2VNFA

Molecular basis of histone h3k4me3 recognition by ing4
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
b'EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INHIBITOR OF GROWTH PROTEIN 4
molecule tags Cell cycle
source organism Homo sapiens
publication title Molecular Basis of Histone H3K4Me3 Recognition by Ing4
pubmed doi rcsb
total genus 7
structure length 50
sequence length 50
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vnfA00
5JG6A 1Z60A 1X4JA 2CSZA 2L0BA 1K2FA 4LK9A 1MM2A 1VD4A 1WEMA 2MIQA 2PNXA 4P5OB 2E6RA 3O33A 3DPLR 4YABA 2QICA 2AN6A 3RPGB 2Y1MA 3U5NA 2HDPA 2CSYA 1RMDA 1VYXA 3GV4A 2D8SA 5B76A 4ZUXU 1T1HA 2K17A 2LGKA 3N9LA 3ZTGA 3O35A 2ECNA 4PPEA 3O7AA 4XI1A 5FERA 2M3HA 5D1MB 4R2YA 4TKPB 1X4UA 4YC9A 1Z2QA 4BHWA 5LKXA 4IC2A 4YBSA 2RSDA 4BBQA 1IYMA 4GB0A 3FL2A 2LGLA 5KH3A 2XB1A 1CHCA 2ZETC 3ZNIA 2L75A 3HCUA 3ZPVE 4FK5A 1WE9A 2YYRA 3U5PA 2C2LA 2LGVA 3PHDA 4V3LC 3LQIA 4GNDA 4C9ZA 5EYAF 2VJFB 5FEYA 4NN2A 2YW8A 2MD8C 2LDRA 2L43A 2YQLA 4GNGA 2JMJA 3O70A 2MA6A 2LXPC 2KWOA 1WEQA 3L1ZB 4LKAA 5TRBA 3PUQA 3O34A 2BAYA 2VPBA 4YAXA 3V43A 3ZVZB 2JMDA 3N9PA 2VP7A 2FSAA 2VPEA 3L1XA 3SOWA 4AUQB 5TBNA 1WILA 3M99A 4CA1A 2CKLB 4YBMA 2F6NA 1N87A 1HYIA 5TDRA 2KR4A 1JM7B 1FP0A 4I7BA 4WA6A 3I2DA 3DQVR 1HYJA 2ECVA 4AP4A 2LXHC 3QZVA 2ECTA 2YQMA 1Z6UA 3M63A 3T6RA 5G0FA 2QJ0A 3EB6A 3N9QA 2K1JA 5TDWA 2MT5A 3KQIA 4QF3A 4QF2A 4AVXA 5FB1A 2L5UA 3C5KA 2G45A 5KH9A 2XEUA 3RPGC 2ECWA 3O37A 4A0CD 3HCTA 4L58A 5G04B 5LKTA 1VFYA 2H0DA 2CT2A 2H0DB 3GL6A 4FJCA 4YATA 4A49A 5KH7A 5AITA 4S3OB 5LKUA 4A4CA 2KWJA 4LADB 4WZ0A 2KFTA 4ZQLA 2LN0A 2YSJA 2HYED 2ECJA 2LGGA 1FBVA 2M1RA 2PUYA 4LLBA 2KE1A 3ZYQA 4S3OC 2EODA 2KWNA 2I50A 4WZ2A 2OXQC 2L80A 4W4UA 3MHSA 1WGMA 2YREA 5TABA 2IDAA 3LRQA 4V3KC 2C2VS 4A4BA 3ZVYA 1WEEA 4B7YC 4B86C 3PURA 3N9MA 2ECGA 5B78A 4R8PK 5J3XA 4AYCA 4R7EA 3T7LA 1WESA 1WEPA 5B75A 1LDJB 4LJNA 1V87A 1JM7A 5LKZA 5H1VA 2MA5A 2KU3A 4YADA 3RTRB 3ZPV1 1WIMA 2LRIC 1G25A 2KYUA 2FUIA 2QIZA 1WFKA 3SHBA 3L11A 2YHNA 2EA6A 5C13A 2RI7A 2YSMA 2KGGA 2EGPA 4IC3A 1DVPA 2FUUA 5LCWB 5H1TA 2F6JA 5FB0A 1XWHA 2VPDA 4AYCB 1JOCA 2LV9A 5D1KB 1WEVA 2MNYA 3U5MA 5C11A 1WEOA 2VJEB 2M6MA 3HCSA 2KIZA 3SOXA 2JMIA 3VK6A 5DKAA 2CKLA 3M62A 2KWKA 2VPGA 4L7XA 4FO9A 5G05B 3KV6A 2G43A 2NAAA 2F42A 4UP5A 3N9NA 2Y1NA 1WEWA 2YT5A 5H9MA 3LQJA 2LQ6A 1LDKC 1X4IA 4N4FA 4MSXA 1U6GB 3O36A 4I7CA 3IHPA 3NG2A 3KV5A 2DX8A 4FIPA 