 5B75A 4UP0A 3MHHA 2ECGA 5TDWA 3O33A 2PNXA 2MNYA 4YABA 3O70A 3L1XA 4XI1A 4I7DA 4CA1A 3U5PA 3I2DA 5KH3A 4B86C 3RPGC 4F52B 4R2YA 2KREA 1G25A 4ZDTA 3ZVYA 2Y43A 3L11A 4P5OB 1K2FA 2OWAA 3LVQE 2ECTA 4LLBA 1WILA 3ZPV1 3HTKC 2FD4A 3FAOA 4N3WA 2LXPC 2FUUA 2CSZA 4IC2A 5B77A 2M85A 5FB1A 2K16A 1VD4A 2LRIC 1WESA 3EB6A 2XOCA 5DKAA 2RR4A 4AYCA 2LV9A 4Q6FA 2KYUA 2CRWA 2MA6A 5LKUA 3NG2A 3N9QA 2G6QA 1MM3A 2L0BA 1WFKA 4YBSA 2XEUA 5I3LA 1DVPA 2JMIA 4AVXA 2K17A 3ZNIA 5DINA 4UI9B 4A49A 2XOZA 1IYMA 4S3OC 2E61A 2MA5A 4A4BA 2ECJA 4W4UA 2H0DA 2VJFA 3LDYA 2LQ6A 3SUBA 2YHOA 4QQ4A 3FEHA 1Z2QA 5B78A 5B8DA 1F62A 2KWOA 3DQVR 4Z0OA 2IQJA 5EYAF 3LQJA 2L43A 2JM3A 3C5KA 3LQHA 4BHWA 5G04B 5D1LB 4B7YC 1JOCA 4C9ZA 3LQIA 2EODA 3N9PA 3O35A 3C6WA 4BBQA 2LAUA 2FUIA 4ZUXU 2Y1MA 3O37A 2QICA 3SOWA 2CONA 4I7BA 4H9DA 2ZETC 3PUQA 3HCSA 2JUNA 3KV5A 2F6JA 2CKLA 2LGKA 4YBTA 1LDJB 2EGMA 1WE9A 1MBMA 2MUMA 1LDKC 3FM8C 3ZPVE 2PUYA 2VJEA 4LJNA 3FJUB 2KU3A 3ZVZB 4LADB 2FSAA 3HCTA 2LXHC 4IC3A 2YREA 2E6SA 1X4JA 3PURA 2F6NA 3JUEA 2VP7A 5FEYA 2KKXA 1WEWA 2BAYA 4LK9A 2LGGA 3KNVA 2B0OE 3ZTGA 5G0FA 4MSXA 4O62A 4R8PK 5H1VA 5KH7A 3N9OA 2HDPA 4AUQB 1X4IA 3KQIA 5D1MB 2ECVA 5LKTA 1Z6UA 2YW8A 4GNGA 4OGEA 2D8SA 4PPEA 5TRBA 3M99A 1E4UA 2KIZA 2DSMA 1DCQA 4S3OB 2MKEA 2EXUA 2CT2A 3V43A
chains in the Genus database with same CATH topology
4L7XA 1WEEA 3ZYQA 2M6MA 5B76A 3HCUA 3N9NA 2YQLA 1VFYA 3O36A 4A0CD 3RTRB 2KGGA 2EGPA 1X4UA 2F42A 2M3HA 2XB1A 5H1UA 5H1TA 2LN0A 2C2VS 4WZ2A 2IDAA 3VK6A 5G05B 1RMDA 4O64A 4WZ0A 4I7CA 5D1KB 2VNFA 4L58A 2RI7A 2VPEA 3L1ZB 4YADA 5TBNA 2KWNA 4ZQLA 1XWHA 3SOXA 5TDRA 3T6RA 2LGVA 4FO9A 4YC9A 2YT5A 4PTBA 2K4DA 2YUCA 2CSYA 4GB0A 2AN6A 2VPBA 2YHNA 2JMJA 3RPGB 5LKXA 3M63A 2JMDA 1V87A 2VPDA 3DPLR 2MD7B 4X3GA 2MT5A 1ZBDB 2RSDA 2Y1NA 4QF2A 2KR4A 2C2LA 2KWKA 3ASLA 2L75A 1JM7B 2MNZA 4YBMA 2KWJA 1WEUA 2H0DB 4FIPA 2VJFB 1FP0A 2OXQC 2KGIA 1WEOA 3SHBA 5AITA 2EA6A 2L80A 2E6RA 5FB0A 5H9MA 5J3XA 4FJCA 1CHCA 3T7LA 3U5OA 5LKZA 2YQMA 4NN2A 2UZGA 5TABA 4UP5A 4YATA 1T1HA 2YU4A 5JG6A 4V3LC 5AIUA 4MVTA 2LGLA 2VPGA 3MHSA 2YSMA 5FERA 4WZ3B 1WIMA 3N9MA 5KH9A 4AP4A 2CKLB 4TKPB 5C13A 1U6GB 