2VNFA

Molecular basis of histone h3k4me3 recognition by ing4
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis of Histone H3K4Me3 Recognition by Ing4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords INHIBITOR OF GROWTH PROTEIN 4
total genus 7
structure length 50
sequence length 50
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vnfA00
4YABA 3HCSA 1WEMA 3RPGB 3L11A 3O33A 2PNXA 5TABA 2KFTA 4NN2A 1FBVA 2E6RA 2VPGA 4A4BA 4ZQLA 2C2LA 2VJFB 4CA1A 4R7EA 3KV5A 3DPLR 5D1MB 2KWJA 3PUQA 2MD8C 4BHWA 2CKLB 4S3OB 4S3OC 5LKXA 2QIZA 2NAAA 2LQ6A 4GNGA 2LGGA 3T6RA 1JOCA 5D1KB 4WZ0A 4LKAA 4MSXA 4WZ3B 2KWKA 2YT5A 4W4UA 1WEUA 2H0DB 4YC9A 4YAXA 5TDRA 3O36A 2JMJA 2EGPA 4PPEA 2RSDA 3O37A 4V3LC 4AUQB 2ECWA 2DX8A 3U5PA 5TDWA 2HYED 2M3HA 3PHDA 4IC2A 4AP4A 3O35A 2L0BA 3U5NA 1WE9A 5B76A 3V43A 4QF2A 2KWNA 1WEOA 4LLBA 3N9PA 2H0DA 3RPGC 3U5MA 2ECTA 4UI9B 5EYAF 2F42A 2LRIC 4FO9A 3QZVA 4YADA 2BAYA 3EB6A 4BBQA 1V87A 2ECNA 2MNYA 4FK5A 4GB0A 2K4DA 2M1RA 1CHCA 1JM7A 2M85A 2CSZA 4L7XA 4I7DA 4WA6A 1WEVA 4FJCA 4WZ2A 1X4UA 3HTKC 1K2FA 1VYXA 2K1JA 3ZNIA 3LRQA 3O34A 3M99A 3O7AA 3EB5A 3GV4A 5KH7A 3ZTGA 2L5UA 2YREA 2MNZA 3N9QA 2OXQC 1FP0A 1HYIA 1U6GB 1ZBDB 2FSAA 2LGKA 2VNFA 2I50A 4A4CA 2XEUA 2PUYA 5KH3A 1IYMA 1Z60A 5C11A 3KNVA 5LCWB 4YBMA 2ECVA 4GNDA 3FL2A 2YW8A 2KYUA 1HYJA 5H1TA 3SOXA 4CCGX 5C13A 4O64A 2YQMA 1WEEA 2UZGA 5FB0A 2CT2A 4MVTA 3LQHA 3DQVR 2MD7B 4LADB 2MT5A 1WFKA 2JRJA 2EA6A 3GL6A 1RMDA 2VJEA 5B77A 1XWHA 4YBTA 2VPEA 2G43A 3ZVZB 2HDPA 2L43A 4L58A 4XI1A 2KWOA 2LXPC 2MIQA 4UP0A 5J3XA 3MHSA 3N9MA 1LDJB 3SHBA 5KH9A 5G04B 3VK6A 2YHNA 1LDKC 4YATA 3T7LA 3PURA 5DKAA 1WENA 4QF3A 5DINA 5G05B 5B75A 3ASLA 2ECIA 2JMDA 3IHPA 2KGGA 2QJ0A 1X4IA 1Z6UA 1WEPA 2G6QA 1BORA 4F52B 4GNFA 2L80A 5B8DA 4AYCB 5FEYA 5H1VA 1N87A 2YYRA 4I7BA 2ZETC 3LQJA 3HCUA 4V3KC 3C6WA 4N3WA 2ECJA 2VJFA 5LKUA 2M6MA 3ZPV1 3N9OA 3O70A 1T1HA 3C5KA 2YUCA 5LKZA 3L1ZB 2C2VS 5I3LA 1WEWA 4R2YA 5LKTA 5G0FA 4R8PK 2F6NA 2L75A 4A49A 4AVXA 2FUIA 3ZPVE 2K17A 1WIMA 4YBSA 2ECGA 3U5OA 2VJEB 2KREA 2MA6A 3N9LA 1VFYA 3ZYQA 4IC3A 4I7CA 1X4JA 4PTBA 1F62A 2LDRA 3L1XA 1WESA 2D8SA 2K16A 2YURA 4X3GA 2MA5A 5TRBA 2KR4A 1MM2A 2MUMA 2LV9A 4N4FA 2LXHC 5AITA 1E4UA 2KU3A 1Z2QA 2Y1NA 4AYCA 4B86C 5H9MA 5FB1A 2YSJA 1DVPA 2F6JA 2KIZA 4UP5A 5B79A 3MHHA 2XB1A 1WGMA 2IDAA 2YU4A 1JM7B 3KQIA 2Y1MA 2LN0A 1WEQA 4B7YC 2EODA 1G25A 4LJNA 5FERA 3I2DA 4GNEA 5H1UA 4LK9A 3M62A 2YQLA 5AIUA 2CSYA 4P5OB 2Y43A 4FIPA 1MM3A 3RTRB 2E6SA 4A0CD 2JMIA 3KV6A 2YHOA 2AN6A 4TKPB 1WILA 4Q6FA 4C9ZA 3LQIA 3ZVYA 2CKLA 2G45A 3M63A 2VPDA 3SOWA 3HCTA 4ZUXU 3SOUA 5JG6A 2KE1A 2QICA 3N9NA 2KGIA 5B78A 3NG2A 5TBNA 2LGLA 2VP7A 4ZDTA 2RI7A 5D1LB 2LGVA 2VPBA 2YSMA 2FUUA 1VD4A