5B79A 4N3WA 4PTBA 4UI9B 1F62A 2VNFA 2VJEA 5I3LA 5AIUA 3C6WA 5D1LB 4X3GA 3SOUA 4GNEA 2YUCA 2MD7B 3U5OA 4UP0A 2K16A 3N9OA 2VJFA 4ZDTA 2YHOA 2JRJA 4I7DA 1WEUA 2YU4A 5B8DA 2MUMA 2Y43A 2ECIA 5B77A 2UZGA 4YBTA 1WENA 1BORA 5DINA 3MHHA 3ASLA 2G6QA 5H1UA 2KREA 2M85A 4MVTA 2E6SA 2KGIA 3HTKC 2MNZA 1E4UA 4CCGX 4O64A 4WZ3B 4Q6FA 1ZBDB 1MM3A 4GNFA 2YURA 4F52B 3KNVA 2K4DA 3EB5A 3LQHA
chains in the Genus database with same CATH superfamily
5JG6A 2OWAA 1Z60A 1X4JA 2CSZA 2DJAA 1K2FA 2L0BA 4LK9A 2RR4A 2CRRA 1MM2A 1VD4A 2E61A 1WEMA 2MIQA 2PNXA 4P5OB 2E6RA 3O33A 3DPLR 4YABA 2QICA 2KKXA 2AN6A 3RPGB 2Y1MA 3Q1DA 3U5NA 2HDPA 2CSYA 1RMDA 3LVQE 1VYXA 3GV4A 2D8SA 5B76A 4O62A 4ZUXU 2XOCA 1T1HA 2K17A 2LGKA 3N9LA 3ZTGA 3O35A 2KKYA 2ECNA 4PPEA 3O7AA 4XI1A 5FERA 2M3HA 3LVRE 5D1MB 4R2YA 4TKPB 1X4UA 2CONA 4YC9A 1Z2QA 4BHWA 5LKXA 4IC2A 4YBSA 2RSDA 4BBQA 1IYMA 4GB0A 3FL2A 3MDBC 2LGLA 5KH3A 2XB1A 1CHCA 2ZETC 3ZNIA 2L75A 3HCUA 3ZPVE 4FK5A 1WE9A 2YYRA 3U5PA 2C2LA 2LAUA 2LGVA 3PHDA 4V3LC 3LQIA 4GNDA 4C9ZA 5EYAF 2VJFB 5FEYA 4NN2A 2YW8A 2MD8C 2LDRA 2L43A 2YQLA 4GNGA 2B0OE 2JMJA 3O70A 2MA6A 2LXPC 2KWOA 2MKEA 1WEQA 4OGEA 3L1ZB 4LKAA 5TRBA 3PUQA 3O34A 2BAYA 2VPBA 4YAXA 3V43A 3ZVZB 2JMDA 3N9PA 2VP7A 5SVXA 2EGMA 2FSAA 1DCQA 2VPEA 3L1XA 3SOWA 4AUQB 5TBNA 1WILA 2CSVA 3M99A 4CA1A 2CKLB 4YBMA 3DDTA 3T9KA 2DSMA 2F6NA 4OGCA 1N87A 1HYIA 5TDRA 2KR4A 1JM7B 1FP0A 4I7BA 3O47A 4WA6A 3I2DA 3DQVR 1HYJA 2ECVA 4AP4A 2LXHC 2P57A 3QZVA 2ECTA 2YQMA 1Z6UA 3M63A 3T6RA 3LDYA 5G0FA 5SVYA 2QJ0A 3EB6A 3LJUX 3N9QA 2K1JA 5TDWA 2MT5A 3KQIA 4QF3A 4QF2A 4AVXA 5FB1A 2L5UA 4H9DA 3C5KA 2G45A 5KH9A 2XEUA 3RPGC 2XOYA 2ECWA 3O37A 4A0CD 3HCTA 4L58A 5G04B 5LKTA 1VFYA 5SVIB 2H0DA 2CT2A 2H0DB 3GL6A 4FJCA 4YATA 4A49A 5KH7A 5AITA 4S3OB 5LKUA 3H7HA 4A4CA 2KWJA 4LADB 2FFWA 4WZ0A 2KFTA 4ZQLA 2LN0A 2YSJA 2HYED 2XP0A 2ECJA 2LGGA 1FBVA 2M1RA 2PUYA 4LLBA 2KE1A 5K3QA 3ZYQA 4S3OC 2EODA 2KWNA 2I50A 4WZ2A 2OXQC 2L80A 4W4UA 3MHSA 1WGMA 3FAOA 2YREA 5TABA 2IDAA 3LRQA 4V3KC 2C2VS 4A4BA 3ZVYA 1WEEA 4B7YC 4B86C 3PURA 4F1PA 3N9MA 2YVRA 3M7KA 2ECGA 3FJUB 5B78A 2L7PA 4R8PK 5J3XA 4AYCA 4R7EA 3T7LA 1WESA 1WEPA 5B75A 1LDJB 4LJNA 1V87A 1JM7A 5LKZA 5H1VA 2MA5A 2KU3A 2D8UA 4YADA 3RTRB 3ZPV1 1WIMA 2LRIC 1G25A 2KYUA 2FUIA 2QIZA 1WFKA 3SHBA 3L11A 2YHNA 2EA6A 5C13A 4QQ4A 2RI7A 2YSMA 2KGGA 3SUBA 2EGPA 4IC3A 1DVPA 4Z0OA 2FUUA 3E2DA 3PLWA 5SVIA 5LCWB 5H1TA 2F6JA 5FB0A 1XWHA 2VPDA 4AYCB 