2VNFA

Molecular basis of histone h3k4me3 recognition by ing4
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
EPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INHIBITOR OF GROWTH PROTEIN 4
publication title Molecular Basis of Histone H3K4Me3 Recognition by Ing4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 7
structure length 50
sequence length 50
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vnfA00
5LKTA 2L75A 2VJFB 3M99A 4N3WA 2VJEB 5J3XA 3VK6A 4LJNA 2ZETC 4R7EA 3ZPVE 5C13A 2M1RA 5TBNA 2ECIA 5D1LB 2LGVA 2MD7B 3KV6A 4YBTA 1WEEA 4PTBA 5B8DA 4WZ3B 2ECTA 2JRJA 2QICA 3HCUA 4R2YA 2F6NA 2G43A 2KWKA 4WA6A 3MHSA 2JMIA 4GNFA 3ZYQA 1K2FA 5H1VA 3ZTGA 4GB0A 3O35A 1IYMA 4QF2A 2MIQA 3PHDA 2KIZA 1WGMA 3L1ZB 2CKLA 3DPLR 2MA5A 4ZUXU 3LQJA 2AN6A 5I3LA 3N9NA 5FERA 2E6SA 2H0DB 3EB6A 2KE1A 4S3OB 1VYXA 2F42A 4O64A 4XI1A 2JMJA 1X4UA 3O34A 2YURA 2LGLA 5KH9A 5JG6A 2CSYA 2RSDA 2VJEA 3N9MA 1FP0A 2EGPA 4LK9A 4WZ0A 1WE9A 2YUCA 2YSJA 2PNXA 2C2VS 4UP0A 2YHNA 1X4IA 4WZ2A 2RI7A 2VP7A 3C5KA 2E6RA 5H1UA 5LKZA 4P5OB 3PURA 1F62A 1FBVA 2LXPC 2M3HA 2L80A 3SOWA 4AP4A 2YREA 1WEWA 4V3KC 2YHOA 3ZNIA 3M63A 3M62A 2H0DA 2KU3A 4YBMA 1Z6UA 2FUUA 3ZVZB 2CT2A 4B86C 2CKLB 2LGKA 4YATA 2LV9A 3U5OA 2MNZA 2EA6A 2YQLA 1WFKA 4GNGA 2Y1NA 4I7BA 1LDJB 1MM2A 2VNFA 4AUQB 1VD4A 4AVXA 1U6GB 2ECNA 2K1JA 1RMDA 1LDKC 1WENA 4L7XA 2VPDA 1WEQA 2YQMA 1HYIA 4UP5A 4F52B 2LN0A 3T6RA 1E4UA 2KYUA 2KFTA 2KWJA 3N9LA 5DINA 5H1TA 2L0BA 1WEMA 3U5NA 2I50A 4S3OC 4Q6FA 3LQIA 4PPEA 1WEVA 1Z60A 1JM7A 3LQHA 4L58A 2FSAA 2MT5A 2MA6A 3NG2A 1DVPA 5AITA 1ZBDB 1MM3A 2VPBA 2LDRA 5B77A 1N87A 3HCSA 5TABA 5LKXA 4B7YC 2XEUA 4IC3A 2YU4A 3EB5A 1V87A 2XB1A 4TKPB 2Y1MA 2KGIA 2L5UA 2L43A 4FO9A 3V43A 4AYCA 4ZQLA 5D1MB 4IC2A 3N9OA 4CCGX 3SOXA 4N4FA 2KREA 3U5MA 2HDPA 4ZDTA 3RTRB 4A49A 5B76A 3ZPV1 2LQ6A 2VPEA 2MD8C 1HYJA 2QIZA 3ASLA 4MVTA 4YADA 4YABA 2YT5A 2JMDA 4LKAA 4QF3A 5D1KB 5TRBA 5LCWB 4V3LC 2PUYA 3N9QA 5KH7A 5LKUA 1Z2QA 1JM7B 2MUMA 3LRQA 3GL6A 4A0CD 2C2LA 2KR4A 2K17A 4LLBA 4C9ZA 2VPGA 3T7LA 3O36A 3MHHA 3N9PA 4GNDA 2M85A 1XWHA 3RPGB 4I7DA 3KQIA 2LXHC 3I2DA 1WEOA 5G04B 2K16A 5TDWA 5FEYA 1WEPA 4A4CA 2ECWA 4AYCB 3O37A 2BAYA 3L1XA 3U5PA 4BBQA 5FB1A 4FJCA 3HTKC 2KWNA 2EODA 2UZGA 2K4DA 2HYED 4X3GA 2KWOA 3KNVA 2KGGA 5AIUA 5C11A 1T1HA 2G6QA 2M6MA 4CA1A 4NN2A 3IHPA 3L11A 3SHBA 2OXQC 4W4UA 5DKAA 2CSZA 1BORA 5TDRA 3ZVYA 5B78A 3O70A 2NAAA 3KV5A 2IDAA 