chains in the Genus database with same CATH superfamily
4YABA 3HCSA 3M7KA 1WEMA 3RPGB 3L11A 3O33A 2PNXA 5TABA 5SVXA 2KFTA 4NN2A 4Z0RA 1FBVA 2E6RA 2VPGA 4A4BA 4ZQLA 2C2LA 2VJFB 3T9KA 4CA1A 4R7EA 3KV5A 3DPLR 5D1MB 2KWJA 3PUQA 2MD8C 4BHWA 2EXUA 2CKLB 3LVQE 4S3OB 4S3OC 5LKXA 2QIZA 2NAAA 2LQ6A 4GNGA 2LGGA 3T6RA 1JOCA 5D1KB 4WZ0A 4LKAA 4MSXA 3E2DA 4WZ3B 2KWKA 2YT5A 4W4UA 3PLWA 1WEUA 2H0DB 4YC9A 4YAXA 5TDRA 3O36A 2JMJA 2EGPA 4PPEA 2RSDA 3O37A 4V3LC 4AUQB 2ECWA 2DX8A 3U5PA 5TDWA 2HYED 2M3HA 3PHDA 4IC2A 3O35A 4AP4A 2L0BA 3U5NA 1WE9A 5B76A 3V43A 4QF2A 2KWNA 1WEOA 4LLBA 3N9PA 2H0DA 3RPGC 3U5MA 2ECTA 4UI9B 5EYAF 2F42A 2LRIC 4FO9A 3QZVA 4YADA 2BAYA 3EB6A 4BBQA 1V87A 2ECNA 2MNYA 4FK5A 4GB0A 2OWAA 2K4DA 2M1RA 3FJUB 1CHCA 1JM7A 2M85A 2CSZA 4L7XA 4I7DA 3KDEC 4WA6A 1WEVA 4FJCA 4WZ2A 1X4UA 2JUNA 2P57A 3HTKC 1K2FA 1VYXA 5SVYA 2K1JA 2M13A 3ZNIA 3FM8C 3LRQA 4O62A 2B0OE 3O34A 3M99A 3O7AA 3EB5A 3GV4A 5KH7A 3ZTGA 2L5UA 2YREA 2YVRA 2MNZA 3N9QA 2OXQC 1FP0A 1HYIA 1U6GB 1ZBDB 2FSAA 2LGKA 2VNFA 2I50A 4A4CA 2XEUA 2PUYA 5KH3A 1IYMA 1Z60A 5C11A 2E61A 3KNVA 5LCWB 4YBMA 2ECVA 4GNDA 3FL2A 2YW8A 2KYUA 2D8UA 1HYJA 5H1TA 3SOXA 4CCGX 5C13A 2XOYA 4O64A 2LAUA 2KKYA 2EGMA 2YQMA 1WEEA 2UZGA 5FB0A 2CT2A 4MVTA 2L7PA 3LQHA 3DQVR 2KKXA 2MD7B 4LADB 2MT5A 1WFKA 2JRJA 2EA6A 3GL6A 1RMDA 2VJEA 5B77A 1XWHA 4YBTA 2VPEA 2G43A 5SVIA 3ZVZB 2HDPA 2L43A 4L58A 4XI1A 2KWOA 2LXPC 2MIQA 5SVIB 4UP0A 5J3XA 3MHSA 3N9MA 1LDJB 5G04B 5KH9A 3SHBA 3VK6A 2YHNA 1LDKC 4YATA 3T7LA 3PURA 4Z0OA 3LVRE 5DKAA 1WENA 4QF3A 1MBMA 5DINA 5G05B 5B75A 2CRWA 3ASLA 2ECIA 2JMDA 3IHPA 2KGGA 3DDTA 2CSVA 2DJAA 2QJ0A 1X4IA 1Z6UA 1WEPA 2G6QA 1BORA 4F52B 4GNFA 2L80A 2CONA 4AYCB 5FEYA 5H1VA 5B8DA 1N87A 2YYRA 4I7BA 2ZETC 3LQJA 3HCUA 4V3KC 3LJUX 3C6WA 4N3WA 2ECJA 2VJFA 5LKUA 2M6MA 3ZPV1 3N9OA 3O70A 1T1HA 3C5KA 2YUCA 5LKZA 3L1ZB 2C2VS 5I3LA 1WEWA 4R2YA 5LKTA 5G0FA 2FFWA 4R8PK 1DCQA 2F6NA 2L75A 4A49A 3FANA 4AVXA 3SUBA 2FUIA 3ZPVE 4OGEA 3DWDA 2K17A 1WIMA 4YBSA 2ECGA 3U5OA 2VJEB 2KREA 2MA6A 3N9LA 1VFYA 3ZYQA 4IC3A 4I7CA 1X4JA 4PTBA 1F62A 2LDRA 3L1XA 2XOZA 3MDBC 1WESA 2D8SA 2K16A 