1JOCA 2LV9A 5D1KB 1WEVA 2MNYA 3U5MA 5C11A 2IQJA 1WEOA 2VJEB 3FM8C 2M6MA 3HCSA 2KIZA 3SOXA 2JMIA 3VK6A 2FD4A 5DKAA 2CKLA 3M62A 2KWKA 2VPGA 4L7XA 4FO9A 5G05B 2JM3A 3KV6A 2G43A 2NAAA 2F42A 4UP5A 3N9NA 2JUNA 2Y1NA 1WEWA 2YT5A 5H9MA 3LQJA 2XOZA 2LQ6A 1LDKC 1X4IA 4N4FA 4MSXA 1U6GB 3O36A 4I7CA 3IHPA 3NG2A 3KV5A 2DX8A 4FIPA 5B79A 4N3WA 4PTBA 4UI9B 1F62A 2VNFA 2VJEA 5I3LA 5AIUA 3C6WA 5D1LB 4X3GA 4Z0RA 3SOUA 4GNEA 2YUCA 2MD7B 3U5OA 4UP0A 2K16A 3N9OA 2VJFA 4ZDTA 2M13A 2YHOA 2JRJA 4I7DA 3DWDA 2CRWA 1WEUA 2YU4A 5B8DA 1MBMA 2EXUA 2MUMA 2Y43A 3FANA 2ECIA 5B77A 2UZGA 4YBTA 1WENA 1BORA 3FEHA 5DINA 3MHHA 3ASLA 2G6QA 5H1UA 2KREA 2M85A 4MVTA 2E6SA 2KGIA 3HTKC 2MNZA 1E4UA 3JUEA 4CCGX 4O64A 4WZ3B 4Q6FA 1ZBDB 1MM3A 4GNFA 2YURA 4F52B 3KNVA 3KDEC 2K4DA 3EB5A 3LQHA
chains in the Genus database with same CATH topology
5JG6A 1Z60A 1X4JA 2CSZA 2L0BA 1K2FA 4LK9A 1MM2A 1VD4A 1WEMA 2MIQA 2PNXA 4P5OB 2E6RA 3O33A 3DPLR 4YABA 2QICA 2AN6A 3RPGB 2Y1MA 3U5NA 2HDPA 2CSYA 1RMDA 1VYXA 3GV4A 2D8SA 5B76A 4ZUXU 1T1HA 2K17A 2LGKA 3N9LA 3ZTGA 3O35A 2ECNA 4PPEA 3O7AA 4XI1A 5FERA 2M3HA 5D1MB 4R2YA 4TKPB 1X4UA 4YC9A 1Z2QA 4BHWA 5LKXA 4IC2A 4YBSA 2RSDA 4BBQA 1IYMA 4GB0A 3FL2A 2LGLA 5KH3A 2XB1A 1CHCA 2ZETC 3ZNIA 2L75A 3HCUA 3ZPVE 4FK5A 1WE9A 2YYRA 3U5PA 2C2LA 2LGVA 3PHDA 4V3LC 3LQIA 4GNDA 4C9ZA 5EYAF 2VJFB 5FEYA 4NN2A 2YW8A 2MD8C 2LDRA 2L43A 2YQLA 4GNGA 2JMJA 3O70A 2MA6A 2LXPC 2KWOA 1WEQA 3L1ZB 4LKAA 5TRBA 3PUQA 3O34A 2BAYA 2VPBA 4YAXA 3V43A 3ZVZB 2JMDA 3N9PA 2VP7A 2FSAA 2VPEA 3L1XA 3SOWA 4AUQB 5TBNA 1WILA 3M99A 4CA1A 2CKLB 4YBMA 2F6NA 1N87A 1HYIA 5TDRA 2KR4A 1JM7B 1FP0A 4I7BA 4WA6A 3I2DA 3DQVR 1HYJA 2ECVA 4AP4A 2LXHC 3QZVA 2ECTA 2YQMA 1Z6UA 3M63A 3T6RA 5G0FA 2QJ0A 3EB6A 3N9QA 2K1JA 5TDWA 2MT5A 3KQIA 4QF3A 4QF2A 4AVXA 5FB1A 2L5UA 3C5KA 2G45A 5KH9A 2XEUA 3RPGC 2ECWA 3O37A 4A0CD 3HCTA 4L58A 5G04B 5LKTA 1VFYA 2H0DA 2CT2A 2H0DB 3GL6A 4FJCA 4YATA 4A49A 5KH7A 5AITA 4S3OB 5LKUA 4A4CA 2KWJA 4LADB 4WZ0A 2KFTA 4ZQLA 2LN0A 2YSJA 2HYED 2ECJA 2LGGA 1FBVA 2M1RA 2PUYA 4LLBA 2KE1A 3ZYQA 4S3OC 2EODA 2KWNA 2I50A 4WZ2A 2OXQC 2L80A 4W4UA 3MHSA 1WGMA 2YREA 5TABA 2IDAA 3LRQA 4V3KC 2C2VS 4A4BA 3ZVYA 1WEEA 4B7YC 4B86C 3PURA 3N9MA 2ECGA 5B78A 4R8PK 5J3XA 4AYCA 4R7EA 3T7LA 1WESA 1WEPA 5B75A 1LDJB 4LJNA 1V87A 1JM7A 5LKZA 5H1VA 2MA5A 2KU3A 4YADA 3RTRB 3ZPV1 1WIMA 2LRIC 1G25A 2KYUA 2FUIA 2QIZA 1WFKA 3SHBA 3L11A 2YHNA 2EA6A 5C13A 2RI7A 2YSMA 2KGGA 