5FB0A 5B75A 4FIPA 2YW8A 5G05B 2LRIC 2QJ0A 1JOCA 2ECVA 4LADB 2VJFA 3C6WA 3SOUA 4I7CA 2ECGA 3FL2A 5B79A 3GV4A 5H9MA 4GNEA 4YC9A 2F6JA 4FK5A 1CHCA 3RPGC 3HCTA 1X4JA 1WESA 4YAXA 2G45A 4R8PK 2ECJA 2DX8A 5G0FA 1G25A 3O7AA 2MNYA 5EYAF 4UI9B 1WEUA 4A4BA 3QZVA 2YSMA 3PUQA 1WILA 1VFYA 3O33A 4BHWA 3DQVR 2Y43A 1WIMA 2LGGA 4YBSA 2D8SA 5KH3A 4MSXA 2FUIA 2YYRA
chains in the Genus database with same CATH superfamily
5LKTA 2L75A 2VJFB 3LVQE 3M99A 4N3WA 2VJEB 5J3XA 3VK6A 4LJNA 2ZETC 4R7EA 3ZPVE 5C13A 2M1RA 5TBNA 2ECIA 5D1LB 2LGVA 2MD7B 3KV6A 4YBTA 1WEEA 4PTBA 3FJUB 5B8DA 4WZ3B 2ECTA 2JRJA 4QQ4A 2QICA 3HCUA 4R2YA 2F6NA 2G43A 2KWKA 4WA6A 5SVIB 3MHSA 2JMIA 4GNFA 3ZYQA 1K2FA 5H1VA 3ZTGA 4GB0A 3O35A 1IYMA 4QF2A 2MIQA 3PHDA 2KIZA 1WGMA 3L1ZB 2CKLA 3DPLR 2MA5A 4ZUXU 3LQJA 2AN6A 5I3LA 3N9NA 5FERA 2E6SA 2H0DB 3EB6A 2KE1A 4Z0RA 4S3OB 1VYXA 2F42A 4O64A 4XI1A 2JMJA 1X4UA 3O34A 2YURA 2LGLA 5KH9A 5JG6A 2CSYA 2RSDA 4OGEA 2VJEA 3N9MA 1FP0A 2EGPA 4LK9A 4WZ0A 2YVRA 1WE9A 2YUCA 2YSJA 2PNXA 2C2VS 4UP0A 2XOYA 2YHNA 2CRWA 1X4IA 2D8UA 4WZ2A 2RI7A 2VP7A 3C5KA 2E6RA 5H1UA 5LKZA 4P5OB 3PURA 2KKYA 1F62A 1FBVA 2JUNA 2LXPC 2M3HA 2L80A 3SOWA 4AP4A 2YREA 1WEWA 4V3KC 2YHOA 3ZNIA 2MKEA 3M63A 3FANA 3M62A 2H0DA 2KKXA 2KU3A 4YBMA 1Z6UA 2FUUA 3ZVZB 2CT2A 4B86C 2CKLB 2LGKA 4YATA 2DJAA 2LV9A 3U5OA 3KDEC 2MNZA 2EA6A 2YQLA 1WFKA 4GNGA 2RR4A 2Y1NA 4I7BA 1LDJB 1MM2A 2VNFA 4AUQB 1VD4A 4AVXA 1U6GB 2ECNA 2K1JA 1RMDA 3DDTA 1LDKC 4OGCA 1WENA 4L7XA 2VPDA 1WEQA 2YQMA 1HYIA 4UP5A 4F52B 2LN0A 3SUBA 3T6RA 1E4UA 2KYUA 2KFTA 2CSVA 2KWJA 3N9LA 3MDBC 5DINA 5H1TA 2EGMA 2L0BA 1WEMA 3U5NA 2I50A 4S3OC 4Q6FA 3LQIA 4PPEA 1MBMA 1WEVA 1Z60A 1JM7A 3LQHA 4L58A 2FSAA 2MT5A 2MA6A 3DWDA 3NG2A 1DVPA 5AITA 1ZBDB 1MM3A 2VPBA 3O47A 2LDRA 5B77A 2DSMA 2P57A 1N87A 2XOZA 3HCSA 5TABA 5LKXA 2E61A 4B7YC 2XEUA 4IC3A 2YU4A 3JUEA 3EB5A 3FEHA 1V87A 2XB1A 4TKPB 2Y1MA 2KGIA 2M13A 2L5UA 2L43A 4FO9A 3V43A 4AYCA 4ZQLA 2L7PA 2EXUA 5D1MB 4IC2A 1DCQA 3N9OA 3Q1DA 4CCGX 3SOXA 4N4FA 2KREA 3U5MA 2HDPA 4ZDTA 3RTRB 5SVYA 4A49A 5B76A 3ZPV1 2LQ6A 2VPEA 2MD8C 2IQJA 4H9DA 1HYJA 2QIZA 3ASLA 4MVTA 4YADA 4YABA 2YT5A 2JMDA 4LKAA 4QF3A 5D1KB 5TRBA 5LCWB 4Z0OA 3PLWA 4V3LC 2PUYA 3N9QA 5KH7A 5LKUA 1Z2QA 1JM7B 2MUMA 3LRQA 3GL6A 4A0CD 2C2LA 2KR4A 2K17A 4LLBA 4C9ZA 2VPGA 3T7LA 3O36A 3M7KA 3MHHA 3N9PA 4GNDA 2M85A 1XWHA 3RPGB 4I7DA 3KQIA 2LXHC 3I2DA 4O62A 1WEOA 5G04B 2K16A 5TDWA 5SVXA 5FEYA 1WEPA 