2YURA 2FD4A 4X3GA 2MA5A 2XOCA 5TRBA 2KR4A 1MM2A 2MUMA 2LV9A 2MKEA 4N4FA 2LXHC 5AITA 1E4UA 2DSMA 3FAOA 2KU3A 1Z2QA 2Y1NA 4AYCA 2JM3A 4B86C 5H9MA 5FB1A 2YSJA 1DVPA 2F6JA 2KIZA 4UP5A 3Q1DA 5B79A 3MHHA 2XB1A 1WGMA 3FEHA 2IDAA 2YU4A 4H9DA 1JM7B 3KQIA 2Y1MA 2LN0A 1WEQA 4B7YC 2EODA 1G25A 4LJNA 5FERA 3I2DA 4GNEA 5H1UA 4LK9A 3M62A 2YQLA 5AIUA 3LDYA 2CSYA 4P5OB 2Y43A 4FIPA 3JUEA 1MM3A 3RTRB 2E6SA 2JMIA 4A0CD 3KV6A 2YHOA 2AN6A 4TKPB 1WILA 2CRRA 4Q6FA 4C9ZA 3LQIA 2XP0A 3H7HA 3ZVYA 2CKLA 2G45A 2IQJA 3M63A 2VPDA 3SOWA 3HCTA 4ZUXU 3SOUA 5JG6A 2KE1A 2QICA 4QQ4A 3N9NA 2KGIA 5B78A 3NG2A 5TBNA 2LGLA 2VP7A 2RR4A 4ZDTA 2RI7A 4OGCA 5D1LB 2LGVA 5K3QA 2VPBA 2YSMA 2FUUA 4F1PA 1VD4A 3O47A
chains in the Genus database with same CATH topology
4YABA 3HCSA 1WEMA 3RPGB 3L11A 3O33A 2PNXA 5TABA 2KFTA 4NN2A 1FBVA 2E6RA 2VPGA 4A4BA 4ZQLA 2C2LA 2VJFB 4CA1A 4R7EA 3KV5A 3DPLR 5D1MB 2KWJA 3PUQA 2MD8C 4BHWA 2CKLB 4S3OB 4S3OC 5LKXA 2QIZA 2NAAA 2LQ6A 4GNGA 2LGGA 3T6RA 1JOCA 5D1KB 4WZ0A 4LKAA 4MSXA 4WZ3B 2KWKA 2YT5A 4W4UA 1WEUA 2H0DB 4YC9A 4YAXA 5TDRA 3O36A 2JMJA 2EGPA 4PPEA 2RSDA 3O37A 4V3LC 4AUQB 2ECWA 2DX8A 3U5PA 5TDWA 2HYED 2M3HA 3PHDA 4IC2A 4AP4A 3O35A 2L0BA 3U5NA 1WE9A 5B76A 3V43A 4QF2A 2KWNA 1WEOA 4LLBA 3N9PA 2H0DA 3RPGC 3U5MA 2ECTA 4UI9B 5EYAF 2F42A 2LRIC 4FO9A 3QZVA 4YADA 2BAYA 3EB6A 4BBQA 1V87A 2ECNA 2MNYA 4FK5A 4GB0A 2K4DA 2M1RA 1CHCA 1JM7A 2M85A 2CSZA 4L7XA 4I7DA 4WA6A 1WEVA 4FJCA 4WZ2A 1X4UA 3HTKC 1K2FA 1VYXA 2K1JA 3ZNIA 3LRQA 3O34A 3M99A 3O7AA 3EB5A 3GV4A 5KH7A 3ZTGA 2L5UA 2YREA 2MNZA 3N9QA 2OXQC 1FP0A 1HYIA 1U6GB 1ZBDB 2FSAA 2LGKA 2VNFA 2I50A 4A4CA 2XEUA 2PUYA 5KH3A 1IYMA 1Z60A 5C11A 3KNVA 5LCWB 4YBMA 2ECVA 4GNDA 3FL2A 2YW8A 2KYUA 1HYJA 5H1TA 3SOXA 4CCGX 5C13A 4O64A 2YQMA 1WEEA 2UZGA 5FB0A 2CT2A 4MVTA 3LQHA 3DQVR 2MD7B 4LADB 2MT5A 1WFKA 2JRJA 2EA6A 3GL6A 1RMDA 2VJEA 5B77A 1XWHA 4YBTA 2VPEA 2G43A 3ZVZB 2HDPA 2L43A 4L58A 4XI1A 2KWOA 2LXPC 2MIQA 4UP0A 5J3XA 3MHSA 3N9MA 1LDJB 3SHBA 5KH9A 5G04B 3VK6A 2YHNA 1LDKC 4YATA 3T7LA 3PURA 5DKAA 1WENA 4QF3A 5DINA 5G05B 5B75A 3ASLA 2ECIA 2JMDA 3IHPA 2KGGA 2QJ0A 1X4IA 1Z6UA 1WEPA 2G6QA 1BORA 4F52B 4GNFA 2L80A 5B8DA 4AYCB 5FEYA 5H1VA 1N87A 2YYRA 4I7BA 2ZETC 3LQJA 3HCUA 4V3KC 3C6WA 4N3WA 2ECJA 2VJFA 5LKUA 2M6MA 3ZPV1 3N9OA 3O70A 1T1HA 3C5KA 2YUCA 5LKZA 3L1ZB 2C2VS 5I3LA 1WEWA 4R2YA 5LKTA 5G0FA 4R8PK 2F6NA 2L75A 4A49A 4AVXA 2FUIA 3ZPVE 2K17A 1WIMA 4YBSA 