2EGPA 4IC3A 1DVPA 2FUUA 5LCWB 5H1TA 2F6JA 5FB0A 1XWHA 2VPDA 4AYCB 1JOCA 2LV9A 5D1KB 1WEVA 2MNYA 3U5MA 5C11A 1WEOA 2VJEB 2M6MA 3HCSA 2KIZA 3SOXA 2JMIA 3VK6A 5DKAA 2CKLA 3M62A 2KWKA 2VPGA 4L7XA 4FO9A 5G05B 3KV6A 2G43A 2NAAA 2F42A 4UP5A 3N9NA 2Y1NA 1WEWA 2YT5A 5H9MA 3LQJA 2LQ6A 1LDKC 1X4IA 4N4FA 4MSXA 1U6GB 3O36A 4I7CA 3IHPA 3NG2A 3KV5A 2DX8A 4FIPA 5B79A 4N3WA 4PTBA 4UI9B 1F62A 2VNFA 2VJEA 5I3LA 5AIUA 3C6WA 5D1LB 4X3GA 3SOUA 4GNEA 2YUCA 2MD7B 3U5OA 4UP0A 2K16A 3N9OA 2VJFA 4ZDTA 2YHOA 2JRJA 4I7DA 1WEUA 2YU4A 5B8DA 2MUMA 2Y43A 2ECIA 5B77A 2UZGA 4YBTA 1WENA 1BORA 5DINA 3MHHA 3ASLA 2G6QA 5H1UA 2KREA 2M85A 4MVTA 2E6SA 2KGIA 3HTKC 2MNZA 1E4UA 4CCGX 4O64A 4WZ3B 4Q6FA 1ZBDB 1MM3A 4GNFA 2YURA 4F52B 3KNVA 2K4DA 3EB5A 3LQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JG6 A;  1Z60 A;  1X4J A;  2CSZ A;  2L0B A;  1K2F A;  4LK9 A;  1MM2 A;  1VD4 A;  1WEM A;  2MIQ A;  2PNX A;  4P5O B;  2E6R A;  3O33 A;  3DPL R;  4YAB A;  2QIC A;  2AN6 A;  3RPG B;  2Y1M A;  3U5N A;  2HDP A;  2CSY A;  1RMD A;  1VYX A;  3GV4 A;  2D8S A;  5B76 A;  4ZUX U;  1T1H A;  2K17 A;  2LGK A;  3N9L A;  3ZTG A;  3O35 A;  2ECN A;  4PPE A;  3O7A A;  4XI1 A;  5FER A;  2M3H A;  5D1M B;  4R2Y A;  4TKP B;  1X4U A;  4YC9 A;  1Z2Q A;  4BHW A;  5LKX A;  4IC2 A;  4YBS A;  2RSD A;  4BBQ A;  1IYM A;  4GB0 A;  3FL2 A;  2LGL A;  5KH3 A;  2XB1 A;  1CHC A;  2ZET C;  3ZNI A;  2L75 A;  3HCU A;  3ZPV E;  4FK5 A;  1WE9 A;  2YYR A;  3U5P A;  2C2L A;  2LGV A;  3PHD A;  4V3L C;  3LQI A;  4GND A;  4C9Z A;  5EYA F;  2VJF B;  5FEY A;  4NN2 A;  2YW8 A;  2MD8 C;  2LDR A;  2L43 A;  2YQL A;  4GNG A;  2JMJ A;  3O70 A;  2MA6 A;  2LXP C;  2KWO A;  1WEQ A;  3L1Z B;  4LKA A;  5TRB A;  3PUQ A;  3O34 A;  2BAY A;  2VPB A;  4YAX A;  3V43 A;  3ZVZ B;  2JMD A;  3N9P A;  2VP7 A;  2FSA A;  2VPE A;  3L1X A;  3SOW A;  4AUQ B;  5TBN A;  1WIL A;  3M99 A;  4CA1 A;  2CKL B;  4YBM A;  2F6N A;  1N87 A;  1HYI A;  5TDR A;  2KR4 A;  1JM7 B;  1FP0 A;  4I7B A;  4WA6 A;  3I2D A;  3DQV R;  1HYJ A;  2ECV A;  4AP4 A;  2LXH C;  3QZV A;  2ECT A;  2YQM A;  1Z6U A;  3M63 A;  3T6R A;  5G0F A;  2QJ0 A;  3EB6 A;  3N9Q A;  2K1J A;  5TDW A;  2MT5 A;  3KQI A;  4QF3 A;  4QF2 A;  4AVX A;  5FB1 A;  2L5U A;  3C5K A;  2G45 A;  5KH9 A;  2XEU A;  3RPG C;  2ECW A;  3O37 A;  4A0C D;  3HCT A;  4L58 A;  5G04 B;  5LKT A;  1VFY A;  2H0D A;  2CT2 A;  2H0D B;  3GL6 A;  4FJC A;  4YAT A;  4A49 A;  5KH7 A;  5AIT A;  4S3O B;  5LKU A;  4A4C A;  2KWJ A;  4LAD B;  4WZ0 A;  2KFT A;  4ZQL A;  2LN0 A;  2YSJ A;  2HYE D;  2ECJ A;  2LGG A;  1FBV A;  2M1R A;  2PUY A;  4LLB A;  2KE1 A;  3ZYQ A;  4S3O C;  2EOD A;  2KWN A;  2I50 A;  4WZ2 A;  2OXQ C;  2L80 A;  4W4U A;  3MHS A;  1WGM A;  2YRE A;  5TAB A;  2IDA A;  3LRQ A;  4V3K C;  2C2V S;  4A4B A;  3ZVY A;  1WEE A;  4B7Y C;  4B86 C;  3PUR A;  3N9M A;  2ECG A;  5B78 A;  4R8P K;  5J3X A;  4AYC A;  4R7E A;  3T7L A;  1WES A;  1WEP A;  5B75 A;  1LDJ B;  4LJN A;  1V87 A;  1JM7 A;  5LKZ A;  5H1V A;  2MA5 A;  2KU3 A;  4YAD A;  3RTR B;  3ZPV 1;  1WIM A;  2LRI C;  1G25 A;  2KYU A;  2FUI A;  2QIZ A;  1WFK A;  3SHB A;  3L11 A;  2YHN A;  2EA6 A;  5C13 A;  2RI7 A;  2YSM A;  2KGG A;  2EGP A;  4IC3 A;  1DVP A;  2FUU A;  5LCW B;  5H1T A;  2F6J A;  5FB0 A;  1XWH A;  2VPD A;  4AYC B;  1JOC A;  2LV9 A;  5D1K B;  1WEV A;  2MNY A;  3U5M A;  5C11 A;  1WEO A;  2VJE B;  2M6M A;  3HCS A;  2KIZ A;  3SOX A;  2JMI A;  3VK6 A;  5DKA A;  2CKL A;  3M62 A;  2KWK A;  2VPG A;  4L7X A;  4FO9 A;  5G05 B;  3KV6 A;  2G43 A;  2NAA A;  2F42 A;  4UP5 A;  3N9N A;  2Y1N A;  1WEW A;  2YT5 A;  5H9M A;  3LQJ A;  2LQ6 A;  1LDK C;  1X4I A;  4N4F A;  4MSX A;  1U6G B;  3O36 A;  4I7C A;  3IHP A;  3NG2 A;  3KV5 A;  2DX8 A;  4FIP A;  5B79 A;  4N3W A;  4PTB A;  4UI9 B;  1F62 A;  2VNF A;  2VJE A;  5I3L A;  5AIU A;  3C6W A;  5D1L B;  4X3G A;  3SOU A;  4GNE A;  2YUC A;  2MD7 B;  3U5O A;  4UP0 A;  2K16 A;  3N9O A;  2VJF A;  4ZDT A;  2YHO A;  2JRJ A;  4I7D A;  1WEU A;  2YU4 A;  5B8D A;  2MUM A;  2Y43 A;  2ECI A;  5B77 A;  2UZG A;  4YBT A;  1WEN A;  1BOR A;  5DIN A;  3MHH A;  3ASL A;  2G6Q A;  5H1U A;  2KRE A;  2M85 A;  4MVT A;  2E6S A;  2KGI A;  3HTK C;  2MNZ A;  1E4U A;  4CCG X;  4O64 A;  4WZ3 B;  4Q6F A;  1ZBD B;  1MM3 A;  4GNF A;  2YUR A;  4F52 B;  3KNV A;  2K4D A;  3EB5 A;  3LQH A; 
#chains in the Genus database with same CATH topology
 5JG6 A;  2OWA A;  1Z60 A;  1X4J A;  2CSZ A;  2DJA A;  1K2F A;  2L0B A;  4LK9 A;  2RR4 A;  2CRR A;  1MM2 A;  1VD4 A;  2E61 A;  1WEM A;  2MIQ A;  2PNX A;  4P5O B;  2E6R A;  3O33 A;  3DPL R;  4YAB A;  2QIC A;  2KKX A;  2AN6 A;  3RPG B;  2Y1M A;  3Q1D A;  3U5N A;  2HDP A;  2CSY A;  1RMD A;  3LVQ E;  1VYX A;  3GV4 A;  2D8S A;  5B76 A;  4O62 A;  4ZUX U;  2XOC A;  1T1H A;  2K17 A;  2LGK A;  3N9L A;  3ZTG A;  3O35 A;  2KKY A;  2ECN A;  4PPE A;  3O7A A;  4XI1 A;  