1WENA 1WEQA 2LDRA 2MD8C 4GNEA 3FL2A 2M1RA 2ECNA 1JM7A 4YAXA 2KE1A 1WGMA 2K1JA 1N87A 3IHPA 2L5UA 2VJEB 3U5NA 3O34A 3N9LA 3O7AA 1Z60A 2QJ0A 3SOUA 2ECWA 2YSJA 2G45A 4FK5A 2HYED 4CCGX 2YYRA 4A4CA 5LCWB 4V3KC 2G43A 3M62A 1WEMA 2I50A 3KV6A 4R7EA 4GNDA 5C11A 2ECIA 1WEPA 2NAAA 5B79A 1FBVA 2CT2A 1BORA 2YURA 1VYXA 1HYJA 4QF3A 3GL6A 3EB5A 3QZVA 4AYCB 2QIZA 4N4FA 3LRQA 4WA6A 3GV4A 4LKAA 3PHDA 1HYIA 2JRJA 1MM2A 2MIQA 4GNFA 2DX8A 1WEVA 3U5MA 2KFTA 5B75A 4UP0A 3MHHA 2ECGA 3O33A 2PNXA 2MNYA 4YABA 3O70A 3L1XA 4XI1A 4I7DA 4CA1A 3U5PA 3I2DA 5KH3A 4B86C 3RPGC 4F52B 4R2YA 2KREA 1G25A 4ZDTA 3ZVYA 2Y43A 3L11A 4P5OB 1K2FA 2ECTA 4LLBA 1WILA 3ZPV1 3HTKC 4N3WA 2LXPC 2FUUA 2CSZA 4IC2A 5B77A 2M85A 5FB1A 2K16A 1VD4A 2LRIC 1WESA 3EB6A 5DKAA 4AYCA 2LV9A 4Q6FA 2KYUA 5LKUA 2MA6A 3NG2A 3N9QA 2G6QA 1MM3A 2L0BA 1WFKA 4YBSA 2XEUA 5I3LA 1DVPA 2JMIA 4AVXA 2K17A 3ZNIA 5DINA 4UI9B 4A49A 1IYMA 4S3OC 2MA5A 4A4BA 2ECJA 4W4UA 2H0DA 2VJFA 2LQ6A 2YHOA 1Z2QA 5B78A 5B8DA 1F62A 2KWOA 3DQVR 5EYAF 3LQJA 2L43A 3C5KA 3LQHA 4BHWA 5G04B 5D1LB 4B7YC 1JOCA 4C9ZA 3LQIA 2EODA 3N9PA 3O35A 3C6WA 4BBQA 2FUIA 4ZUXU 2Y1MA 3O37A 2QICA 3SOWA 4I7BA 2ZETC 3PUQA 3HCSA 3KV5A 2F6JA 2CKLA 2LGKA 4YBTA 1LDJB 1WE9A 2MUMA 1LDKC 3ZPVE 2PUYA 2VJEA 4LJNA 2KU3A 3ZVZB 4LADB 2FSAA 3HCTA 2LXHC 4IC3A 2YREA 2E6SA 1X4JA 3PURA 2F6NA 2VP7A 5FEYA 1WEWA 2BAYA 4LK9A 2LGGA 3KNVA 3ZTGA 5G0FA 4MSXA 4R8PK 5H1VA 5KH7A 3N9OA 2HDPA 4AUQB 1X4IA 3KQIA 5D1MB 2ECVA 5LKTA 1Z6UA 2YW8A 4GNGA 2D8SA 4PPEA 5TRBA 3M99A 1E4UA 2KIZA 4S3OB 5TDWA 3V43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L7X A;  1WEE A;  3ZYQ A;  2M6M A;  5B76 A;  3HCU A;  3N9N A;  2YQL A;  1VFY A;  3O36 A;  4A0C D;  3RTR B;  2KGG A;  2EGP A;  1X4U A;  2F42 A;  2M3H A;  2XB1 A;  5H1U A;  5H1T A;  2LN0 A;  2C2V S;  4WZ2 A;  2IDA A;  3VK6 A;  5G05 B;  1RMD A;  4O64 A;  4WZ0 A;  4I7C A;  5D1K B;  2VNF A;  4L58 A;  2RI7 A;  2VPE A;  3L1Z B;  4YAD A;  5TBN A;  2KWN A;  4ZQL A;  1XWH A;  3SOX A;  5TDR A;  3T6R A;  2LGV A;  4FO9 A;  4YC9 A;  2YT5 A;  4PTB A;  2K4D A;  2YUC A;  2CSY A;  4GB0 A;  2AN6 A;  2VPB A;  2YHN A;  2JMJ A;  3RPG B;  5LKX A;  3M63 