2ECGA 3U5OA 2VJEB 2KREA 2MA6A 3N9LA 1VFYA 3ZYQA 4IC3A 4I7CA 1X4JA 4PTBA 1F62A 2LDRA 3L1XA 1WESA 2D8SA 2K16A 2YURA 4X3GA 2MA5A 5TRBA 2KR4A 1MM2A 2MUMA 2LV9A 4N4FA 2LXHC 5AITA 1E4UA 2KU3A 1Z2QA 2Y1NA 4AYCA 4B86C 5H9MA 5FB1A 2YSJA 1DVPA 2F6JA 2KIZA 4UP5A 5B79A 3MHHA 2XB1A 1WGMA 2IDAA 2YU4A 1JM7B 3KQIA 2Y1MA 2LN0A 1WEQA 4B7YC 2EODA 1G25A 4LJNA 5FERA 3I2DA 4GNEA 5H1UA 4LK9A 3M62A 2YQLA 5AIUA 2CSYA 4P5OB 2Y43A 4FIPA 1MM3A 3RTRB 2E6SA 4A0CD 2JMIA 3KV6A 2YHOA 2AN6A 4TKPB 1WILA 4Q6FA 4C9ZA 3LQIA 3ZVYA 2CKLA 2G45A 3M63A 2VPDA 3SOWA 3HCTA 4ZUXU 3SOUA 5JG6A 2KE1A 2QICA 3N9NA 2KGIA 5B78A 3NG2A 5TBNA 2LGLA 2VP7A 4ZDTA 2RI7A 5D1LB 2LGVA 2VPBA 2YSMA 2FUUA 1VD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAB A;  3HCS A;  1WEM A;  3RPG B;  3L11 A;  3O33 A;  2PNX A;  5TAB A;  2KFT A;  4NN2 A;  1FBV A;  2E6R A;  2VPG A;  4A4B A;  4ZQL A;  2C2L A;  2VJF B;  4CA1 A;  4R7E A;  3KV5 A;  3DPL R;  5D1M B;  2KWJ A;  3PUQ A;  2MD8 C;  4BHW A;  2CKL B;  4S3O B;  4S3O C;  5LKX A;  2QIZ A;  2NAA A;  2LQ6 A;  4GNG A;  2LGG A;  3T6R A;  1JOC A;  5D1K B;  4WZ0 A;  4LKA A;  4MSX A;  4WZ3 B;  2KWK A;  2YT5 A;  4W4U A;  1WEU A;  2H0D B;  4YC9 A;  4YAX A;  5TDR A;  3O36 A;  2JMJ A;  2EGP A;  4PPE A;  2RSD A;  3O37 A;  4V3L C;  4AUQ B;  2ECW A;  2DX8 A;  3U5P A;  5TDW A;  2HYE D;  2M3H A;  3PHD A;  4IC2 A;  4AP4 A;  3O35 A;  2L0B A;  3U5N A;  1WE9 A;  5B76 A;  3V43 A;  4QF2 A;  2KWN A;  1WEO A;  4LLB A;  3N9P A;  2H0D A;  3RPG C;  3U5M A;  2ECT A;  4UI9 B;  5EYA F;  2F42 A;  2LRI C;  4FO9 A;  3QZV A;  4YAD A;  2BAY A;  3EB6 A;  4BBQ A;  1V87 A;  2ECN A;  2MNY A;  4FK5 A;  4GB0 A;  2K4D A;  2M1R A;  1CHC A;  1JM7 A;  2M85 A;  2CSZ A;  4L7X A;  4I7D A;  4WA6 A;  1WEV A;  4FJC A;  4WZ2 A;  1X4U A;  3HTK C;  1K2F A;  1VYX A;  2K1J A;  3ZNI A;  3LRQ A;  3O34 A;  3M99 A;  3O7A A;  3EB5 A;  3GV4 A;  5KH7 A;  3ZTG A;  2L5U A;  2YRE A;  2MNZ A;  3N9Q A;  2OXQ C;  1FP0 A;  1HYI A;  1U6G B;  1ZBD B;  2FSA A;  2LGK A;  2VNF A;  2I50 A;  4A4C A;  2XEU A;  2PUY A;  5KH3 A;  1IYM A;  1Z60 A;  5C11 A;  3KNV A;  5LCW B;  4YBM A;  2ECV A;  4GND A;  3FL2 A;  2YW8 A;  2KYU A;  1HYJ A;  5H1T A;  3SOX A;  4CCG X;  5C13 A;  4O64 A;  2YQM A;  1WEE A;  2UZG A;  5FB0 A;  2CT2 A;  4MVT A;  3LQH A;  3DQV R;  2MD7 B;  4LAD B;  2MT5 A;  1WFK A;  2JRJ A;  2EA6 A;  3GL6 A;  1RMD A;  2VJE A;  5B77 A;  1XWH A;  4YBT A;  