5FER A;  2M3H A;  3LVR E;  5D1M B;  4R2Y A;  4TKP B;  1X4U A;  2CON A;  4YC9 A;  1Z2Q A;  4BHW A;  5LKX A;  4IC2 A;  4YBS A;  2RSD A;  4BBQ A;  1IYM A;  4GB0 A;  3FL2 A;  3MDB C;  2LGL A;  5KH3 A;  2XB1 A;  1CHC A;  2ZET C;  3ZNI A;  2L75 A;  3HCU A;  3ZPV E;  4FK5 A;  1WE9 A;  2YYR A;  3U5P A;  2C2L A;  2LAU A;  2LGV A;  3PHD A;  4V3L C;  3LQI A;  4GND A;  4C9Z A;  5EYA F;  2VJF B;  5FEY A;  4NN2 A;  2YW8 A;  2MD8 C;  2LDR A;  2L43 A;  2YQL A;  4GNG A;  2B0O E;  2JMJ A;  3O70 A;  2MA6 A;  2LXP C;  2KWO A;  2MKE A;  1WEQ A;  4OGE A;  3L1Z B;  4LKA A;  5TRB A;  3PUQ A;  3O34 A;  2BAY A;  2VPB A;  4YAX A;  3V43 A;  3ZVZ B;  2JMD A;  3N9P A;  2VP7 A;  5SVX A;  2EGM A;  2FSA A;  1DCQ A;  2VPE A;  3L1X A;  3SOW A;  4AUQ B;  5TBN A;  1WIL A;  2CSV A;  3M99 A;  4CA1 A;  2CKL B;  4YBM A;  3DDT A;  3T9K A;  2DSM A;  2F6N A;  4OGC A;  1N87 A;  1HYI A;  5TDR A;  2KR4 A;  1JM7 B;  1FP0 A;  4I7B A;  3O47 A;  4WA6 A;  3I2D A;  3DQV R;  1HYJ A;  2ECV A;  4AP4 A;  2LXH C;  2P57 A;  3QZV A;  2ECT A;  2YQM A;  1Z6U A;  3M63 A;  3T6R A;  3LDY A;  5G0F A;  5SVY A;  2QJ0 A;  3EB6 A;  3LJU X;  3N9Q A;  2K1J A;  5TDW A;  2MT5 A;  3KQI A;  4QF3 A;  4QF2 A;  4AVX A;  5FB1 A;  2L5U A;  4H9D A;  3C5K A;  2G45 A;  5KH9 A;  2XEU A;  3RPG C;  2XOY A;  2ECW A;  3O37 A;  4A0C D;  3HCT A;  4L58 A;  5G04 B;  5LKT A;  1VFY A;  5SVI B;  2H0D A;  2CT2 A;  2H0D B;  3GL6 A;  4FJC A;  4YAT A;  4A49 A;  5KH7 A;  5AIT A;  4S3O B;  5LKU A;  3H7H A;  4A4C A;  2KWJ A;  4LAD B;  2FFW A;  4WZ0 A;  2KFT A;  4ZQL A;  2LN0 A;  2YSJ A;  2HYE D;  2XP0 A;  2ECJ A;  2LGG A;  1FBV A;  2M1R A;  2PUY A;  4LLB A;  2KE1 A;  5K3Q A;  3ZYQ A;  4S3O C;  2EOD A;  2KWN A;  2I50 A;  4WZ2 A;  2OXQ C;  2L80 A;  4W4U A;  3MHS A;  1WGM A;  3FAO A;  2YRE A;  5TAB A;  2IDA A;  3LRQ A;  4V3K C;  2C2V S;  4A4B A;  3ZVY A;  1WEE A;  4B7Y C;  4B86 C;  3PUR A;  4F1P A;  3N9M A;  2YVR A;  3M7K A;  2ECG A;  3FJU B;  5B78 A;  2L7P A;  4R8P K;  5J3X A;  4AYC A;  4R7E A;  3T7L A;  1WES A;  1WEP A;  5B75 A;  1LDJ B;  4LJN A;  1V87 A;  1JM7 A;  5LKZ A;  5H1V A;  2MA5 A;  2KU3 A;  2D8U A;  4YAD A;  3RTR B;  3ZPV 1;  1WIM A;  2LRI C;  1G25 A;  2KYU A;  2FUI A;  2QIZ A;  1WFK A;  3SHB A;  3L11 A;  2YHN A;  2EA6 A;  5C13 A;  4QQ4 A;  2RI7 A;  2YSM A;  2KGG A;  3SUB A;  2EGP A;  4IC3 A;  1DVP A;  4Z0O A;  2FUU A;  3E2D A;  3PLW A;  5SVI A;  5LCW B;  5H1T