4A4CA 2ECWA 3FM8C 4AYCB 2B0OE 3O37A 2BAYA 3L1XA 3U5PA 3E2DA 4BBQA 5FB1A 5K3QA 4FJCA 3HTKC 2KWNA 2EODA 2UZGA 3FAOA 2K4DA 2HYED 4X3GA 2KWOA 3KNVA 2KGGA 5AIUA 5C11A 3T9KA 1T1HA 2G6QA 2M6MA 4CA1A 3LJUX 4NN2A 3IHPA 3L11A 3SHBA 2OXQC 4W4UA 5DKAA 2CSZA 1BORA 5TDRA 3ZVYA 5B78A 3O70A 2XOCA 2FD4A 2NAAA 3KV5A 2IDAA 2LAUA 5FB0A 5B75A 4FIPA 2YW8A 5G05B 2LRIC 2QJ0A 1JOCA 2ECVA 2CRRA 4LADB 3LDYA 2VJFA 3C6WA 2FFWA 2JM3A 3SOUA 4I7CA 2ECGA 3FL2A 5B79A 3GV4A 5H9MA 4GNEA 4YC9A 2F6JA 4FK5A 1CHCA 3RPGC 3HCTA 1X4JA 1WESA 4YAXA 5SVIA 2CONA 2G45A 4R8PK 2ECJA 2DX8A 5G0FA 1G25A 3O7AA 2MNYA 5EYAF 4UI9B 2OWAA 1WEUA 4A4BA 4F1PA 3QZVA 2YSMA 2XP0A 3PUQA 3LVRE 1WILA 3H7HA 1VFYA 3O33A 4BHWA 3DQVR 2Y43A 1WIMA 2LGGA 4YBSA 2D8SA 5KH3A 4MSXA 2FUIA 2YYRA
chains in the Genus database with same CATH topology
5LKTA 2L75A 2VJFB 3M99A 4N3WA 2VJEB 5J3XA 3VK6A 4LJNA 2ZETC 4R7EA 3ZPVE 5C13A 2M1RA 5TBNA 2ECIA 5D1LB 2LGVA 2MD7B 3KV6A 4YBTA 1WEEA 4PTBA 5B8DA 4WZ3B 2ECTA 2JRJA 2QICA 3HCUA 4R2YA 2F6NA 2G43A 2KWKA 4WA6A 3MHSA 2JMIA 4GNFA 3ZYQA 1K2FA 5H1VA 3ZTGA 4GB0A 3O35A 1IYMA 4QF2A 2MIQA 3PHDA 2KIZA 1WGMA 3L1ZB 2CKLA 3DPLR 2MA5A 4ZUXU 3LQJA 2AN6A 5I3LA 3N9NA 5FERA 2E6SA 2H0DB 3EB6A 2KE1A 4S3OB 1VYXA 2F42A 4O64A 4XI1A 2JMJA 1X4UA 3O34A 2YURA 2LGLA 5KH9A 5JG6A 2CSYA 2RSDA 2VJEA 3N9MA 1FP0A 2EGPA 4LK9A 4WZ0A 1WE9A 2YUCA 2YSJA 2PNXA 2C2VS 4UP0A 2YHNA 1X4IA 4WZ2A 2RI7A 2VP7A 3C5KA 2E6RA 5H1UA 5LKZA 4P5OB 3PURA 1F62A 1FBVA 2LXPC 2M3HA 2L80A 3SOWA 4AP4A 2YREA 1WEWA 4V3KC 2YHOA 3ZNIA 3M63A 3M62A 2H0DA 2KU3A 4YBMA 1Z6UA 2FUUA 3ZVZB 2CT2A 4B86C 2CKLB 2LGKA 4YATA 2LV9A 3U5OA 2MNZA 2EA6A 2YQLA 1WFKA 4GNGA 2Y1NA 4I7BA 1LDJB 1MM2A 2VNFA 4AUQB 1VD4A 4AVXA 1U6GB 2ECNA 2K1JA 1RMDA 1LDKC 1WENA 4L7XA 2VPDA 1WEQA 2YQMA 1HYIA 4UP5A 4F52B 2LN0A 3T6RA 1E4UA 2KYUA 2KFTA 2KWJA 3N9LA 5DINA 5H1TA 2L0BA 1WEMA 3U5NA 2I50A 4S3OC 4Q6FA 3LQIA 4PPEA 1WEVA 1Z60A 1JM7A 3LQHA 4L58A 2FSAA 2MT5A 2MA6A 3NG2A 1DVPA 5AITA 1ZBDB 1MM3A 2VPBA 2LDRA 5B77A 1N87A 3HCSA 5TABA 5LKXA 4B7YC 2XEUA 4IC3A 2YU4A 3EB5A 1V87A 2XB1A 4TKPB 2Y1MA 2KGIA 2L5UA 2L43A 4FO9A 3V43A 4AYCA 4ZQLA 5D1MB 4IC2A 3N9OA 4CCGX 3SOXA 4N4FA 2KREA 3U5MA 2HDPA 4ZDTA 3RTRB 4A49A 5B76A 3ZPV1 2LQ6A 2VPEA 2MD8C 1HYJA 2QIZA 3ASLA 4MVTA 4YADA 4YABA 2YT5A 2JMDA 4LKAA 4QF3A 5D1KB 5TRBA 5LCWB 4V3LC 2PUYA 3N9QA 5KH7A 5LKUA 1Z2QA 1JM7B 2MUMA 3LRQA 3GL6A 4A0CD 2C2LA 2KR4A 2K17A 4LLBA 4C9ZA 2VPGA 3T7LA 