2VPE A;  2G43 A;  3ZVZ B;  2HDP A;  2L43 A;  4L58 A;  4XI1 A;  2KWO A;  2LXP C;  2MIQ A;  4UP0 A;  5J3X A;  3MHS A;  3N9M A;  1LDJ B;  3SHB A;  5KH9 A;  5G04 B;  3VK6 A;  2YHN A;  1LDK C;  4YAT A;  3T7L A;  3PUR A;  5DKA A;  1WEN A;  4QF3 A;  5DIN A;  5G05 B;  5B75 A;  3ASL A;  2ECI A;  2JMD A;  3IHP A;  2KGG A;  2QJ0 A;  1X4I A;  1Z6U A;  1WEP A;  2G6Q A;  1BOR A;  4F52 B;  4GNF A;  2L80 A;  5B8D A;  4AYC B;  5FEY A;  5H1V A;  1N87 A;  2YYR A;  4I7B A;  2ZET C;  3LQJ A;  3HCU A;  4V3K C;  3C6W A;  4N3W A;  2ECJ A;  2VJF A;  5LKU A;  2M6M A;  3ZPV 1;  3N9O A;  3O70 A;  1T1H A;  3C5K A;  2YUC A;  5LKZ A;  3L1Z B;  2C2V S;  5I3L A;  1WEW A;  4R2Y A;  5LKT A;  5G0F A;  4R8P K;  2F6N A;  2L75 A;  4A49 A;  4AVX A;  2FUI A;  3ZPV E;  2K17 A;  1WIM A;  4YBS A;  2ECG A;  3U5O A;  2VJE B;  2KRE A;  2MA6 A;  3N9L A;  1VFY A;  3ZYQ A;  4IC3 A;  4I7C A;  1X4J A;  4PTB A;  1F62 A;  2LDR A;  3L1X A;  1WES A;  2D8S A;  2K16 A;  2YUR A;  4X3G A;  2MA5 A;  5TRB A;  2KR4 A;  1MM2 A;  2MUM A;  2LV9 A;  4N4F A;  2LXH C;  5AIT A;  1E4U A;  2KU3 A;  1Z2Q A;  2Y1N A;  4AYC A;  4B86 C;  5H9M A;  5FB1 A;  2YSJ A;  1DVP A;  2F6J A;  2KIZ A;  4UP5 A;  5B79 A;  3MHH A;  2XB1 A;  1WGM A;  2IDA A;  2YU4 A;  1JM7 B;  3KQI A;  2Y1M A;  2LN0 A;  1WEQ A;  4B7Y C;  2EOD A;  1G25 A;  4LJN A;  5FER A;  3I2D A;  4GNE A;  5H1U A;  4LK9 A;  3M62 A;  2YQL A;  5AIU A;  2CSY A;  4P5O B;  2Y43 A;  4FIP A;  1MM3 A;  3RTR B;  2E6S A;  4A0C D;  2JMI A;  3KV6 A;  2YHO A;  2AN6 A;  4TKP B;  1WIL A;  4Q6F A;  4C9Z A;  3LQI A;  3ZVY A;  2CKL A;  2G45 A;  3M63 A;  2VPD A;  3SOW A;  3HCT A;  4ZUX U;  3SOU A;  5JG6 A;  2KE1 A;  2QIC A;  3N9N A;  2KGI A;  5B78 A;  3NG2 A;  5TBN A;  2LGL A;  2VP7 A;  4ZDT A;  2RI7 A;  5D1L B;  2LGV A;  2VPB A;  2YSM A;  2FUU A;  1VD4 A; 
#chains in the Genus database with same CATH topology
 4YAB A;  3HCS A;  3M7K A;  1WEM A;  3RPG B;  3L11 A;  3O33 A;  2PNX A;  5TAB A;  5SVX A;  2KFT A;  4NN2 A;  4Z0R A;  1FBV A;  2E6R A;  2VPG A;  4A4B A;  4ZQL A;  2C2L A;  2VJF B;  3T9K A;  4CA1 A;  4R7E A;  3KV5 A;  3DPL R;  5D1M B;  2KWJ A;  3PUQ A;  2MD8 C;  4BHW A;  2EXU A;  2CKL B;  3LVQ E;  4S3O B;  4S3O C;  5LKX A;  2QIZ A;  2NAA A;  2LQ6 A;  4GNG A;  2LGG A;  3T6R A;  1JOC A;  5D1K B;  4WZ0 A;  4LKA A;  4MSX A;  3E2D A;  4WZ3 B;  2KWK A;  2YT5 A;  4W4U A;  3PLW A;  1WEU A;  2H0D B;  