A;  2F6J A;  5FB0 A;  1XWH A;  2VPD A;  4AYC B;  1JOC A;  2LV9 A;  5D1K B;  1WEV A;  2MNY A;  3U5M A;  5C11 A;  2IQJ A;  1WEO A;  2VJE B;  3FM8 C;  2M6M A;  3HCS A;  2KIZ A;  3SOX A;  2JMI A;  3VK6 A;  2FD4 A;  5DKA A;  2CKL A;  3M62 A;  2KWK A;  2VPG A;  4L7X A;  4FO9 A;  5G05 B;  2JM3 A;  3KV6 A;  2G43 A;  2NAA A;  2F42 A;  4UP5 A;  3N9N A;  2JUN A;  2Y1N A;  1WEW A;  2YT5 A;  5H9M A;  3LQJ A;  2XOZ A;  2LQ6 A;  1LDK C;  1X4I A;  4N4F A;  4MSX A;  1U6G B;  3O36 A;  4I7C A;  3IHP A;  3NG2 A;  3KV5 A;  2DX8 A;  4FIP A;  5B79 A;  4N3W A;  4PTB A;  4UI9 B;  1F62 A;  2VNF A;  2VJE A;  5I3L A;  5AIU A;  3C6W A;  5D1L B;  4X3G A;  4Z0R A;  3SOU A;  4GNE A;  2YUC A;  2MD7 B;  3U5O A;  4UP0 A;  2K16 A;  3N9O A;  2VJF A;  4ZDT A;  2M13 A;  2YHO A;  2JRJ A;  4I7D A;  3DWD A;  2CRW A;  1WEU A;  2YU4 A;  5B8D A;  1MBM A;  2EXU A;  2MUM A;  2Y43 A;  3FAN A;  2ECI A;  5B77 A;  2UZG A;  4YBT A;  1WEN A;  1BOR A;  3FEH A;  5DIN A;  3MHH A;  3ASL A;  2G6Q A;  5H1U A;  2KRE A;  2M85 A;  4MVT A;  2E6S A;  2KGI A;  3HTK C;  2MNZ A;  1E4U A;  3JUE A;  4CCG X;  4O64 A;  4WZ3 B;  4Q6F A;  1ZBD B;  1MM3 A;  4GNF A;  2YUR A;  4F52 B;  3KNV A;  3KDE C;  2K4D A;  3EB5 A;  3LQH A; 
#chains in the Genus database with same CATH homology
 5JG6 A;  1Z60 A;  1X4J A;  2CSZ A;  2L0B A;  1K2F A;  4LK9 A;  1MM2 A;  1VD4 A;  1WEM A;  2MIQ A;  2PNX A;  4P5O B;  2E6R A;  3O33 A;  3DPL R;  4YAB A;  2QIC A;  2AN6 A;  3RPG B;  2Y1M A;  3U5N A;  2HDP A;  2CSY A;  1RMD A;  1VYX A;  3GV4 A;  2D8S A;  5B76 A;  4ZUX U;  1T1H A;  2K17 A;  2LGK A;  3N9L A;  3ZTG A;  3O35 A;  2ECN A;  4PPE A;  3O7A A;  4XI1 A;  5FER A;  2M3H A;  5D1M B;  4R2Y A;  4TKP B;  1X4U A;  4YC9 A;  1Z2Q A;  4BHW A;  5LKX A;  4IC2 A;  4YBS A;  2RSD A;  4BBQ A;  1IYM A;  4GB0 A;  3FL2 A;  2LGL A;  5KH3 A;  2XB1 A;  1CHC A;  2ZET C;  3ZNI A;  2L75 A;  3HCU A;  3ZPV E;  4FK5 A;  1WE9 A;  2YYR A;  3U5P A;  2C2L A;  2LGV A;  3PHD A;  4V3L C;  3LQI A;  4GND A;  4C9Z A;  5EYA F;  2VJF B;  5FEY A;  4NN2 A;  2YW8 A;  2MD8 C;  2LDR A;  2L43 A;  2YQL A;  4GNG A;  2JMJ A;  3O70 A;  2MA6 A;  2LXP C;  2KWO A;  1WEQ A;  3L1Z B;  4LKA A;  5TRB A;  3PUQ A;  3O34 A;  2BAY A;  2VPB A;  4YAX A;  3V43 A;  3ZVZ B;  2JMD A;  3N9P A;  2VP7 A;  2FSA A;  2VPE A;  3L1X A;  3SOW A;  4AUQ B;  5TBN A;  1WIL A;  3M99 A;  4CA1 A;  2CKL B;  4YBM A;  2F6N A;  1N87 A;  1HYI A;  