3O36A 3MHHA 3N9PA 4GNDA 2M85A 1XWHA 3RPGB 4I7DA 3KQIA 2LXHC 3I2DA 1WEOA 5G04B 2K16A 5TDWA 5FEYA 1WEPA 4A4CA 2ECWA 4AYCB 3O37A 2BAYA 3L1XA 3U5PA 4BBQA 5FB1A 4FJCA 3HTKC 2KWNA 2EODA 2UZGA 2K4DA 2HYED 4X3GA 2KWOA 3KNVA 2KGGA 5AIUA 5C11A 1T1HA 2G6QA 2M6MA 4CA1A 4NN2A 3IHPA 3L11A 3SHBA 2OXQC 4W4UA 5DKAA 2CSZA 1BORA 5TDRA 3ZVYA 5B78A 3O70A 2NAAA 3KV5A 2IDAA 5FB0A 5B75A 4FIPA 2YW8A 5G05B 2LRIC 2QJ0A 1JOCA 2ECVA 4LADB 2VJFA 3C6WA 3SOUA 4I7CA 2ECGA 3FL2A 5B79A 3GV4A 5H9MA 4GNEA 4YC9A 2F6JA 4FK5A 1CHCA 3RPGC 3HCTA 1X4JA 1WESA 4YAXA 2G45A 4R8PK 2ECJA 2DX8A 5G0FA 1G25A 3O7AA 2MNYA 5EYAF 4UI9B 1WEUA 4A4BA 3QZVA 2YSMA 3PUQA 1WILA 1VFYA 3O33A 4BHWA 3DQVR 2Y43A 1WIMA 2LGGA 4YBSA 2D8SA 5KH3A 4MSXA 2FUIA 2YYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKT A;  2L75 A;  2VJF B;  3M99 A;  4N3W A;  2VJE B;  5J3X A;  3VK6 A;  4LJN A;  2ZET C;  4R7E A;  3ZPV E;  5C13 A;  2M1R A;  5TBN A;  2ECI A;  5D1L B;  2LGV A;  2MD7 B;  3KV6 A;  4YBT A;  1WEE A;  4PTB A;  5B8D A;  4WZ3 B;  2ECT A;  2JRJ A;  2QIC A;  3HCU A;  4R2Y A;  2F6N A;  2G43 A;  2KWK A;  4WA6 A;  3MHS A;  2JMI A;  4GNF A;  3ZYQ A;  1K2F A;  5H1V A;  3ZTG A;  4GB0 A;  3O35 A;  1IYM A;  4QF2 A;  2MIQ A;  3PHD A;  2KIZ A;  1WGM A;  3L1Z B;  2CKL A;  3DPL R;  2MA5 A;  4ZUX U;  3LQJ A;  2AN6 A;  5I3L A;  3N9N A;  5FER A;  2E6S A;  2H0D B;  3EB6 A;  2KE1 A;  4S3O B;  1VYX A;  2F42 A;  4O64 A;  4XI1 A;  2JMJ A;  1X4U A;  3O34 A;  2YUR A;  2LGL A;  5KH9 A;  5JG6 A;  2CSY A;  2RSD A;  2VJE A;  3N9M A;  1FP0 A;  2EGP A;  4LK9 A;  4WZ0 A;  1WE9 A;  2YUC A;  2YSJ A;  2PNX A;  2C2V S;  4UP0 A;  2YHN A;  1X4I A;  4WZ2 A;  2RI7 A;  2VP7 A;  3C5K A;  2E6R A;  5H1U A;  5LKZ A;  4P5O B;  3PUR A;  1F62 A;  1FBV A;  2LXP C;  2M3H A;  2L80 A;  3SOW A;  4AP4 A;  2YRE A;  1WEW A;  4V3K C;  2YHO A;  3ZNI A;  3M63 A;  3M62 A;  2H0D A;  2KU3 A;  4YBM A;  1Z6U A;  2FUU A;  3ZVZ B;  2CT2 A;  4B86 C;  2CKL B;  2LGK A;  4YAT A;  2LV9 A;  3U5O A;  2MNZ A;  2EA6 A;  2YQL A;  1WFK A;  4GNG A;  2Y1N A;  4I7B A;  1LDJ B;  1MM2 A;  2VNF A;  4AUQ B;  1VD4 A;  4AVX A;  1U6G B;  2ECN A;  2K1J A;  1RMD A;  1LDK C;  1WEN A;  4L7X A;  2VPD A;  1WEQ A;  2YQM A;  1HYI A;  4UP5 A;  4F52 B;  2LN0 A;  3T6R A;  1E4U A;  2KYU A;  2KFT A;  2KWJ A;  3N9L A;  5DIN A;  5H1T A;  2L0B A;  1WEM A;  3U5N A;  2I50 A;  4S3O C;  4Q6F A;  3LQI A;  4PPE A;  1WEV A;  1Z60 A;  1JM7 A;  