4YC9 A;  4YAX A;  5TDR A;  3O36 A;  2JMJ A;  2EGP A;  4PPE A;  2RSD A;  3O37 A;  4V3L C;  4AUQ B;  2ECW A;  2DX8 A;  3U5P A;  5TDW A;  2HYE D;  2M3H A;  3PHD A;  4IC2 A;  3O35 A;  4AP4 A;  2L0B A;  3U5N A;  1WE9 A;  5B76 A;  3V43 A;  4QF2 A;  2KWN A;  1WEO A;  4LLB A;  3N9P A;  2H0D A;  3RPG C;  3U5M A;  2ECT A;  4UI9 B;  5EYA F;  2F42 A;  2LRI C;  4FO9 A;  3QZV A;  4YAD A;  2BAY A;  3EB6 A;  4BBQ A;  1V87 A;  2ECN A;  2MNY A;  4FK5 A;  4GB0 A;  2OWA A;  2K4D A;  2M1R A;  3FJU B;  1CHC A;  1JM7 A;  2M85 A;  2CSZ A;  4L7X A;  4I7D A;  3KDE C;  4WA6 A;  1WEV A;  4FJC A;  4WZ2 A;  1X4U A;  2JUN A;  2P57 A;  3HTK C;  1K2F A;  1VYX A;  5SVY A;  2K1J A;  2M13 A;  3ZNI A;  3FM8 C;  3LRQ A;  4O62 A;  2B0O E;  3O34 A;  3M99 A;  3O7A A;  3EB5 A;  3GV4 A;  5KH7 A;  3ZTG A;  2L5U A;  2YRE A;  2YVR A;  2MNZ A;  3N9Q A;  2OXQ C;  1FP0 A;  1HYI A;  1U6G B;  1ZBD B;  2FSA A;  2LGK A;  2VNF A;  2I50 A;  4A4C A;  2XEU A;  2PUY A;  5KH3 A;  1IYM A;  1Z60 A;  5C11 A;  2E61 A;  3KNV A;  5LCW B;  4YBM A;  2ECV A;  4GND A;  3FL2 A;  2YW8 A;  2KYU A;  2D8U A;  1HYJ A;  5H1T A;  3SOX A;  4CCG X;  5C13 A;  2XOY A;  4O64 A;  2LAU A;  2KKY A;  2EGM A;  2YQM A;  1WEE A;  2UZG A;  5FB0 A;  2CT2 A;  4MVT A;  2L7P A;  3LQH A;  3DQV R;  2KKX A;  2MD7 B;  4LAD B;  2MT5 A;  1WFK A;  2JRJ A;  2EA6 A;  3GL6 A;  1RMD A;  2VJE A;  5B77 A;  1XWH A;  4YBT A;  2VPE A;  2G43 A;  5SVI A;  3ZVZ B;  2HDP A;  2L43 A;  4L58 A;  4XI1 A;  2KWO A;  2LXP C;  2MIQ A;  5SVI B;  4UP0 A;  5J3X A;  3MHS A;  3N9M A;  1LDJ B;  5G04 B;  5KH9 A;  3SHB A;  3VK6 A;  2YHN A;  1LDK C;  4YAT A;  3T7L A;  3PUR A;  4Z0O A;  3LVR E;  5DKA A;  1WEN A;  4QF3 A;  1MBM A;  5DIN A;  5G05 B;  5B75 A;  2CRW A;  3ASL A;  2ECI A;  2JMD A;  3IHP A;  2KGG A;  3DDT A;  2CSV A;  2DJA A;  2QJ0 A;  1X4I A;  1Z6U A;  1WEP A;  2G6Q A;  1BOR A;  4F52 B;  4GNF A;  2L80 A;  2CON A;  4AYC B;  5FEY A;  5H1V A;  5B8D A;  1N87 A;  2YYR A;  4I7B A;  2ZET C;  3LQJ A;  3HCU A;  4V3K C;  3LJU X;  3C6W A;  4N3W A;  2ECJ A;  2VJF A;  5LKU A;  2M6M A;  3ZPV 1;  3N9O A;  3O70 A;  1T1H A;  3C5K A;  2YUC A;  5LKZ A;  3L1Z B;  2C2V S;  5I3L A;  1WEW A;  4R2Y A;  5LKT A;  5G0F A;  2FFW A;  4R8P K;  1DCQ A;  2F6N A;  2L75 A;  4A49 A;  3FAN A;  4AVX A;  3SUB A;  2FUI A;  3ZPV E;  4OGE A;  3DWD A;  2K17 A;  1WIM A;  4YBS A;  2ECG A;  3U5O A;  2VJE B;  2KRE A;  