5TDR A;  2KR4 A;  1JM7 B;  1FP0 A;  4I7B A;  4WA6 A;  3I2D A;  3DQV R;  1HYJ A;  2ECV A;  4AP4 A;  2LXH C;  3QZV A;  2ECT A;  2YQM A;  1Z6U A;  3M63 A;  3T6R A;  5G0F A;  2QJ0 A;  3EB6 A;  3N9Q A;  2K1J A;  5TDW A;  2MT5 A;  3KQI A;  4QF3 A;  4QF2 A;  4AVX A;  5FB1 A;  2L5U A;  3C5K A;  2G45 A;  5KH9 A;  2XEU A;  3RPG C;  2ECW A;  3O37 A;  4A0C D;  3HCT A;  4L58 A;  5G04 B;  5LKT A;  1VFY A;  2H0D A;  2CT2 A;  2H0D B;  3GL6 A;  4FJC A;  4YAT A;  4A49 A;  5KH7 A;  5AIT A;  4S3O B;  5LKU A;  4A4C A;  2KWJ A;  4LAD B;  4WZ0 A;  2KFT A;  4ZQL A;  2LN0 A;  2YSJ A;  2HYE D;  2ECJ A;  2LGG A;  1FBV A;  2M1R A;  2PUY A;  4LLB A;  2KE1 A;  3ZYQ A;  4S3O C;  2EOD A;  2KWN A;  2I50 A;  4WZ2 A;  2OXQ C;  2L80 A;  4W4U A;  3MHS A;  1WGM A;  2YRE A;  5TAB A;  2IDA A;  3LRQ A;  4V3K C;  2C2V S;  4A4B A;  3ZVY A;  1WEE A;  4B7Y C;  4B86 C;  3PUR A;  3N9M A;  2ECG A;  5B78 A;  4R8P K;  5J3X A;  4AYC A;  4R7E A;  3T7L A;  1WES A;  1WEP A;  5B75 A;  1LDJ B;  4LJN A;  1V87 A;  1JM7 A;  5LKZ A;  5H1V A;  2MA5 A;  2KU3 A;  4YAD A;  3RTR B;  3ZPV 1;  1WIM A;  2LRI C;  1G25 A;  2KYU A;  2FUI A;  2QIZ A;  1WFK A;  3SHB A;  3L11 A;  2YHN A;  2EA6 A;  5C13 A;  2RI7 A;  2YSM A;  2KGG A;  2EGP A;  4IC3 A;  1DVP A;  2FUU A;  5LCW B;  5H1T A;  2F6J A;  5FB0 A;  1XWH A;  2VPD A;  4AYC B;  1JOC A;  2LV9 A;  5D1K B;  1WEV A;  2MNY A;  3U5M A;  5C11 A;  1WEO A;  2VJE B;  2M6M A;  3HCS A;  2KIZ A;  3SOX A;  2JMI A;  3VK6 A;  5DKA A;  2CKL A;  3M62 A;  2KWK A;  2VPG A;  4L7X A;  4FO9 A;  5G05 B;  3KV6 A;  2G43 A;  2NAA A;  2F42 A;  4UP5 A;  3N9N A;  2Y1N A;  1WEW A;  2YT5 A;  5H9M A;  3LQJ A;  2LQ6 A;  1LDK C;  1X4I A;  4N4F A;  4MSX A;  1U6G B;  3O36 A;  4I7C A;  3IHP A;  3NG2 A;  3KV5 A;  2DX8 A;  4FIP A;  5B79 A;  4N3W A;  4PTB A;  4UI9 B;  1F62 A;  2VNF A;  2VJE A;  5I3L A;  5AIU A;  3C6W A;  5D1L B;  4X3G A;  3SOU A;  4GNE A;  2YUC A;  2MD7 B;  3U5O A;  4UP0 A;  2K16 A;  3N9O A;  2VJF A;  4ZDT A;  2YHO A;  2JRJ A;  4I7D A;  1WEU A;  2YU4 A;  5B8D A;  2MUM A;  2Y43 A;  2ECI A;  5B77 A;  2UZG A;  4YBT A;  1WEN A;  1BOR A;  5DIN A;  3MHH A;  3ASL A;  2G6Q A;  5H1U A;  2KRE A;  2M85 A;  4MVT A;  2E6S A;  2KGI A;  3HTK C;  2MNZ A;  1E4U A;  4CCG X;  4O64 A;  4WZ3 B;  4Q6F A;  1ZBD B;  1MM3 A;  4GNF A;  2YUR A;  4F52 B;  3KNV A;  2K4D A;  3EB5 A;  3LQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...