A;  2JMD A;  1V87 A;  2VPD A;  3DPL R;  2MD7 B;  4X3G A;  2MT5 A;  1ZBD B;  2RSD A;  2Y1N A;  4QF2 A;  2KR4 A;  2C2L A;  2KWK A;  3ASL A;  2L75 A;  1JM7 B;  2MNZ A;  4YBM A;  2KWJ A;  1WEU A;  2H0D B;  4FIP A;  2VJF B;  1FP0 A;  2OXQ C;  2KGI A;  1WEO A;  3SHB A;  5AIT A;  2EA6 A;  2L80 A;  2E6R A;  5FB0 A;  5H9M A;  5J3X A;  4FJC A;  1CHC A;  3T7L A;  3U5O A;  5LKZ A;  2YQM A;  4NN2 A;  2UZG A;  5TAB A;  4UP5 A;  4YAT A;  1T1H A;  2YU4 A;  5JG6 A;  4V3L C;  5AIU A;  4MVT A;  2LGL A;  2VPG A;  3MHS A;  2YSM A;  5FER A;  4WZ3 B;  1WIM A;  3N9M A;  5KH9 A;  4AP4 A;  2CKL B;  4TKP B;  5C13 A;  1U6G B;  1WEN A;  1WEQ A;  2LDR A;  2MD8 C;  4GNE A;  3FL2 A;  2M1R A;  2ECN A;  1JM7 A;  4YAX A;  2KE1 A;  1WGM A;  2K1J A;  1N87 A;  3IHP A;  2L5U A;  2VJE B;  3U5N A;  3O34 A;  3N9L A;  3O7A A;  1Z60 A;  2QJ0 A;  3SOU A;  2ECW A;  2YSJ A;  2G45 A;  4FK5 A;  2HYE D;  4CCG X;  2YYR A;  4A4C A;  5LCW B;  4V3K C;  2G43 A;  3M62 A;  1WEM A;  2I50 A;  3KV6 A;  4R7E A;  4GND A;  5C11 A;  2ECI A;  1WEP A;  2NAA A;  5B79 A;  1FBV A;  2CT2 A;  1BOR A;  2YUR A;  1VYX A;  1HYJ A;  4QF3 A;  3GL6 A;  3EB5 A;  3QZV A;  4AYC B;  2QIZ A;  4N4F A;  3LRQ A;  4WA6 A;  3GV4 A;  4LKA A;  3PHD A;  1HYI A;  2JRJ A;  1MM2 A;  2MIQ A;  4GNF A;  2DX8 A;  1WEV A;  3U5M A;  2KFT A;  5B75 A;  4UP0 A;  3MHH A;  2ECG A;  3O33 A;  2PNX A;  2MNY A;  4YAB A;  3O70 A;  3L1X A;  4XI1 A;  4I7D A;  4CA1 A;  3U5P A;  3I2D A;  5KH3 A;  4B86 C;  3RPG C;  4F52 B;  4R2Y A;  2KRE A;  1G25 A;  4ZDT A;  3ZVY A;  2Y43 A;  3L11 A;  4P5O B;  1K2F A;  2ECT A;  4LLB A;  1WIL A;  3ZPV 1;  3HTK C;  4N3W A;  2LXP C;  2FUU A;  2CSZ A;  4IC2 A;  5B77 A;  2M85 A;  5FB1 A;  2K16 A;  1VD4 A;  2LRI C;  1WES A;  3EB6 A;  5DKA A;  4AYC A;  2LV9 A;  4Q6F A;  2KYU A;  5LKU A;  2MA6 A;  3NG2 A;  3N9Q A;  2G6Q A;  1MM3 A;  2L0B A;  1WFK A;  4YBS A;  2XEU A;  5I3L A;  1DVP A;  2JMI A;  4AVX A;  2K17 A;  3ZNI A;  5DIN A;  4UI9 B;  4A49 A;  1IYM A;  4S3O C;  2MA5 A;  4A4B A;  2ECJ A;  4W4U A;  2H0D A;  2VJF A;  2LQ6 A;  2YHO A;  1Z2Q A;  5B78 A;  5B8D A;  1F62 A;  2KWO A;  3DQV R;  5EYA F;  3LQJ A;  2L43 A;  3C5K A;  3LQH A;  4BHW A;  5G04 B;  5D1L B;  4B7Y C;  1JOC A;  4C9Z A;  3LQI A;  2EOD A;  3N9P A;  3O35 A;  3C6W A;  4BBQ A;  2FUI A;  4ZUX U;  2Y1M A;  3O37 A;  2QIC A;  3SOW A;  4I7B A;  2ZET C;  3PUQ A;  3HCS A;  3KV5 A;  2F6J A;  2CKL A;  2LGK A;  4YBT A;  1LDJ B;  1WE9 A;  2MUM A;  1LDK C;  3ZPV E;  2PUY A;  2VJE A;  4LJN A;  2KU3 A;  3ZVZ B;  4LAD B;  2FSA A;  3HCT A;  2LXH C;  4IC3 A;  2YRE A;  2E6S A;  1X4J A;  3PUR A;  2F6N A;  2VP7 A;  5FEY A;  1WEW A;  2BAY A;  4LK9 A;  2LGG A;  3KNV A;  3ZTG A;  5G0F A;  4MSX A;  4R8P K;  5H1V A;  5KH7 A;  3N9O A;  2HDP A;  4AUQ B;  1X4I A;  3KQI A;  5D1M B;  2ECV A;  5LKT A;  1Z6U A;  2YW8 A;  4GNG A;  2D8S A;  4PPE A;  5TRB A;  3M99 A;  1E4U A;  2KIZ A;  4S3O B;  5TDW A;  3V43 A; 
#chains in the Genus database with same CATH topology
 4L7X A;  1WEE A;  3ZYQ A;  2M6M A;  5B76 A;  3HCU A;  3N9N A;  2YQL A;  2XOY A;  1VFY A;  3O36 A;  4OGC A;  5SVI B;  4A0C D;  3RTR B;  2KGG A;  2EGP A;  1X4U A;  2F42 A;  2M3H A;  2XB1 A;  5H1U A;  5H1T A;  2LN0 A;  2C2V S;  4WZ2 A;  2IDA A;  5SVX A;  3VK6 A;  5G05 B;  1RMD A;  4O64 A;  4WZ0 A;  4I7C A;  2DJA A;  3Q1D A;  5D1K B;  2VNF A;  4L58 A;  2RI7 A;  2XP0 A;  2VPE A;  3L1Z B;  4YAD A;  5TBN A;  3M7K A;  2KWN A;  4ZQL A;  1XWH A;  3SOX A;  5TDR A;  3T6R A;  2LGV A;  4FO9 A;  4YC9 A;  2FFW A;  2YT5 A;  4PTB A;  2K4D A;  2YUC A;  2CSY A;  4GB0 A;  2AN6 A;  2VPB A;  2YHN A;  3KDE C;  2JMJ A;  3RPG B;  5LKX A;  3O47 A;  3M63 A;  2JMD A;  3DWD A;  1V87 A;  2VPD A;  3DPL R;  2MD7 B;  4X3G A;  2MT5 A;  1ZBD B;  2RSD A;  2Y1N A;  4QF2 A;  2KR4 A;  2C2L A;  2KWK A;  3ASL A;  2L75 A;  1JM7 B;  2MNZ A;  4YBM A;  2KWJ A;  1WEU A;  2H0D B;  4FIP A;  2P57 A;  2VJF B;  1FP0 A;  2OXQ C;  4F1P A;  2KGI A;  3LVR E;  1WEO A;  3SHB A;  5AIT A;  2EA6 A;  3T9K A;  2L80 A;  2E6R A;  3MDB C;  5FB0 A;  5H9M A;  5J3X A;  4FJC A;  1CHC A;  3T7L A;  3U5O A;  5LKZ A;  2YQM A;  4NN2 A;  3PLW A;  2UZG A;  5TAB A;  4UP5 A;  4Z0R A;  4YAT A;  3H7H A;  1T1H A;  2YU4 A;  5JG6 A;  2CSV A;  4V3L C;  5AIU A;  4MVT A;  2LGL A;  2VPG A;  3MHS A;  2YSM A;  