2MA6 A;  3N9L A;  1VFY A;  3ZYQ A;  4IC3 A;  4I7C A;  1X4J A;  4PTB A;  1F62 A;  2LDR A;  3L1X A;  2XOZ A;  3MDB C;  1WES A;  2D8S A;  2K16 A;  2YUR A;  2FD4 A;  4X3G A;  2MA5 A;  2XOC A;  5TRB A;  2KR4 A;  1MM2 A;  2MUM A;  2LV9 A;  2MKE A;  4N4F A;  2LXH C;  5AIT A;  1E4U A;  2DSM A;  3FAO A;  2KU3 A;  1Z2Q A;  2Y1N A;  4AYC A;  2JM3 A;  4B86 C;  5H9M A;  5FB1 A;  2YSJ A;  1DVP A;  2F6J A;  2KIZ A;  4UP5 A;  3Q1D A;  5B79 A;  3MHH A;  2XB1 A;  1WGM A;  3FEH A;  2IDA A;  2YU4 A;  4H9D A;  1JM7 B;  3KQI A;  2Y1M A;  2LN0 A;  1WEQ A;  4B7Y C;  2EOD A;  1G25 A;  4LJN A;  5FER A;  3I2D A;  4GNE A;  5H1U A;  4LK9 A;  3M62 A;  2YQL A;  5AIU A;  3LDY A;  2CSY A;  4P5O B;  2Y43 A;  4FIP A;  3JUE A;  1MM3 A;  3RTR B;  2E6S A;  2JMI A;  4A0C D;  3KV6 A;  2YHO A;  2AN6 A;  4TKP B;  1WIL A;  2CRR A;  4Q6F A;  4C9Z A;  3LQI A;  2XP0 A;  3H7H A;  3ZVY A;  2CKL A;  2G45 A;  2IQJ A;  3M63 A;  2VPD A;  3SOW A;  3HCT A;  4ZUX U;  3SOU A;  5JG6 A;  2KE1 A;  2QIC A;  4QQ4 A;  3N9N A;  2KGI A;  5B78 A;  3NG2 A;  5TBN A;  2LGL A;  2VP7 A;  2RR4 A;  4ZDT A;  2RI7 A;  4OGC A;  5D1L B;  2LGV A;  5K3Q A;  2VPB A;  2YSM A;  2FUU A;  4F1P A;  1VD4 A;  3O47 A; 
#chains in the Genus database with same CATH homology
 4YAB A;  3HCS A;  1WEM A;  3RPG B;  3L11 A;  3O33 A;  2PNX A;  5TAB A;  2KFT A;  4NN2 A;  1FBV A;  2E6R A;  2VPG A;  4A4B A;  4ZQL A;  2C2L A;  2VJF B;  4CA1 A;  4R7E A;  3KV5 A;  3DPL R;  5D1M B;  2KWJ A;  3PUQ A;  2MD8 C;  4BHW A;  2CKL B;  4S3O B;  4S3O C;  5LKX A;  2QIZ A;  2NAA A;  2LQ6 A;  4GNG A;  2LGG A;  3T6R A;  1JOC A;  5D1K B;  4WZ0 A;  4LKA A;  4MSX A;  4WZ3 B;  2KWK A;  2YT5 A;  4W4U A;  1WEU A;  2H0D B;  4YC9 A;  4YAX A;  5TDR A;  3O36 A;  2JMJ A;  2EGP A;  4PPE A;  2RSD A;  3O37 A;  4V3L C;  4AUQ B;  2ECW A;  2DX8 A;  3U5P A;  5TDW A;  2HYE D;  2M3H A;  3PHD A;  4IC2 A;  4AP4 A;  3O35 A;  2L0B A;  3U5N A;  1WE9 A;  5B76 A;  3V43 A;  4QF2 A;  2KWN A;  1WEO A;  4LLB A;  3N9P A;  2H0D A;  3RPG C;  3U5M A;  2ECT A;  4UI9 B;  5EYA F;  2F42 A;  2LRI C;  4FO9 A;  3QZV A;  4YAD A;  2BAY A;  3EB6 A;  4BBQ A;  1V87 A;  2ECN A;  2MNY A;  4FK5 A;  4GB0 A;  2K4D A;  2M1R A;  1CHC A;  1JM7 A;  2M85 A;  2CSZ A;  4L7X A;  4I7D A;  4WA6 A;  1WEV A;  4FJC A;  4WZ2 A;  1X4U A;  3HTK C;  1K2F A;  1VYX A;  2K1J A;  3ZNI A;  3LRQ A;  3O34 A;  3M99 A;  3O7A A;  3EB5 A;  3GV4 A;  5KH7 