3LQH A;  4L58 A;  2FSA A;  2MT5 A;  2MA6 A;  3NG2 A;  1DVP A;  5AIT A;  1ZBD B;  1MM3 A;  2VPB A;  2LDR A;  5B77 A;  1N87 A;  3HCS A;  5TAB A;  5LKX A;  4B7Y C;  2XEU A;  4IC3 A;  2YU4 A;  3EB5 A;  1V87 A;  2XB1 A;  4TKP B;  2Y1M A;  2KGI A;  2L5U A;  2L43 A;  4FO9 A;  3V43 A;  4AYC A;  4ZQL A;  5D1M B;  4IC2 A;  3N9O A;  4CCG X;  3SOX A;  4N4F A;  2KRE A;  3U5M A;  2HDP A;  4ZDT A;  3RTR B;  4A49 A;  5B76 A;  3ZPV 1;  2LQ6 A;  2VPE A;  2MD8 C;  1HYJ A;  2QIZ A;  3ASL A;  4MVT A;  4YAD A;  4YAB A;  2YT5 A;  2JMD A;  4LKA A;  4QF3 A;  5D1K B;  5TRB A;  5LCW B;  4V3L C;  2PUY A;  3N9Q A;  5KH7 A;  5LKU A;  1Z2Q A;  1JM7 B;  2MUM A;  3LRQ A;  3GL6 A;  4A0C D;  2C2L A;  2KR4 A;  2K17 A;  4LLB A;  4C9Z A;  2VPG A;  3T7L A;  3O36 A;  3MHH A;  3N9P A;  4GND A;  2M85 A;  1XWH A;  3RPG B;  4I7D A;  3KQI A;  2LXH C;  3I2D A;  1WEO A;  5G04 B;  2K16 A;  5TDW A;  5FEY A;  1WEP A;  4A4C A;  2ECW A;  4AYC B;  3O37 A;  2BAY A;  3L1X A;  3U5P A;  4BBQ A;  5FB1 A;  4FJC A;  3HTK C;  2KWN A;  2EOD A;  2UZG A;  2K4D A;  2HYE D;  4X3G A;  2KWO A;  3KNV A;  2KGG A;  5AIU A;  5C11 A;  1T1H A;  2G6Q A;  2M6M A;  4CA1 A;  4NN2 A;  3IHP A;  3L11 A;  3SHB A;  2OXQ C;  4W4U A;  5DKA A;  2CSZ A;  1BOR A;  5TDR A;  3ZVY A;  5B78 A;  3O70 A;  2NAA A;  3KV5 A;  2IDA A;  5FB0 A;  5B75 A;  4FIP A;  2YW8 A;  5G05 B;  2LRI C;  2QJ0 A;  1JOC A;  2ECV A;  4LAD B;  2VJF A;  3C6W A;  3SOU A;  4I7C A;  2ECG A;  3FL2 A;  5B79 A;  3GV4 A;  5H9M A;  4GNE A;  4YC9 A;  2F6J A;  4FK5 A;  1CHC A;  3RPG C;  3HCT A;  1X4J A;  1WES A;  4YAX A;  2G45 A;  4R8P K;  2ECJ A;  2DX8 A;  5G0F A;  1G25 A;  3O7A A;  2MNY A;  5EYA F;  4UI9 B;  1WEU A;  4A4B A;  3QZV A;  2YSM A;  3PUQ A;  1WIL A;  1VFY A;  3O33 A;  4BHW A;  3DQV R;  2Y43 A;  1WIM A;  2LGG A;  4YBS A;  2D8S A;  5KH3 A;  4MSX A;  2FUI A;  2YYR A; 
#chains in the Genus database with same CATH topology
 5LKT A;  2L75 A;  2VJF B;  3LVQ E;  3M99 A;  4N3W A;  2VJE B;  5J3X A;  3VK6 A;  4LJN A;  2ZET C;  4R7E A;  3ZPV E;  5C13 A;  2M1R A;  5TBN A;  2ECI A;  5D1L B;  2LGV A;  2MD7 B;  3KV6 A;  4YBT A;  1WEE A;  4PTB A;  3FJU B;  5B8D A;  4WZ3 B;  2ECT A;  2JRJ A;  4QQ4 A;  2QIC A;  3HCU A;  4R2Y A;  2F6N A;  2G43 A;  2KWK A;  4WA6 A;  5SVI B;  3MHS A;  2JMI A;  4GNF A;  3ZYQ A;  1K2F A;  5H1V A;  3ZTG A;  4GB0 A;  3O35 A;  1IYM A;  4QF2 A;  2MIQ A;  3PHD A;  2KIZ A;  