5FER A;  4WZ3 B;  1WIM A;  3N9M A;  5KH9 A;  3E2D A;  4AP4 A;  2CKL B;  4TKP B;  5C13 A;  1U6G B;  1WEN A;  1WEQ A;  2LDR A;  2YVR A;  2MD8 C;  4GNE A;  3FL2 A;  2M1R A;  2ECN A;  1JM7 A;  2D8U A;  4YAX A;  2KE1 A;  1WGM A;  2K1J A;  1N87 A;  3IHP A;  2L5U A;  2VJE B;  3U5N A;  3O34 A;  3N9L A;  3O7A A;  1Z60 A;  2QJ0 A;  3SOU A;  2ECW A;  2YSJ A;  2G45 A;  4FK5 A;  2HYE D;  4CCG X;  2M13 A;  2YYR A;  4A4C A;  5LCW B;  4V3K C;  2G43 A;  3M62 A;  1WEM A;  2I50 A;  3KV6 A;  2L7P A;  2KKY A;  3FAN A;  4R7E A;  4GND A;  5C11 A;  2ECI A;  2CRR A;  1WEP A;  2NAA A;  5B79 A;  1FBV A;  3DDT A;  1BOR A;  2YUR A;  5SVY A;  1VYX A;  5SVI A;  1HYJ A;  3LJU X;  4QF3 A;  3GL6 A;  3EB5 A;  3QZV A;  4AYC B;  2QIZ A;  4N4F A;  5K3Q A;  3LRQ A;  4WA6 A;  3GV4 A;  4LKA A;  3PHD A;  1HYI A;  2JRJ A;  1MM2 A;  2MIQ A;  4GNF A;  2DX8 A;  1WEV A;  3U5M A;  2KFT A;  5B75 A;  4UP0 A;  3MHH A;  2ECG A;  5TDW A;  3O33 A;  2PNX A;  2MNY A;  4YAB A;  3O70 A;  3L1X A;  4XI1 A;  4I7D A;  4CA1 A;  3U5P A;  3I2D A;  5KH3 A;  4B86 C;  3RPG C;  4F52 B;  4R2Y A;  2KRE A;  1G25 A;  4ZDT A;  3ZVY A;  2Y43 A;  3L11 A;  4P5O B;  1K2F A;  2OWA A;  3LVQ E;  2ECT A;  4LLB A;  1WIL A;  3ZPV 1;  3HTK C;  2FD4 A;  3FAO A;  4N3W A;  2LXP C;  2FUU A;  2CSZ A;  4IC2 A;  5B77 A;  2M85 A;  5FB1 A;  2K16 A;  1VD4 A;  2LRI C;  1WES A;  3EB6 A;  2XOC A;  5DKA A;  2RR4 A;  4AYC A;  2LV9 A;  4Q6F A;  2KYU A;  2CRW A;  2MA6 A;  5LKU A;  3NG2 A;  3N9Q A;  2G6Q A;  1MM3 A;  2L0B A;  1WFK A;  4YBS A;  2XEU A;  5I3L A;  1DVP A;  2JMI A;  4AVX A;  2K17 A;  3ZNI A;  5DIN A;  4UI9 B;  4A49 A;  2XOZ A;  1IYM A;  4S3O C;  2E61 A;  2MA5 A;  4A4B A;  2ECJ A;  4W4U A;  2H0D A;  2VJF A;  3LDY A;  2LQ6 A;  3SUB A;  2YHO A;  4QQ4 A;  3FEH A;  1Z2Q A;  5B78 A;  5B8D A;  1F62 A;  2KWO A;  3DQV R;  4Z0O A;  2IQJ A;  5EYA F;  3LQJ A;  2L43 A;  2JM3 A;  3C5K A;  3LQH A;  4BHW A;  5G04 B;  5D1L B;  4B7Y C;  1JOC A;  4C9Z A;  3LQI A;  2EOD A;  3N9P A;  3O35 A;  3C6W A;  4BBQ A;  2LAU A;  2FUI A;  4ZUX U;  2Y1M A;  3O37 A;  2QIC A;  3SOW A;  2CON A;  4I7B A;  4H9D A;  2ZET C;  3PUQ A;  3HCS