A;  3ZTG A;  2L5U A;  2YRE A;  2MNZ A;  3N9Q A;  2OXQ C;  1FP0 A;  1HYI A;  1U6G B;  1ZBD B;  2FSA A;  2LGK A;  2VNF A;  2I50 A;  4A4C A;  2XEU A;  2PUY A;  5KH3 A;  1IYM A;  1Z60 A;  5C11 A;  3KNV A;  5LCW B;  4YBM A;  2ECV A;  4GND A;  3FL2 A;  2YW8 A;  2KYU A;  1HYJ A;  5H1T A;  3SOX A;  4CCG X;  5C13 A;  4O64 A;  2YQM A;  1WEE A;  2UZG A;  5FB0 A;  2CT2 A;  4MVT A;  3LQH A;  3DQV R;  2MD7 B;  4LAD B;  2MT5 A;  1WFK A;  2JRJ A;  2EA6 A;  3GL6 A;  1RMD A;  2VJE A;  5B77 A;  1XWH A;  4YBT A;  2VPE A;  2G43 A;  3ZVZ B;  2HDP A;  2L43 A;  4L58 A;  4XI1 A;  2KWO A;  2LXP C;  2MIQ A;  4UP0 A;  5J3X A;  3MHS A;  3N9M A;  1LDJ B;  3SHB A;  5KH9 A;  5G04 B;  3VK6 A;  2YHN A;  1LDK C;  4YAT A;  3T7L A;  3PUR A;  5DKA A;  1WEN A;  4QF3 A;  5DIN A;  5G05 B;  5B75 A;  3ASL A;  2ECI A;  2JMD A;  3IHP A;  2KGG A;  2QJ0 A;  1X4I A;  1Z6U A;  1WEP A;  2G6Q A;  1BOR A;  4F52 B;  4GNF A;  2L80 A;  5B8D A;  4AYC B;  5FEY A;  5H1V A;  1N87 A;  2YYR A;  4I7B A;  2ZET C;  3LQJ A;  3HCU A;  4V3K C;  3C6W A;  4N3W A;  2ECJ A;  2VJF A;  5LKU A;  2M6M A;  3ZPV 1;  3N9O A;  3O70 A;  1T1H A;  3C5K A;  2YUC A;  5LKZ A;  3L1Z B;  2C2V S;  5I3L A;  1WEW A;  4R2Y A;  5LKT A;  5G0F A;  4R8P K;  2F6N A;  2L75 A;  4A49 A;  4AVX A;  2FUI A;  3ZPV E;  2K17 A;  1WIM A;  4YBS A;  2ECG A;  3U5O A;  2VJE B;  2KRE A;  2MA6 A;  3N9L A;  1VFY A;  3ZYQ A;  4IC3 A;  4I7C A;  1X4J A;  4PTB A;  1F62 A;  2LDR A;  3L1X A;  1WES A;  2D8S A;  2K16 A;  2YUR A;  4X3G A;  2MA5 A;  5TRB A;  2KR4 A;  1MM2 A;  2MUM A;  2LV9 A;  4N4F A;  2LXH C;  5AIT A;  1E4U A;  2KU3 A;  1Z2Q A;  2Y1N A;  4AYC A;  4B86 C;  5H9M A;  5FB1 A;  2YSJ A;  1DVP A;  2F6J A;  2KIZ A;  4UP5 A;  5B79 A;  3MHH A;  2XB1 A;  1WGM A;  2IDA A;  2YU4 A;  1JM7 B;  3KQI A;  2Y1M A;  2LN0 A;  1WEQ A;  4B7Y C;  2EOD A;  1G25 A;  4LJN A;  5FER A;  3I2D A;  4GNE A;  5H1U A;  4LK9 A;  3M62 A;  2YQL A;  5AIU A;  2CSY A;  4P5O B;  2Y43 A;  4FIP A;  1MM3 A;  3RTR B;  2E6S A;  4A0C D;  2JMI A;  3KV6 A;  2YHO A;  2AN6 A;  4TKP B;  1WIL A;  4Q6F A;  4C9Z A;  3LQI A;  3ZVY A;  2CKL A;  2G45 A;  3M63 A;  2VPD A;  3SOW A;  3HCT A;  4ZUX U;  3SOU A;  5JG6 A;  2KE1 A;  2QIC A;  3N9N A;  2KGI A;  5B78 A;  3NG2 A;  5TBN A;  2LGL A;  2VP7 A;  4ZDT A;  2RI7 A;  5D1L B;  2LGV A;  2VPB A;  2YSM A;  2FUU A;  1VD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...