1WGM A;  3L1Z B;  2CKL A;  3DPL R;  2MA5 A;  4ZUX U;  3LQJ A;  2AN6 A;  5I3L A;  3N9N A;  5FER A;  2E6S A;  2H0D B;  3EB6 A;  2KE1 A;  4Z0R A;  4S3O B;  1VYX A;  2F42 A;  4O64 A;  4XI1 A;  2JMJ A;  1X4U A;  3O34 A;  2YUR A;  2LGL A;  5KH9 A;  5JG6 A;  2CSY A;  2RSD A;  4OGE A;  2VJE A;  3N9M A;  1FP0 A;  2EGP A;  4LK9 A;  4WZ0 A;  2YVR A;  1WE9 A;  2YUC A;  2YSJ A;  2PNX A;  2C2V S;  4UP0 A;  2XOY A;  2YHN A;  2CRW A;  1X4I A;  2D8U A;  4WZ2 A;  2RI7 A;  2VP7 A;  3C5K A;  2E6R A;  5H1U A;  5LKZ A;  4P5O B;  3PUR A;  2KKY A;  1F62 A;  1FBV A;  2JUN A;  2LXP C;  2M3H A;  2L80 A;  3SOW A;  4AP4 A;  2YRE A;  1WEW A;  4V3K C;  2YHO A;  3ZNI A;  2MKE A;  3M63 A;  3FAN A;  3M62 A;  2H0D A;  2KKX A;  2KU3 A;  4YBM A;  1Z6U A;  2FUU A;  3ZVZ B;  2CT2 A;  4B86 C;  2CKL B;  2LGK A;  4YAT A;  2DJA A;  2LV9 A;  3U5O A;  3KDE C;  2MNZ A;  2EA6 A;  2YQL A;  1WFK A;  4GNG A;  2RR4 A;  2Y1N A;  4I7B A;  1LDJ B;  1MM2 A;  2VNF A;  4AUQ B;  1VD4 A;  4AVX A;  1U6G B;  2ECN A;  2K1J A;  1RMD A;  3DDT A;  1LDK C;  4OGC A;  1WEN A;  4L7X A;  2VPD A;  1WEQ A;  2YQM A;  1HYI A;  4UP5 A;  4F52 B;  2LN0 A;  3SUB A;  3T6R A;  1E4U A;  2KYU A;  2KFT A;  2CSV A;  2KWJ A;  3N9L A;  3MDB C;  5DIN A;  5H1T A;  2EGM A;  2L0B A;  1WEM A;  3U5N A;  2I50 A;  4S3O C;  4Q6F A;  3LQI A;  4PPE A;  1MBM A;  1WEV A;  1Z60 A;  1JM7 A;  3LQH A;  4L58 A;  2FSA A;  2MT5 A;  2MA6 A;  3DWD A;  3NG2 A;  1DVP A;  5AIT A;  1ZBD B;  1MM3 A;  2VPB A;  3O47 A;  2LDR A;  5B77 A;  2DSM A;  2P57 A;  1N87 A;  2XOZ A;  3HCS A;  5TAB A;  5LKX A;  2E61 A;  4B7Y C;  2XEU A;  4IC3 A;  2YU4 A;  3JUE A;  3EB5 A;  3FEH A;  1V87 A;  2XB1 A;  4TKP B;  2Y1M A;  2KGI A;  2M13 A;  2L5U A;  2L43 A;  4FO9 A;  3V43 A;  4AYC A;  4ZQL A;  2L7P A;  2EXU A;  5D1M B;  4IC2 A;  1DCQ A;  3N9O A;  3Q1D A;  4CCG X;  3SOX A;  4N4F A;  2KRE A;  3U5M A;  2HDP A;  4ZDT A;  3RTR B;  5SVY A;  4A49 A;  5B76 A;  3ZPV 1;  2LQ6 A;  2VPE A;  2MD8 C;  2IQJ A;  4H9D A;  1HYJ A;  2QIZ A;  3ASL A;  4MVT A;  4YAD A;  4YAB A;  2YT5 A;  2JMD A;  4LKA A;  4QF3 A;  5D1K B;  5TRB A;  5LCW B;  4Z0O A;  3PLW A;  4V3L C;  2PUY A;  3N9Q A;  5KH7 A;  5LKU A;  1Z2Q A;  1JM7 B;  2MUM A;  3LRQ A;  3GL6 A;  4A0C D;  2C2L A;  2KR4 A;  2K17 A;  4LLB A;  4C9Z A;  2VPG A;  3T7L A;  3O36 A;  3M7K A;  3MHH A;  3N9P A;  4GND A;  2M85 A;  1XWH A;  3RPG B;  4I7D A;  3KQI A;  2LXH C;  3I2D