A;  2JUN A;  3KV5 A;  2F6J A;  2CKL A;  2LGK A;  4YBT A;  1LDJ B;  2EGM A;  1WE9 A;  1MBM A;  2MUM A;  1LDK C;  3FM8 C;  3ZPV E;  2PUY A;  2VJE A;  4LJN A;  3FJU B;  2KU3 A;  3ZVZ B;  4LAD B;  2FSA A;  3HCT A;  2LXH C;  4IC3 A;  2YRE A;  2E6S A;  1X4J A;  3PUR A;  2F6N A;  3JUE A;  2VP7 A;  5FEY A;  2KKX A;  1WEW A;  2BAY A;  4LK9 A;  2LGG A;  3KNV A;  2B0O E;  3ZTG A;  5G0F A;  4MSX A;  4O62 A;  4R8P K;  5H1V A;  5KH7 A;  3N9O A;  2HDP A;  4AUQ B;  1X4I A;  3KQI A;  5D1M B;  2ECV A;  5LKT A;  1Z6U A;  2YW8 A;  4GNG A;  4OGE A;  2D8S A;  4PPE A;  5TRB A;  3M99 A;  1E4U A;  2KIZ A;  2DSM A;  1DCQ A;  4S3O B;  2MKE A;  2EXU A;  2CT2 A;  3V43 A; 
#chains in the Genus database with same CATH homology
 4L7X A;  1WEE A;  3ZYQ A;  2M6M A;  5B76 A;  3HCU A;  3N9N A;  2YQL A;  1VFY A;  3O36 A;  4A0C D;  3RTR B;  2KGG A;  2EGP A;  1X4U A;  2F42 A;  2M3H A;  2XB1 A;  5H1U A;  5H1T A;  2LN0 A;  2C2V S;  4WZ2 A;  2IDA A;  3VK6 A;  5G05 B;  1RMD A;  4O64 A;  4WZ0 A;  4I7C A;  5D1K B;  2VNF A;  4L58 A;  2RI7 A;  2VPE A;  3L1Z B;  4YAD A;  5TBN A;  2KWN A;  4ZQL A;  1XWH A;  3SOX A;  5TDR A;  3T6R A;  2LGV A;  4FO9 A;  4YC9 A;  2YT5 A;  4PTB A;  2K4D A;  2YUC A;  2CSY A;  4GB0 A;  2AN6 A;  2VPB A;  2YHN A;  2JMJ A;  3RPG B;  5LKX A;  3M63 A;  2JMD A;  1V87 A;  2VPD A;  3DPL R;  2MD7 B;  4X3G A;  2MT5 A;  1ZBD B;  2RSD A;  2Y1N A;  4QF2 A;  2KR4 A;  2C2L A;  2KWK A;  3ASL A;  2L75 A;  1JM7 B;  2MNZ A;  4YBM A;  2KWJ A;  1WEU A;  2H0D B;  4FIP A;  2VJF B;  1FP0 A;  2OXQ C;  2KGI A;  1WEO A;  3SHB A;  5AIT A;  2EA6 A;  2L80 A;  2E6R A;  5FB0 A;  5H9M A;  5J3X A;  4FJC A;  1CHC A;  3T7L A;  3U5O A;  5LKZ A;  2YQM A;  4NN2 A;  2UZG A;  5TAB A;  4UP5 A;  4YAT A;  1T1H A;  2YU4 A;  5JG6 A;  4V3L C;  5AIU A;  4MVT A;  2LGL A;  2VPG A;  3MHS A;  2YSM A;  5FER A;  4WZ3 B;  1WIM A;  3N9M A;  5KH9 A;  4AP4 A;  2CKL B;  4TKP B;  5C13 A;  1U6G B;  1WEN A;  1WEQ A;  2LDR A;  2MD8 C;  4GNE A;  3FL2 A;  2M1R A;  2ECN A;  1JM7 A;  4YAX A;  2KE1 A;  1WGM A;  2K1J A;  1N87 A;  3IHP A;  2L5U A;  2VJE B;  3U5N A;  3O34 A;  3N9L A;  3O7A A;  1Z60 A;  2QJ0 A;  3SOU A;  2ECW A;  2YSJ A;  2G45 A;  4FK5 A;  2HYE D;  4CCG X;  2YYR A;  4A4C A;  5LCW B;  4V3K C;  2G43 A;  3M62 A;  1WEM A;  2I50 A;  3KV6 A;  4R7E A;  4GND A;  5C11 A;  2ECI A;  1WEP A;  2NAA A;  5B79 A;  1FBV A;  2CT2 A;  1BOR A;  2YUR A;  1VYX A;  1HYJ A;  4QF3 A;  3GL6 A;  3EB5 A;  3QZV A;  4AYC B;  2QIZ A;  4N4F A;  3LRQ A;  4WA6 A;  3GV4 A;  4LKA A;  3PHD A;  1HYI A;  2JRJ A;  1MM2 A;  2MIQ A;  4GNF A;  2DX8 A;  1WEV A;  3U5M A;  2KFT A;  5B75 A;  4UP0 A;  3MHH A;  2ECG A;  3O33 A;  2PNX A;  2MNY A;  4YAB A;  3O70 A;  3L1X A;  4XI1 A;  4I7D A;  4CA1 A;  3U5P A;  3I2D A;  5KH3 A;  4B86 C;  3RPG C;  4F52 B;  4R2Y A;  2KRE A;  1G25 A;  4ZDT A;  3ZVY A;  2Y43 A;  3L11 A;  4P5O B;  1K2F A;  2ECT A;  4LLB A;  1WIL A;  3ZPV 1;  3HTK C;  4N3W A;  2LXP C;  2FUU A;  2CSZ A;  4IC2 A;  5B77 A;  2M85 A;  5FB1 A;  2K16 A;  1VD4 A;  2LRI C;  1WES A;  3EB6 A;  5DKA A;  4AYC A;  2LV9 A;  4Q6F A;  2KYU A;  5LKU A;  2MA6 A;  3NG2 A;  3N9Q A;  2G6Q A;  1MM3 A;  2L0B A;  1WFK A;  4YBS A;  2XEU A;  5I3L A;  1DVP A;  2JMI A;  4AVX A;  2K17 A;  3ZNI A;  5DIN A;  4UI9 B;  4A49 A;  1IYM A;  4S3O C;  2MA5 A;  4A4B A;  2ECJ A;  4W4U A;  2H0D A;  2VJF A;  2LQ6 A;  2YHO A;  1Z2Q A;  5B78 A;  5B8D A;  1F62 A;  2KWO A;  3DQV R;  5EYA F;  3LQJ A;  2L43 A;  3C5K A;  3LQH A;  4BHW A;  5G04 B;  5D1L B;  4B7Y C;  1JOC A;  4C9Z A;  3LQI A;  2EOD A;  3N9P A;  3O35 A;  3C6W A;  4BBQ A;  2FUI A;  4ZUX U;  2Y1M A;  3O37 A;  2QIC A;  3SOW A;  4I7B A;  2ZET C;  3PUQ A;  3HCS A;  3KV5 A;  2F6J A;  2CKL A;  2LGK A;  4YBT A;  1LDJ B;  1WE9 A;  2MUM A;  1LDK C;  3ZPV E;  2PUY A;  2VJE A;  4LJN A;  2KU3 A;  3ZVZ B;  4LAD B;  2FSA A;  3HCT A;  2LXH C;  4IC3 A;  2YRE A;  2E6S A;  1X4J A;  3PUR A;  2F6N A;  2VP7 A;  5FEY A;  1WEW A;  2BAY A;  4LK9 A;  2LGG A;  3KNV A;  3ZTG A;  5G0F A;  4MSX A;  4R8P K;  5H1V A;  5KH7 A;  3N9O A;  2HDP A;  4AUQ B;  1X4I A;  3KQI A;  5D1M B;  2ECV A;  5LKT A;  1Z6U A;  2YW8 A;  4GNG A;  2D8S A;  4PPE A;  5TRB A;  3M99 A;  1E4U A;  2KIZ A;  4S3O B;  5TDW A;  3V43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...