A;  4O62 A;  1WEO A;  5G04 B;  2K16 A;  5TDW A;  5SVX A;  5FEY A;  1WEP A;  4A4C A;  2ECW A;  3FM8 C;  4AYC B;  2B0O E;  3O37 A;  2BAY A;  3L1X A;  3U5P A;  3E2D A;  4BBQ A;  5FB1 A;  5K3Q A;  4FJC A;  3HTK C;  2KWN A;  2EOD A;  2UZG A;  3FAO A;  2K4D A;  2HYE D;  4X3G A;  2KWO A;  3KNV A;  2KGG A;  5AIU A;  5C11 A;  3T9K A;  1T1H A;  2G6Q A;  2M6M A;  4CA1 A;  3LJU X;  4NN2 A;  3IHP A;  3L11 A;  3SHB A;  2OXQ C;  4W4U A;  5DKA A;  2CSZ A;  1BOR A;  5TDR A;  3ZVY A;  5B78 A;  3O70 A;  2XOC A;  2FD4 A;  2NAA A;  3KV5 A;  2IDA A;  2LAU A;  5FB0 A;  5B75 A;  4FIP A;  2YW8 A;  5G05 B;  2LRI C;  2QJ0 A;  1JOC A;  2ECV A;  2CRR A;  4LAD B;  3LDY A;  2VJF A;  3C6W A;  2FFW A;  2JM3 A;  3SOU A;  4I7C A;  2ECG A;  3FL2 A;  5B79 A;  3GV4 A;  5H9M A;  4GNE A;  4YC9 A;  2F6J A;  4FK5 A;  1CHC A;  3RPG C;  3HCT A;  1X4J A;  1WES A;  4YAX A;  5SVI A;  2CON A;  2G45 A;  4R8P K;  2ECJ A;  2DX8 A;  5G0F A;  1G25 A;  3O7A A;  2MNY A;  5EYA F;  4UI9 B;  2OWA A;  1WEU A;  4A4B A;  4F1P A;  3QZV A;  2YSM A;  2XP0 A;  3PUQ A;  3LVR E;  1WIL A;  3H7H A;  1VFY A;  3O33 A;  4BHW A;  3DQV R;  2Y43 A;  1WIM A;  2LGG A;  4YBS A;  2D8S A;  5KH3 A;  4MSX A;  2FUI A;  2YYR A; 
#chains in the Genus database with same CATH homology
 5LKT A;  2L75 A;  2VJF B;  3M99 A;  4N3W A;  2VJE B;  5J3X A;  3VK6 A;  4LJN A;  2ZET C;  4R7E A;  3ZPV E;  5C13 A;  2M1R A;  5TBN A;  2ECI A;  5D1L B;  2LGV A;  2MD7 B;  3KV6 A;  4YBT A;  1WEE A;  4PTB A;  5B8D A;  4WZ3 B;  2ECT A;  2JRJ A;  2QIC A;  3HCU A;  4R2Y A;  2F6N A;  2G43 A;  2KWK A;  4WA6 A;  3MHS A;  2JMI A;  4GNF A;  3ZYQ A;  1K2F A;  5H1V A;  3ZTG A;  4GB0 A;  3O35 A;  1IYM A;  4QF2 A;  2MIQ A;  3PHD A;  2KIZ A;  1WGM A;  3L1Z B;  2CKL A;  3DPL R;  2MA5 A;  4ZUX U;  3LQJ A;  2AN6 A;  5I3L A;  3N9N A;  5FER A;  2E6S A;  2H0D B;  3EB6 A;  2KE1 A;  4S3O B;  1VYX A;  2F42 A;  4O64 A;  4XI1 A;  2JMJ A;  1X4U A;  3O34 A;  2YUR A;  2LGL A;  5KH9 A;  5JG6 A;  2CSY A;  2RSD A;  2VJE A;  3N9M A;  1FP0 A;  2EGP A;  4LK9 A;  4WZ0 A;  1WE9 A;  2YUC A;  2YSJ A;  2PNX A;  2C2V S;  4UP0 A;  2YHN A;  1X4I A;  4WZ2 A;  2RI7 A;  2VP7 A;  3C5K A;  2E6R A;  5H1U A;  5LKZ A;  4P5O B;  3PUR A;  1F62 A;  1FBV A;  2LXP C;  2M3H A;  2L80 A;  3SOW A;  4AP4 A;  2YRE A;  1WEW A;  4V3K C;  2YHO A;  3ZNI A;  3M63 A;  3M62 A;  2H0D A;  2KU3 A;  4YBM A;  1Z6U A;  2FUU A;  3ZVZ B;  2CT2 A;  4B86 C;  2CKL B;  2LGK A;  4YAT A;  2LV9 A;  3U5O A;  2MNZ A;  2EA6 A;  2YQL A;  1WFK A;  4GNG A;  2Y1N A;  4I7B A;  1LDJ B;  1MM2 A;  2VNF A;  4AUQ B;  1VD4 A;  4AVX A;  1U6G B;  2ECN A;  2K1J A;  1RMD A;  1LDK C;  1WEN A;  4L7X A;  2VPD A;  1WEQ A;  2YQM A;  1HYI A;  4UP5 A;  4F52 B;  2LN0 A;  3T6R A;  1E4U A;  2KYU A;  2KFT A;  2KWJ A;  3N9L A;  5DIN A;  5H1T A;  2L0B A;  1WEM A;  3U5N A;  2I50 A;  4S3O C;  4Q6F A;  3LQI A;  4PPE A;  1WEV A;  1Z60 A;  1JM7 A;  3LQH A;  4L58 A;  2FSA A;  2MT5 A;  2MA6 A;  3NG2 A;  1DVP A;  5AIT A;  1ZBD B;  1MM3 A;  2VPB A;  2LDR A;  5B77 A;  1N87 A;  3HCS A;  5TAB A;  5LKX A;  4B7Y C;  2XEU A;  4IC3 A;  2YU4 A;  3EB5 A;  1V87 A;  2XB1 A;  4TKP B;  2Y1M A;  2KGI A;  2L5U A;  2L43 A;  4FO9 A;  3V43 A;  4AYC A;  4ZQL A;  5D1M B;  4IC2 A;  3N9O A;  4CCG X;  3SOX A;  4N4F A;  2KRE A;  3U5M A;  2HDP A;  4ZDT A;  3RTR B;  4A49 A;  5B76 A;  3ZPV 1;  2LQ6 A;  2VPE A;  2MD8 C;  1HYJ A;  2QIZ A;  3ASL A;  4MVT A;  4YAD A;  4YAB A;  2YT5 A;  2JMD A;  4LKA A;  4QF3 A;  5D1K B;  5TRB A;  5LCW B;  4V3L C;  2PUY A;  3N9Q A;  5KH7 A;  5LKU A;  1Z2Q A;  1JM7 B;  2MUM A;  3LRQ A;  3GL6 A;  4A0C D;  2C2L A;  2KR4 A;  2K17 A;  4LLB A;  4C9Z A;  2VPG A;  3T7L A;  3O36 A;  3MHH A;  3N9P A;  4GND A;  2M85 A;  1XWH A;  3RPG B;  4I7D A;  3KQI A;  2LXH C;  3I2D A;  1WEO A;  5G04 B;  2K16 A;  5TDW A;  5FEY A;  1WEP A;  4A4C A;  2ECW A;  4AYC B;  3O37 A;  2BAY A;  3L1X A;  3U5P A;  4BBQ A;  5FB1 A;  4FJC A;  3HTK C;  2KWN A;  2EOD A;  2UZG A;  2K4D A;  2HYE D;  4X3G A;  2KWO A;  3KNV A;  2KGG A;  5AIU A;  5C11 A;  1T1H A;  2G6Q A;  2M6M A;  4CA1 A;  4NN2 A;  3IHP A;  3L11 A;  3SHB A;  2OXQ C;  4W4U A;  5DKA A;  2CSZ A;  1BOR A;  5TDR A;  3ZVY A;  5B78 A;  3O70 A;  2NAA A;  3KV5 A;  2IDA A;  5FB0 A;  5B75 A;  4FIP A;  2YW8 A;  5G05 B;  2LRI C;  2QJ0 A;  1JOC A;  2ECV A;  4LAD B;  2VJF A;  3C6W A;  3SOU A;  4I7C A;  2ECG A;  3FL2 A;  5B79 A;  3GV4 A;  5H9M A;  4GNE A;  4YC9 A;  2F6J A;  4FK5 A;  1CHC A;  3RPG C;  3HCT A;  1X4J A;  1WES A;  4YAX A;  2G45 A;  4R8P K;  2ECJ A;  2DX8 A;  5G0F A;  1G25 A;  3O7A A;  2MNY A;  5EYA F;  4UI9 B;  1WEU A;  4A4B A;  3QZV A;  2YSM A;  3PUQ A;  1WIL A;  1VFY A;  3O33 A;  4BHW A;  3DQV R;  2Y43 A;  1WIM A;  2LGG A;  4YBS A;  2D8S A;  5KH3 A;  4MSX A;  2FUI A;  2YYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...